BLAST/PSIBLAST alignment of GI: 254780707 and GI: 241202932 at iteration 1
>gi|241202932|ref|YP_002974028.1| phosphate ABC transporter substrate-binding protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 344
>gi|240856822|gb|ACS54489.1| phosphate ABC transporter, substrate-binding protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 344
 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/321 (53%), Positives = 224/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE + CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRPINKNEAEACKAAGVTDIQEVKIGYDGIVFATDASNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGATDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                Q   AC +VR+DG+A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 204 ADKAAQ-GKACVAVRKDGVAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PDS L +YG
Sbjct: 263 MSGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 323 LVAAPDAERDAIRKDVEAGKS 343