BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780707|ref|YP_003065120.1| putative phosphate-binding
periplasmic protein [Candidatus Liberibacter asiaticus str. psy62]
         (346 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780707|ref|YP_003065120.1| putative phosphate-binding periplasmic protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040384|gb|ACT57180.1| putative phosphate-binding periplasmic protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 346

 Score =  705 bits (1820), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/346 (100%), Positives = 346/346 (100%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE
Sbjct: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD
Sbjct: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE
Sbjct: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV
Sbjct: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG
Sbjct: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG
Sbjct: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346


>gi|315121872|ref|YP_004062361.1| putative phosphate-binding periplasmic protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495274|gb|ADR51873.1| putative phosphate-binding periplasmic protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 355

 Score =  561 bits (1446), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 267/345 (77%), Positives = 310/345 (89%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MRFFFVV+ CFV    YCGT  FARNRIRIAGSST FPYSKIIAENFSEYFPEFKTPFVE
Sbjct: 1   MRFFFVVITCFVFWTTYCGTEIFARNRIRIAGSSTFFPYSKIIAENFSEYFPEFKTPFVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLKEFC+GIG+DTIDIVNSSRKITQ+ELDECKK GVS+IQEVTIG+DGI+LVSD
Sbjct: 61  SGGSSAGLKEFCKGIGEDTIDIVNSSRKITQSELDECKKKGVSEIQEVTIGYDGIVLVSD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++MV+VSLT+EDLYKALAS LIV+  +V NP KKWS+IR D P++RI+IYVPS KHGTRE
Sbjct: 121 KNMVNVSLTIEDLYKALASKLIVNGLLVSNPFKKWSDIRSDLPKIRISIYVPSEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           ++E+KVL+EGCVRS NFSKMRD+FK+N  Q+ +ACT VR+DG+AIEVDGDYTETLARIEV
Sbjct: 181 IIEQKVLREGCVRSGNFSKMRDIFKHNASQVDMACTFVRKDGVAIEVDGDYTETLARIEV 240

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NKD+FGF+GLSFYKNNAD+L LV IDG++PS+ TI+SG+YPISRPLLFYVK+ HF +VLG
Sbjct: 241 NKDIFGFLGLSFYKNNADILNLVSIDGVIPSVDTILSGVYPISRPLLFYVKKSHFINVLG 300

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           LREYVSFS+SDEMM   SQL QYGLIPI N++RK V+DSIA+ K+
Sbjct: 301 LREYVSFSLSDEMMDSGSQLIQYGLIPIPNKDRKIVQDSIAIEKN 345


>gi|15964262|ref|NP_384615.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           meliloti 1021]
 gi|307307000|ref|ZP_07586739.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           meliloti BL225C]
 gi|307320654|ref|ZP_07600067.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           meliloti AK83]
 gi|15073439|emb|CAC45081.1| Phosphate binding periplasmic protein [Sinorhizobium meliloti 1021]
 gi|306893689|gb|EFN24462.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           meliloti AK83]
 gi|306901940|gb|EFN32539.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           meliloti BL225C]
          Length = 344

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/319 (54%), Positives = 229/319 (71%), Gaps = 1/319 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AENF E FP+FKTP VESGGSS GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAENFGETFPDFKTPVVESGGSSAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSRKI  +E++ CK  GV++IQEV IG+DGI+  +D     ++L  E LYKALA+ ++VD
Sbjct: 84  SSRKIKDSEVEACKAAGVTEIQEVKIGYDGIVFATDAGNADLALKPEHLYKALAAEIVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+    P+  IA Y+P  KHGTREV E+K+L  GC  S     ++   
Sbjct: 144 GKLVANPYKKWSEVDASLPDAEIAAYIPGEKHGTREVFEEKILAAGCKDSGAQDVIKAAV 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
               QQ S  C +VR+DG+A+++DGDYTETLARI  NK+  G  GLSFY+NNAD LK+  
Sbjct: 204 SDEKQQFS-KCVAVRKDGMAVDIDGDYTETLARIASNKNGIGVFGLSFYENNADKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++GIVPS  TI SG YP+SRPL FYVK+ H   + GL+EYV F V D+M+ PDS L +YG
Sbjct: 263 VNGIVPSTETIASGEYPVSRPLFFYVKKAHIGVIPGLKEYVEFFVDDQMIGPDSPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAVG 343
           L+   + ER+ +R S   G
Sbjct: 323 LVAAPDAEREEIRTSFEAG 341


>gi|86356163|ref|YP_468055.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli CFN 42]
 gi|86280265|gb|ABC89328.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli CFN 42]
          Length = 344

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/321 (53%), Positives = 224/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I+IAGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQIAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NEL+ CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRSINKNELEACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                Q   AC +VR+DG A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 204 SDKAAQTK-ACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PD  L +YG
Sbjct: 263 VNGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDGPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 323 LVAAPDAERDAIRKDVEAGKS 343


>gi|116250314|ref|YP_766152.1| solute-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115254962|emb|CAK06036.1| putative solute-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 344

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 173/321 (53%), Positives = 226/321 (70%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGGS  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPIVESGGSGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR I +NEL+ CK  GV+DIQEV IG+DGI+  +D     ++    D+YKALA+ ++VD
Sbjct: 84  SSRPINKNELEACKAAGVTDIQEVKIGYDGIVFATDASNPDLAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGATDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                Q   AC +VR+DG+A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 204 ADKAAQ-GKACVAVRKDGVAVDIDGDYPETLARIAANKTGLGVFGLSFYENNADKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PDS L +YG
Sbjct: 263 MSGIVPSTETISNGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER+++R  +  GK+
Sbjct: 323 LVAAPDAEREAIRKEVEAGKA 343


>gi|150395347|ref|YP_001325814.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           medicae WSM419]
 gi|150026862|gb|ABR58979.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           medicae WSM419]
          Length = 344

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/319 (53%), Positives = 229/319 (71%), Gaps = 1/319 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AENF E FP+FKTP +ESGGSS GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAENFGETFPDFKTPVIESGGSSAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSRKI  +E++ CK  GV++IQEV IG+DGI+  +D     ++L  E LYKALA+ ++VD
Sbjct: 84  SSRKIKDSEVEACKAAGVTEIQEVKIGYDGIVFATDAGNADLTLKPEHLYKALAAEIVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+    P+  IA Y+P  KHGTREV E+K+L  GC  S     ++   
Sbjct: 144 GKLVANPYKKWSEVDASLPDAEIAAYIPGEKHGTREVFEEKILAAGCKDSGAQDVIKAAV 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
               QQ S  C +VR+DG+A+++DGDYTETLARI  NK+  G  GLSF++NNAD LK+  
Sbjct: 204 SDEKQQHS-KCVAVRKDGMAVDIDGDYTETLARIASNKNGIGVFGLSFFENNADKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++G+VPS  TI SG YP+SRPL FYVK+ H   + GL+EYV F V D+M+ PDS L +YG
Sbjct: 263 VNGVVPSTETIASGEYPVSRPLFFYVKKAHIGVIPGLKEYVEFFVDDQMIGPDSPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAVG 343
           L+   + ER+ +R S   G
Sbjct: 323 LVAAPDAEREEIRQSFEAG 341


>gi|190890212|ref|YP_001976754.1| phosphate ABC transporter substrate-binding protein [Rhizobium etli
           CIAT 652]
 gi|190695491|gb|ACE89576.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli CIAT 652]
          Length = 344

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/321 (53%), Positives = 223/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE D CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRPINKNEADACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                Q   AC +VR+DG A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 204 SDKAAQ-GKACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PD  L +YG
Sbjct: 263 VNGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDGPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 323 LVAAPDAERDAIRKDVEAGKS 343


>gi|209547777|ref|YP_002279694.1| phosphate ABC transporter substrate-binding protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533533|gb|ACI53468.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 344

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/321 (53%), Positives = 223/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE + CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRPINKNEAEACKAAGVTDIQEVKIGYDGIVFATDASNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                Q   AC +VR+DG A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 204 ADKAAQTK-ACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PDS L +YG
Sbjct: 263 MSGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 323 LVAAPDAERDAIRKDVEAGKS 343


>gi|241202932|ref|YP_002974028.1| phosphate ABC transporter substrate-binding protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240856822|gb|ACS54489.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 344

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 172/321 (53%), Positives = 224/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE + CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRPINKNEAEACKAAGVTDIQEVKIGYDGIVFATDASNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGATDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                Q   AC +VR+DG+A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 204 ADKAAQ-GKACVAVRKDGVAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PDS L +YG
Sbjct: 263 MSGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 323 LVAAPDAERDAIRKDVEAGKS 343


>gi|327192732|gb|EGE59668.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli CNPAF512]
          Length = 366

 Score =  368 bits (944), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 171/321 (53%), Positives = 223/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 46  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 105

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE + CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 106 ASRPINKNEAEACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYVPADIYKALAAQVVVD 165

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 166 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEI 225

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                Q   AC +VR+DG A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 226 SDKAAQ-GKACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 284

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PD  L +YG
Sbjct: 285 VNGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDGPLAEYG 344

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 345 LVAAPDAERDAIRKDVEAGKS 365


>gi|227820729|ref|YP_002824699.1| predicted phosphate ABC transporter, substrate-binding protein
           [Sinorhizobium fredii NGR234]
 gi|227339728|gb|ACP23946.1| predicted phosphate ABC transporter, substrate-binding protein
           [Sinorhizobium fredii NGR234]
          Length = 344

 Score =  365 bits (937), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 173/322 (53%), Positives = 225/322 (69%), Gaps = 7/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE F E FP+FKTP VESGGSS GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAETFGETFPDFKTPVVESGGSSAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSRKI  +E++ CK  GV++IQEV IG+DGI+  +D     ++L  E LYKALA+ ++VD
Sbjct: 84  SSRKIKDSEVEACKAAGVTEIQEVKIGYDGIVFATDAGNADLALKPEQLYKALAAEVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSEI    P+  IA Y+P  KHGTREV E+K+L  GC  +       D+ 
Sbjct: 144 GKLVANPYKKWSEIDASLPDAEIAAYIPGEKHGTREVFEEKILAHGCKDAGAV----DVI 199

Query: 205 KYNVQQLSVA---CTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
           K  +     A   C +VR+DG+A+++DGDYTETLARI  NK   G  GLSFY+NNAD LK
Sbjct: 200 KAAISDEKAAAKKCVAVRKDGLAVDIDGDYTETLARIASNKSGIGVFGLSFYENNADKLK 259

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +  + GIVPS  TI SG YP+SRPL FYVK+ H   V GL+EYV F V D+M+ PD  L 
Sbjct: 260 VATVSGIVPSTETIASGEYPVSRPLFFYVKKAHLGVVPGLKEYVEFFVDDQMIGPDGPLA 319

Query: 322 QYGLIPISNEERKSVRDSIAVG 343
           +YGL+   + ER+ +R +   G
Sbjct: 320 EYGLVAAPDAEREEIRKTFEAG 341


>gi|218672744|ref|ZP_03522413.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli GR56]
          Length = 350

 Score =  363 bits (932), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 168/319 (52%), Positives = 224/319 (70%), Gaps = 1/319 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE + CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRAINKNEAEACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGATDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                Q   AC +VR+DG A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 204 SDKAAQ-GKACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++GIVPS+ TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ P+  L +YG
Sbjct: 263 VNGIVPSVETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPEGPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAVG 343
           L+   + ER+++R ++  G
Sbjct: 323 LVAAPDAEREAIRKAVEAG 341


>gi|15887768|ref|NP_353449.1| ABC transporter, substrate binding protein (phosphate)
           [Agrobacterium tumefaciens str. C58]
 gi|15155338|gb|AAK86234.1| ABC transporter, substrate binding protein (phosphate)
           [Agrobacterium tumefaciens str. C58]
          Length = 344

 Score =  362 bits (928), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 224/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE F+E FP FK P VESGG+  GLK FC G+G+ TIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAETFAETFPNFKAPVVESGGTGGGLKAFCSGVGEGTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I  +EL  CK  GV+D+QEV IG+DGI+   D     + L  +DLY ALA+ ++ D
Sbjct: 84  ASRPIKSDELAACKAAGVADVQEVKIGYDGIVFAMDSSNKDIKLEPKDLYLALAAEIVKD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSEI  + P+V IA Y+P  KHGTREV E+K++ +GC  ++    ++ + 
Sbjct: 144 GKLVANPYKKWSEINKELPDVAIAAYIPGSKHGTREVFEEKIMADGCKEAKATDAIKALI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +Q +  C +VR+DG A+++DGDYTETLARI+ NK   G  GL+FY+NNAD LK+  
Sbjct: 204 T-DAKQAAAKCVAVRKDGAAVDIDGDYTETLARIDANKTGLGVFGLAFYENNADRLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+VPS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F VSDEM+ PDS L  YG
Sbjct: 263 VSGVVPSTETVASGKYPVSRPLFFYVKKAHLGVIPGLKEYVEFFVSDEMIGPDSPLANYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   ++ER+ +R   A G S
Sbjct: 323 LVAAPDKEREEIRSKFAAGAS 343


>gi|325291853|ref|YP_004277717.1| phosphate ABC transporter substrate-binding protein [Agrobacterium
           sp. H13-3]
 gi|325059706|gb|ADY63397.1| phosphate ABC transporter, substrate binding protein [Agrobacterium
           sp. H13-3]
          Length = 344

 Score =  361 bits (927), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 223/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE F+E FP FK P VESGG+  GLK FC G+G+ TIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAETFAETFPNFKAPVVESGGTGGGLKAFCSGVGEGTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I  +EL  CK  GV+D+QEV IG+DGI+   D     + L  +DLY ALA+ ++ D
Sbjct: 84  ASRPIKSDELAACKAAGVADVQEVKIGYDGIVFAMDSSNKDIKLEPKDLYLALAAEIVKD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSEI  + P+V IA Y+P  KHGTREV E+K++ +GC  ++    ++ + 
Sbjct: 144 GKLVANPYKKWSEINKELPDVAIAAYIPGSKHGTREVFEEKIMADGCKEAKATDAIKALI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +Q +  C +VR+DG A+++DGDYTETLARI+ NK   G  GL+FY+NNAD LK+  
Sbjct: 204 T-DAKQAAAKCVAVRKDGAAVDIDGDYTETLARIDANKTGLGVFGLAFYENNADRLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+VPS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F VSDEM+ PDS L  YG
Sbjct: 263 VSGVVPSTETVASGKYPVSRPLFFYVKKAHLGVIPGLKEYVEFFVSDEMIGPDSPLANYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+    +ER+ +R   A G S
Sbjct: 323 LVAAPEKEREEIRSKFAAGAS 343


>gi|222084779|ref|YP_002543308.1| phosphate ABC transporter [Agrobacterium radiobacter K84]
 gi|221722227|gb|ACM25383.1| phosphate ABC transporter [Agrobacterium radiobacter K84]
          Length = 344

 Score =  360 bits (924), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 172/336 (51%), Positives = 224/336 (66%), Gaps = 1/336 (0%)

Query: 9   MCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGL 68
           +  +V  V       AR++I+I+GSST+FPY+KI+AE F E F  +KTP VESGGS  GL
Sbjct: 8   IAALVASVTFAGAAMARDQIQISGSSTVFPYAKIVAETFGETFTNYKTPVVESGGSGAGL 67

Query: 69  KEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSL 128
           KEFC+G+G D+IDI NSSR I  +E+D CK  GV+DIQ+V IG+DGI+   D+    +  
Sbjct: 68  KEFCKGVGPDSIDIANSSRPIKGSEVDACKAAGVADIQQVKIGYDGIVFAYDKSNPDIRF 127

Query: 129 TVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQ 188
              DLYKALA+ ++V+ K+V NP KKWSEI P  P+  IA Y+P  KHGTREV E+KVL 
Sbjct: 128 VPTDLYKALAAEVVVNGKLVANPYKKWSEINPALPDFEIAAYIPGEKHGTREVFEEKVLA 187

Query: 189 EGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFV 248
            GC  S     ++       +Q    C +VR+DG+A+++DGDY ETLARI  NK   G  
Sbjct: 188 AGCKDSGALDVIKAAVPDAGKQAE-KCIAVRKDGVAVDIDGDYPETLARINANKHGVGVF 246

Query: 249 GLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFS 308
           GL FY+NNAD LK+  + GIVPS  TI  G YP+SRPL FYVK+ H   + GL+EYV F 
Sbjct: 247 GLYFYQNNADKLKVATVGGIVPSGQTIADGTYPVSRPLFFYVKKAHLGVIPGLKEYVDFF 306

Query: 309 VSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
            SD+M+ PDS L +YGL+P  + ER  +R  +A GK
Sbjct: 307 TSDQMIGPDSPLAEYGLVPAPDAERDQIRKDVANGK 342


>gi|319781149|ref|YP_004140625.1| phosphate ABC transporter phosphate-binding protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317167037|gb|ADV10575.1| phosphate ABC transporter, phosphate-binding protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 342

 Score =  352 bits (904), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 165/322 (51%), Positives = 225/322 (69%), Gaps = 4/322 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I++AGSST+ PY+KI+AE F E F  FKTP VESGGS  G+KEFC+G+G+DTIDI 
Sbjct: 24  ARDQIQVAGSSTVLPYAKIVAEQFGETFTNFKTPVVESGGSGAGIKEFCKGVGEDTIDIA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           NSSR I  +EL  C   GV ++QEV IG+DGI+  +D      +L   D+YKALA+ L+V
Sbjct: 84  NSSRPIKADELKSCAAAGVKEVQEVRIGYDGIVFATDIKGPDWALVPADIYKALAAKLVV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP  KWS++ P  P+  IA Y+P  KHGTREV E K+L  GC +    + ++  
Sbjct: 144 DGKLVDNPNTKWSQVNPKLPDWDIAAYIPGEKHGTREVFETKLLDAGCDK----AALKAA 199

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +++   C ++R+DG A+++DGDYTETLARI+ NK   G  GL+FY+NNAD LK+ 
Sbjct: 200 GVADDKEIGKTCIAIRKDGKAVDIDGDYTETLARIDSNKTGVGVFGLAFYENNADKLKVA 259

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++GIVPS  TI SG YP+SRPL FYVK+ H   V GL+EYV F + D+M+ P+S L +Y
Sbjct: 260 TVEGIVPSTETIASGKYPVSRPLFFYVKKAHLGVVPGLKEYVEFFLDDQMVGPESPLAEY 319

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+   + ER++ RD+ A GKS
Sbjct: 320 GLVAAPDAERQAQRDAFAAGKS 341


>gi|62290977|ref|YP_222770.1| phosphate ABC transporter phosphate-binding protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82700887|ref|YP_415461.1| hypothetical protein BAB1_2141 [Brucella melitensis biovar Abortus
           2308]
 gi|163844153|ref|YP_001628558.1| hypothetical protein BSUIS_A1977 [Brucella suis ATCC 23445]
 gi|189025190|ref|YP_001935958.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           abortus S19]
 gi|225626508|ref|ZP_03784547.1| phosphate ABC transporter, phosphate-binding protein [Brucella ceti
           str. Cudo]
 gi|225853565|ref|YP_002733798.1| hypothetical protein BMEA_A2199 [Brucella melitensis ATCC 23457]
 gi|237816481|ref|ZP_04595474.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           abortus str. 2308 A]
 gi|254690272|ref|ZP_05153526.1| hypothetical protein Babob68_08887 [Brucella abortus bv. 6 str.
           870]
 gi|254694759|ref|ZP_05156587.1| hypothetical protein Babob3T_08878 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696387|ref|ZP_05158215.1| hypothetical protein Babob28_01393 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700769|ref|ZP_05162597.1| hypothetical protein Bsuib55_07912 [Brucella suis bv. 5 str. 513]
 gi|254707344|ref|ZP_05169172.1| hypothetical protein BpinM_10305 [Brucella pinnipedialis
           M163/99/10]
 gi|254709114|ref|ZP_05170925.1| hypothetical protein BpinB_02372 [Brucella pinnipedialis B2/94]
 gi|254713460|ref|ZP_05175271.1| hypothetical protein BcetM6_08914 [Brucella ceti M644/93/1]
 gi|254716184|ref|ZP_05177995.1| hypothetical protein BcetM_07081 [Brucella ceti M13/05/1]
 gi|254718178|ref|ZP_05179989.1| hypothetical protein Bru83_01291 [Brucella sp. 83/13]
 gi|254731301|ref|ZP_05189879.1| hypothetical protein Babob42_08915 [Brucella abortus bv. 4 str.
           292]
 gi|256030640|ref|ZP_05444254.1| hypothetical protein BpinM2_08302 [Brucella pinnipedialis
           M292/94/1]
 gi|256045744|ref|ZP_05448622.1| hypothetical protein Bmelb1R_14660 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060101|ref|ZP_05450283.1| hypothetical protein Bneo5_07051 [Brucella neotomae 5K33]
 gi|256112463|ref|ZP_05453384.1| hypothetical protein Bmelb3E_07253 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158642|ref|ZP_05456525.1| hypothetical protein BcetM4_07216 [Brucella ceti M490/95/1]
 gi|256254046|ref|ZP_05459582.1| hypothetical protein BcetB_07058 [Brucella ceti B1/94]
 gi|256258525|ref|ZP_05464061.1| hypothetical protein Babob9C_14492 [Brucella abortus bv. 9 str.
           C68]
 gi|256262951|ref|ZP_05465483.1| phosphate ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|256370534|ref|YP_003108045.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           microti CCM 4915]
 gi|260169544|ref|ZP_05756355.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           F5/99]
 gi|260546241|ref|ZP_05821981.1| phosphate ABC transporter [Brucella abortus NCTC 8038]
 gi|260563040|ref|ZP_05833526.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. 16M]
 gi|260755811|ref|ZP_05868159.1| phosphate ABC transporter [Brucella abortus bv. 6 str. 870]
 gi|260759034|ref|ZP_05871382.1| phosphate ABC transporter [Brucella abortus bv. 4 str. 292]
 gi|260760759|ref|ZP_05873102.1| phosphate ABC transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884836|ref|ZP_05896450.1| phosphate ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|261215086|ref|ZP_05929367.1| phosphate ABC transporter [Brucella abortus bv. 3 str. Tulya]
 gi|261217957|ref|ZP_05932238.1| phosphate ABC transporter [Brucella ceti M13/05/1]
 gi|261221186|ref|ZP_05935467.1| phosphate ABC transporter [Brucella ceti B1/94]
 gi|261314827|ref|ZP_05954024.1| phosphate ABC transporter [Brucella pinnipedialis M163/99/10]
 gi|261316614|ref|ZP_05955811.1| phosphate ABC transporter [Brucella pinnipedialis B2/94]
 gi|261321193|ref|ZP_05960390.1| phosphate ABC transporter [Brucella ceti M644/93/1]
 gi|261324077|ref|ZP_05963274.1| phosphate ABC transporter [Brucella neotomae 5K33]
 gi|261751278|ref|ZP_05994987.1| phosphate ABC transporter [Brucella suis bv. 5 str. 513]
 gi|261759071|ref|ZP_06002780.1| phosphate ABC transporter [Brucella sp. F5/99]
 gi|265983135|ref|ZP_06095870.1| phosphate ABC transporter [Brucella sp. 83/13]
 gi|265987686|ref|ZP_06100243.1| phosphate ABC transporter [Brucella pinnipedialis M292/94/1]
 gi|265992160|ref|ZP_06104717.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993898|ref|ZP_06106455.1| phosphate ABC transporter [Brucella melitensis bv. 3 str. Ether]
 gi|265997147|ref|ZP_06109704.1| phosphate ABC transporter [Brucella ceti M490/95/1]
 gi|294851366|ref|ZP_06792039.1| phosphate transport system substrate-binding protein [Brucella sp.
           NVSL 07-0026]
 gi|297247364|ref|ZP_06931082.1| phosphate transport system substrate-binding protein [Brucella
           abortus bv. 5 str. B3196]
 gi|306837693|ref|ZP_07470562.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           NF 2653]
 gi|62197109|gb|AAX75409.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616988|emb|CAJ12097.1| unnamed protein product [Brucella melitensis biovar Abortus 2308]
 gi|163674876|gb|ABY38987.1| Hypothetical protein BSUIS_A1977 [Brucella suis ATCC 23445]
 gi|189020762|gb|ACD73484.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           abortus S19]
 gi|225618165|gb|EEH15208.1| phosphate ABC transporter, phosphate-binding protein [Brucella ceti
           str. Cudo]
 gi|225641930|gb|ACO01844.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237788548|gb|EEP62763.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           abortus str. 2308 A]
 gi|256000697|gb|ACU49096.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           microti CCM 4915]
 gi|260096348|gb|EEW80224.1| phosphate ABC transporter [Brucella abortus NCTC 8038]
 gi|260153056|gb|EEW88148.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. 16M]
 gi|260669352|gb|EEX56292.1| phosphate ABC transporter [Brucella abortus bv. 4 str. 292]
 gi|260671191|gb|EEX58012.1| phosphate ABC transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675919|gb|EEX62740.1| phosphate ABC transporter [Brucella abortus bv. 6 str. 870]
 gi|260874364|gb|EEX81433.1| phosphate ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|260916693|gb|EEX83554.1| phosphate ABC transporter [Brucella abortus bv. 3 str. Tulya]
 gi|260919770|gb|EEX86423.1| phosphate ABC transporter [Brucella ceti B1/94]
 gi|260923046|gb|EEX89614.1| phosphate ABC transporter [Brucella ceti M13/05/1]
 gi|261293883|gb|EEX97379.1| phosphate ABC transporter [Brucella ceti M644/93/1]
 gi|261295837|gb|EEX99333.1| phosphate ABC transporter [Brucella pinnipedialis B2/94]
 gi|261300057|gb|EEY03554.1| phosphate ABC transporter [Brucella neotomae 5K33]
 gi|261303853|gb|EEY07350.1| phosphate ABC transporter [Brucella pinnipedialis M163/99/10]
 gi|261739055|gb|EEY27051.1| phosphate ABC transporter [Brucella sp. F5/99]
 gi|261741031|gb|EEY28957.1| phosphate ABC transporter [Brucella suis bv. 5 str. 513]
 gi|262551615|gb|EEZ07605.1| phosphate ABC transporter [Brucella ceti M490/95/1]
 gi|262764879|gb|EEZ10800.1| phosphate ABC transporter [Brucella melitensis bv. 3 str. Ether]
 gi|263003226|gb|EEZ15519.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092825|gb|EEZ17000.1| phosphate ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|264659883|gb|EEZ30144.1| phosphate ABC transporter [Brucella pinnipedialis M292/94/1]
 gi|264661727|gb|EEZ31988.1| phosphate ABC transporter [Brucella sp. 83/13]
 gi|294819955|gb|EFG36954.1| phosphate transport system substrate-binding protein [Brucella sp.
           NVSL 07-0026]
 gi|297174533|gb|EFH33880.1| phosphate transport system substrate-binding protein [Brucella
           abortus bv. 5 str. B3196]
 gi|306407251|gb|EFM63461.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           NF 2653]
 gi|326410137|gb|ADZ67202.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           melitensis M28]
 gi|326539857|gb|ADZ88072.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 348

 Score =  350 bits (898), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 225/322 (69%), Gaps = 1/322 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+IAGSST+ PY+KI+AE F E +P FKTP VESGGS  G+KEFC+G+G++TIDI 
Sbjct: 24  ARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVESGGSGAGIKEFCKGVGENTIDIA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR +  +EL  C   GV D+QEV  G+DGI+  +D       LT ED+YKALA+ L+V
Sbjct: 84  NASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATDAKGPDWKLTPEDIYKALAARLVV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP  KW+++ P+ P+  IA Y+P  KHGTREV E+KVL +GC  S    ++R  
Sbjct: 144 DGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTREVFEEKVLADGCKHSGALDEIRKT 203

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +  + AC +VR+DG A+++DGDY ETLARI  NK   G  GL F++NNAD LK+ 
Sbjct: 204 -GLDDKAAASACIAVRKDGKAVDIDGDYAETLARIASNKTGVGVFGLYFFENNADKLKVA 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++G+ PS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F ++D+M+ PD  L +Y
Sbjct: 263 TVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPGLKEYVEFFLNDQMIGPDGPLAEY 322

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+P  + ER++ R + + GK+
Sbjct: 323 GLVPAPDAEREAQRTAFSEGKT 344


>gi|148559644|ref|YP_001259936.1| phosphate ABC transporter phosphate-binding protein [Brucella ovis
           ATCC 25840]
 gi|148370901|gb|ABQ60880.1| phosphate ABC transporter, phosphate-binding protein [Brucella ovis
           ATCC 25840]
          Length = 348

 Score =  350 bits (897), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 225/322 (69%), Gaps = 1/322 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+IAGSST+ PY+KI+AE F E +P FKTP VESGGS  G+KEFC+G+G++TIDI 
Sbjct: 24  ARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVESGGSGAGIKEFCKGVGENTIDIA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR +  +EL  C   GV D+QEV  G+DGI+  +D       LT ED+YKALA+ L+V
Sbjct: 84  NASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATDAKGPDWKLTPEDIYKALAARLVV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP  KW+++ P+ P+  IA Y+P  KHGTREV E+KVL +GC  S    ++R  
Sbjct: 144 DGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTREVFEEKVLADGCKHSGALDEIRKT 203

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +  + AC +VR+DG A+++DGDY ETLARI  NK   G  GL F++NNAD LK+ 
Sbjct: 204 -GLDDKAAASACIAVRKDGKAVDIDGDYAETLARIASNKTGVGVFGLYFFENNADKLKVA 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++G+ PS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F ++D+M+ PD  L +Y
Sbjct: 263 TVNGVKPSAETVASGGYPVSRPLYFYVKKAHLGVIPGLKEYVEFFLNDQMIGPDGPLAEY 322

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+P  + ER++ R + + GK+
Sbjct: 323 GLVPAPDAEREAQRTAFSEGKT 344


>gi|17988272|ref|NP_540906.1| phosphate-binding periplasmic protein [Brucella melitensis bv. 1
           str. 16M]
 gi|17984042|gb|AAL53170.1| phosphate-binding periplasmic protein [Brucella melitensis bv. 1
           str. 16M]
          Length = 345

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 225/322 (69%), Gaps = 1/322 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+IAGSST+ PY+KI+AE F E +P FKTP VESGGS  G+KEFC+G+G++TIDI 
Sbjct: 21  ARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVESGGSGAGIKEFCKGVGENTIDIA 80

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR +  +EL  C   GV D+QEV  G+DGI+  +D       LT ED+YKALA+ L+V
Sbjct: 81  NASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATDAKGPDWKLTPEDIYKALAARLVV 140

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP  KW+++ P+ P+  IA Y+P  KHGTREV E+KVL +GC  S    ++R  
Sbjct: 141 DGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTREVFEEKVLADGCKHSGALDEIRKT 200

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +  + AC +VR+DG A+++DGDY ETLARI  NK   G  GL F++NNAD LK+ 
Sbjct: 201 -GLDDKAAASACIAVRKDGKAVDIDGDYAETLARIASNKTGVGVFGLYFFENNADKLKVA 259

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++G+ PS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F ++D+M+ PD  L +Y
Sbjct: 260 TVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPGLKEYVEFFLNDQMIGPDGPLAEY 319

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+P  + ER++ R + + GK+
Sbjct: 320 GLVPAPDAEREAQRTAFSEGKT 341


>gi|23502986|ref|NP_699113.1| phosphate ABC transporter phosphate-binding protein [Brucella suis
           1330]
 gi|161620048|ref|YP_001593935.1| hypothetical protein BCAN_A2182 [Brucella canis ATCC 23365]
 gi|260567392|ref|ZP_05837862.1| phosphate ABC transporter [Brucella suis bv. 4 str. 40]
 gi|23349024|gb|AAN31028.1| phosphate ABC transporter, phosphate-binding protein [Brucella suis
           1330]
 gi|161336859|gb|ABX63164.1| Hypothetical protein BCAN_A2182 [Brucella canis ATCC 23365]
 gi|260156910|gb|EEW91990.1| phosphate ABC transporter [Brucella suis bv. 4 str. 40]
          Length = 348

 Score =  349 bits (896), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 225/322 (69%), Gaps = 1/322 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+IAGSST+ PY+KI+AE F E +P FKTP VESGGS  G+KEFC+G+G++TIDI 
Sbjct: 24  ARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVESGGSGAGIKEFCKGVGENTIDIA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR +  +EL  C   GV D+QEV  G+DGI+  +D       LT ED+YKALA+ L+V
Sbjct: 84  NASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATDAKGPDWKLTPEDIYKALAARLVV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP  KW+++ P+ P+  IA Y+P  KHGTREV E+KVL +GC  S    ++R  
Sbjct: 144 DGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTREVFEEKVLADGCKHSGALDEIRKT 203

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +  + AC +VR+DG A+++DGDY ETLARI  NK   G  GL F++NNAD LK+ 
Sbjct: 204 -GLDDKAAASACIAVRKDGKAVDIDGDYVETLARIASNKTGVGVFGLYFFENNADKLKVA 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++G+ PS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F ++D+M+ PD  L +Y
Sbjct: 263 TVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPGLKEYVEFFLNDQMIGPDGPLAEY 322

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+P  + ER++ R + + GK+
Sbjct: 323 GLVPAPDAEREAQRTAFSEGKT 344


>gi|306842751|ref|ZP_07475393.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           BO2]
 gi|306287095|gb|EFM58600.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           BO2]
          Length = 348

 Score =  348 bits (894), Expect = 5e-94,   Method: Compositional matrix adjust.
 Identities = 160/322 (49%), Positives = 225/322 (69%), Gaps = 1/322 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+IAGSST+ PY+KI+AE F E +P FKTP VESGGS  G+KEFC+G+G++TIDI 
Sbjct: 24  ARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVESGGSGAGIKEFCKGVGENTIDIA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR +  +EL  C   GV D+QEV  G+DGI+  +D       LT ED+YKALA+ L+V
Sbjct: 84  NASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATDAKGPDWKLTPEDIYKALAARLVV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP  KW+++ P+ P+  IA Y+P  KHGTREV E+KVL +GC  S    +++  
Sbjct: 144 DGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTREVFEEKVLADGCKHSGALDEIKKT 203

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +  + AC +VR+DG A+++DGDY ETLARI  NK   G  GL F++NNAD LK+ 
Sbjct: 204 -GLDDKAAASACIAVRKDGKAVDIDGDYAETLARIASNKTGVGVFGLYFFENNADKLKVA 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++G+ PS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F ++D+M+ PD  L +Y
Sbjct: 263 TVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPGLKEYVEFFLNDQMIGPDGPLAEY 322

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+P  + ER++ R + + GK+
Sbjct: 323 GLVPAPDAEREAQRTAFSEGKT 344


>gi|306843557|ref|ZP_07476158.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           BO1]
 gi|306276248|gb|EFM57948.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           BO1]
          Length = 348

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 160/322 (49%), Positives = 224/322 (69%), Gaps = 1/322 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+IAGSST+ PY+KI+AE F E +P FKTP VESGGS  G+KEFC+G+G++TIDI 
Sbjct: 24  ARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVESGGSGAGIKEFCKGVGENTIDIA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR +  +EL  C   GV D+QEV  G+DGI+  +D       LT ED+YKAL + L+V
Sbjct: 84  NASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATDAKGPDWKLTPEDIYKALVARLVV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP  KW+++ P+ P+  IA Y+P  KHGTREV E+KVL +GC  S    ++R  
Sbjct: 144 DGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTREVFEEKVLADGCKHSGALDEIRKT 203

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +  + AC +VR+DG A+++DGDY ETLARI  NK   G  GL F++NNAD LK+ 
Sbjct: 204 -GLDDKAAASACIAVRKDGKAVDIDGDYAETLARIASNKTGVGVFGLYFFENNADKLKVA 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++G+ PS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F ++D+M+ PD  L +Y
Sbjct: 263 TVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPGLKEYVEFFLNDQMIGPDGPLAEY 322

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+P  + ER++ R + + GK+
Sbjct: 323 GLVPAPDAEREAQRTAFSEGKT 344


>gi|239833188|ref|ZP_04681517.1| phosphate ABC transporter, phosphate-binding protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239825455|gb|EEQ97023.1| phosphate ABC transporter, phosphate-binding protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 348

 Score =  347 bits (891), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 227/336 (67%), Gaps = 1/336 (0%)

Query: 10  CFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLK 69
              +  V   +   AR++I++AGSST+ PY+KI+AE F E FP FKTP VESGGS  G+K
Sbjct: 10  ALAIAAVMSVSAAQARDQIQVAGSSTVLPYAKIVAETFGETFPNFKTPVVESGGSGAGIK 69

Query: 70  EFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLT 129
           EFC+G+G++TIDI N+SR +  +EL  C   GV D+QEV  G+DGI+  +D       L 
Sbjct: 70  EFCKGVGENTIDIANASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATDAKGPDWKLK 129

Query: 130 VEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQE 189
            ED+YKALA+ L+VD K+V NP  KW+++ P+ P+  IA Y+P  KHGTREV E+KVL +
Sbjct: 130 PEDVYKALAAKLVVDGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTREVFEEKVLAD 189

Query: 190 GCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVG 249
           GC  S    +++     + +  + AC +VR+DG A+++DGDY ETLARI+ NK   G  G
Sbjct: 190 GCKHSGALDEIKKT-GLDDKAAASACIAVRKDGKAVDIDGDYAETLARIDSNKTGVGVFG 248

Query: 250 LSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           L F++NNAD LK+  ++ + PS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F +
Sbjct: 249 LYFFENNADKLKVATVNDVTPSAATVASGEYPVSRPLFFYVKKAHLGVIPGLKEYVEFFL 308

Query: 310 SDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           +D+M+ PD  L +YGL+P  + ER++ R + + GK+
Sbjct: 309 NDQMIGPDGPLAEYGLVPAPDAEREAQRAAFSEGKT 344


>gi|254705139|ref|ZP_05166967.1| hypothetical protein Bsuib36_14706 [Brucella suis bv. 3 str. 686]
 gi|261755843|ref|ZP_05999552.1| phosphate ABC transporter [Brucella suis bv. 3 str. 686]
 gi|261745596|gb|EEY33522.1| phosphate ABC transporter [Brucella suis bv. 3 str. 686]
          Length = 348

 Score =  347 bits (889), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 160/322 (49%), Positives = 224/322 (69%), Gaps = 1/322 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+IAGSST+ PY+KI+AE F E +P FKTP VESGGS  G+KEFC+G+G++TIDI 
Sbjct: 24  ARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVESGGSGAGIKEFCKGVGENTIDIA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR +  +EL  C   GV D+QEV  G+DGI+  +        LT ED+YKALA+ L+V
Sbjct: 84  NASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATGAKGPDWKLTPEDIYKALAARLVV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP  KW+++ P+ P+  IA Y+P  KHGTREV E+KVL +GC  S    ++R  
Sbjct: 144 DGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTREVFEEKVLADGCKHSGALDEIRKT 203

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +  + AC +VR+DG A+++DGDY ETLARI  NK   G  GL F++NNAD LK+ 
Sbjct: 204 -GLDDKAAASACIAVRKDGKAVDIDGDYVETLARIASNKTGVGVFGLYFFENNADKLKVA 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++G+ PS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F ++D+M+ PD  L +Y
Sbjct: 263 TVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPGLKEYVEFFLNDQMIGPDGPLAEY 322

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+P  + ER++ R + + GK+
Sbjct: 323 GLVPAPDAEREAQRTAFSEGKT 344


>gi|153008107|ref|YP_001369322.1| phosphate ABC transporter phosphate-binding protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|151559995|gb|ABS13493.1| phosphate ABC transporter, phosphate-binding protein [Ochrobactrum
           anthropi ATCC 49188]
          Length = 348

 Score =  346 bits (888), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 223/322 (69%), Gaps = 1/322 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I++AGSST+ PY+KI+AE F E FP FKTP VESGGS  G+KEFC+G+G++TIDI 
Sbjct: 24  ARDQIQVAGSSTVLPYAKIVAETFGETFPNFKTPVVESGGSGAGIKEFCKGVGENTIDIA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR +  +EL  C   GV D+QEV  G+DGI+  +D       L  ED+YKALA+ L+V
Sbjct: 84  NASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATDAKGPDWKLKPEDVYKALAAKLVV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP  KW+++ P+ P+  IA Y+P  KHGTREV E+KVL +GC  S    +++  
Sbjct: 144 DGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTREVFEEKVLADGCKHSGALDEIKKT 203

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +  + AC +VR+DG A+++DGDY ETLARI+ NK   G  GL F++NNAD LK+ 
Sbjct: 204 -GLDDKAAASACIAVRKDGKAVDIDGDYAETLARIDSNKTGVGVFGLYFFENNADKLKVA 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++ I PS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F ++D+M+ PD  L +Y
Sbjct: 263 TVNDITPSAETVASGEYPVSRPLFFYVKKAHLGVIPGLKEYVEFFLNDQMIGPDGPLAEY 322

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+P  + ER++ R +   GK+
Sbjct: 323 GLVPAPDAEREAQRAAFTEGKT 344


>gi|222147392|ref|YP_002548349.1| ABC transporter substrate binding protein (phosphate)
           [Agrobacterium vitis S4]
 gi|221734382|gb|ACM35345.1| ABC transporter substrate binding protein (phosphate)
           [Agrobacterium vitis S4]
          Length = 341

 Score =  336 bits (861), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 157/322 (48%), Positives = 216/322 (67%), Gaps = 6/322 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++++IAGSST+ PY+KI+AE F E F +FKTP VESGG+  GLKEFC+G+G +TIDI N
Sbjct: 24  RDQVQIAGSSTVLPYAKIVAETFGETFTKFKTPVVESGGTGAGLKEFCKGVGPETIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I ++E + CK  GV+DIQEV  G+DGI+   D     ++L   DLYK LA+ ++VD
Sbjct: 84  ASRPINKSEAEACKAAGVTDIQEVKFGYDGIVFAVDSSNKDLALVPTDLYKGLAAEVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+    P+  I  ++P  KHGTREV E  VLQ+GC  +       D+ 
Sbjct: 144 GKLVANPYKKWSEVNKSLPDTDIMAFIPGEKHGTREVFEVNVLQQGCKDAGAL----DVI 199

Query: 205 KYNVQQLSVA--CTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
           K  V +      C +VR+DG A+++DGDY+ETLARI  NK   G  GLSFY+NNAD LK+
Sbjct: 200 KAAVGEKDAPKKCIAVRKDGKAVDIDGDYSETLARIAANKTAIGVFGLSFYENNADKLKV 259

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
             + G+ PS+ T+ +G YP+SRPL FYVK+ H   + G++EYV F +S++M+  D  L  
Sbjct: 260 ATVSGVKPSVETVATGKYPVSRPLFFYVKKAHLGVIPGMKEYVDFFLSEQMIGTDGPLAN 319

Query: 323 YGLIPISNEERKSVRDSIAVGK 344
           YGL+P  ++ER+  R     GK
Sbjct: 320 YGLVPAPDKEREEFRAKFTAGK 341


>gi|254487390|ref|ZP_05100595.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. GAI101]
 gi|214044259|gb|EEB84897.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. GAI101]
          Length = 359

 Score =  333 bits (854), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 156/330 (47%), Positives = 221/330 (66%), Gaps = 3/330 (0%)

Query: 12  VVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEF 71
           + +   C T   AR+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK F
Sbjct: 24  LAISAVCATAAVARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRF 82

Query: 72  CRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVE 131
           C G+G++TIDI N+SRKI  +E + C  +GV+DI EV IG+DGI+  SD D  +   T E
Sbjct: 83  CEGVGENTIDIANASRKIKSSEQEVCASNGVTDIIEVQIGYDGIVFASDIDGNTFEFTPE 142

Query: 132 DLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGC 191
           D YKAL++ ++VD  +V NP K WSE+   FP+  I  Y+P  KHGTREV E+KV+  GC
Sbjct: 143 DWYKALSAEVVVDGAIVANPYKNWSEVNASFPDQPIQAYIPGTKHGTREVFEEKVILAGC 202

Query: 192 VRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLS 251
             + +F   +     + +    AC ++R DG ++++DGDYTETLARIE NKD  G  GL+
Sbjct: 203 EATGDFEAFKAANGDDKKAAEKACIALRTDGASVDIDGDYTETLARIESNKDGIGVFGLA 262

Query: 252 FYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           FY+NN D L +  + G+ P++ TI +G YP+SRPL FYVK+ H   + GL+E+  F V+D
Sbjct: 263 FYENNTDKLSVATMSGVEPTVETISTGDYPVSRPLFFYVKKAHIGVIPGLKEFAEFFVAD 322

Query: 312 EMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           E+  PD  L +YGL  +S+ E  +V+D++A
Sbjct: 323 EIAGPDGPLAEYGL--VSDPELATVQDTVA 350


>gi|319408035|emb|CBI81689.1| periplasmic phosphate binding protein [Bartonella schoenbuchensis
           R1]
          Length = 348

 Score =  330 bits (847), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 165/338 (48%), Positives = 220/338 (65%), Gaps = 4/338 (1%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           V LMC   L V  G    AR++I+IAGSST+ PY KI++E F E +P FK P +ESGGS 
Sbjct: 9   VGLMCVTALLVDIGN---ARDQIKIAGSSTVLPYEKIVSEVFGEIYPNFKIPVIESGGSG 65

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G+KEFCRGIGD TIDIVNSSR +   EL  C   GV DI+E+ IG+DGI+  ++     
Sbjct: 66  AGIKEFCRGIGDKTIDIVNSSRPMKSGELQSCFNAGVKDIEEMRIGYDGIVFATNSSGPD 125

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
             L   D+Y+ALA+ ++VD K+  N + KW+ +    P+  I +Y+P  KHGTREV E+K
Sbjct: 126 WELRSVDVYRALAAQVVVDGKLQLNKVTKWNTVNNALPDWEITVYIPGEKHGTREVFEEK 185

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           +L  GC  S     M +    N ++++ AC +VR+DG AI++DGDY+ET A +  NK   
Sbjct: 186 LLAAGCKASGAVEAM-EALGMNEKEINAACIAVRKDGKAIDIDGDYSETFAHLMSNKTGI 244

Query: 246 GFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           G + LSFY+NNAD LK+  I+G+VPS  TI +G Y +SRPL FYVK+ HF+ V GL EYV
Sbjct: 245 GVLSLSFYENNADKLKVAYINGVVPSSETISNGKYSLSRPLFFYVKKAHFSIVPGLWEYV 304

Query: 306 SFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
            F +SD+M+ PD  L  YGL+  S EER+  R S   G
Sbjct: 305 DFFLSDQMIGPDGPLADYGLVAASKEERQMQRTSFYAG 342


>gi|240849904|ref|YP_002971293.1| periplasmic phosphate binding protein [Bartonella grahamii as4aup]
 gi|240267027|gb|ACS50615.1| periplasmic phosphate binding protein [Bartonella grahamii as4aup]
          Length = 348

 Score =  329 bits (843), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 219/325 (67%), Gaps = 1/325 (0%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
            G  AR++I+I GSST+ PY KI+AE F E +P FK P +ESGG+  G+KEFCRGIG++T
Sbjct: 20  NGGNARDQIQITGSSTVLPYQKIVAETFGEIYPHFKVPVIESGGTGAGIKEFCRGIGENT 79

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
           +DIVN+SR +  +EL  C   GV D++E+ IG+DGI+  +D       L   D+YKALA+
Sbjct: 80  VDIVNASRAMKPSELQSCFDAGVKDVEEIRIGYDGIVFATDIKGPDWKLKPVDVYKALAA 139

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            +I+D K+  N + KWS +    P+  IA Y+P  KHGTREV E+K+L EGC  S     
Sbjct: 140 RIIIDGKLQPNNVLKWSAVNSALPDWTIAAYIPGEKHGTREVFEEKLLTEGCKESGAVEV 199

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           M+ +   + +++  AC +VR+DG A+++DGDY+ET AR+  NK   G  GLSFY+NNAD 
Sbjct: 200 MKSL-GMDDKEIHTACIAVRKDGKAVDIDGDYSETFARLTSNKTGVGIFGLSFYQNNADR 258

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           LK+  I+G  P++ TI SG YP+SRPL FY+K+ H + V GLREYV F +SD+M+ PD  
Sbjct: 259 LKVADINGFAPTVETISSGQYPVSRPLFFYIKKAHLDIVSGLREYVDFFLSDQMIGPDGP 318

Query: 320 LFQYGLIPISNEERKSVRDSIAVGK 344
           L +YGLI    +ER++ R   + G+
Sbjct: 319 LAEYGLIVSPEKERQAQRSDFSTGR 343


>gi|163867535|ref|YP_001608734.1| periplasmic phosphate binding protein [Bartonella tribocorum CIP
           105476]
 gi|161017181|emb|CAK00739.1| periplasmic phosphate binding protein [Bartonella tribocorum CIP
           105476]
          Length = 348

 Score =  326 bits (835), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 158/339 (46%), Positives = 225/339 (66%), Gaps = 4/339 (1%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           V L+  ++L V  G    AR++I++ GSST+ PY KI+AE F E +P FK P +ESGG+ 
Sbjct: 9   VGLVFALLLSVNVGN---ARDQIQVTGSSTVLPYQKIVAETFGEIYPHFKVPVIESGGTG 65

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G+KEFCRGIG++T+DIVN+SR +  +EL  C   GV D++E+ IG+DGI+  +D     
Sbjct: 66  AGIKEFCRGIGENTVDIVNASRAMKSSELQSCFDAGVKDVEEIRIGYDGIVFATDIKGPD 125

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
             L   D+YKALA+ +IVD K+  N + KW+ +    P+  IA Y+P  KHGTREV E+K
Sbjct: 126 WRLQPIDVYKALAARVIVDGKLQSNHVSKWNAVNSALPDWTIAAYIPGEKHGTREVFEEK 185

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           +L  GC  S     M+ +   N +++  AC +VR+DG A+++DGDY+ET AR+  NK   
Sbjct: 186 LLAVGCKESGAVKVMKSL-GMNDKEIHAACIAVRKDGKAVDIDGDYSETFARLTANKTGV 244

Query: 246 GFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           G  GLSFY+NNAD LK+  I+G  P++ TI SG YP+SRPL FY+K+ H + V GLREYV
Sbjct: 245 GIFGLSFYQNNADRLKVADINGFAPTVETISSGQYPVSRPLFFYIKKAHLDIVPGLREYV 304

Query: 306 SFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
            F +SD+M+ P+  L +YGLI    +ER++ R   + G+
Sbjct: 305 DFFLSDQMIGPEGPLAEYGLIVAPEKERQAQRSDFSSGQ 343


>gi|49473892|ref|YP_031934.1| periplasmic phosphate binding protein [Bartonella quintana str.
           Toulouse]
 gi|49239395|emb|CAF25733.1| Periplasmic phosphate binding protein [Bartonella quintana str.
           Toulouse]
          Length = 348

 Score =  325 bits (832), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 156/321 (48%), Positives = 217/321 (67%), Gaps = 1/321 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+I GSST+ PY KI+AE F E +P  K P +ESGGS  G+KEFCRGIG+ TIDIV
Sbjct: 24  ARDQIQITGSSTVLPYQKIVAEIFGEIYPHLKIPVIESGGSGAGIKEFCRGIGESTIDIV 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           NSSR +  +EL  C   GV D++E+ IG+DGI+  +D +     L   D+Y+ALA+ ++V
Sbjct: 84  NSSRAMRPSELQSCFDAGVKDVEEIRIGYDGIVFATDINGPDWKLEPIDVYRALAAQVVV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           + K+  N + KW  I+   P+  IA Y+P  KHGTREV E+K+L  GC  S     M+  
Sbjct: 144 NGKLQSNKISKWKAIKSTLPDWPIAAYIPGEKHGTREVFEEKLLVAGCKASGAVEAMK-F 202

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + + +  AC +VR+DG  I++DGDY+ET AR+  NK   G  GLSFY+NNAD LK+ 
Sbjct: 203 LGMDDKAIHAACIAVRKDGKVIDIDGDYSETFARLTSNKTGIGVFGLSFYENNADRLKVA 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+G  P++ TI SG YPISRPL FYVK+ H N + GLREYV F +SD+M+ P+S L +Y
Sbjct: 263 DINGFAPTVETISSGKYPISRPLFFYVKKAHLNIIPGLREYVDFFLSDQMIGPNSPLAEY 322

Query: 324 GLIPISNEERKSVRDSIAVGK 344
           GL+  S++ER++ R + + G+
Sbjct: 323 GLVVASDKERQAQRSAFSAGR 343


>gi|319898362|ref|YP_004158455.1| periplasmic phosphate binding protein [Bartonella clarridgeiae 73]
 gi|319402326|emb|CBI75865.1| periplasmic phosphate binding protein [Bartonella clarridgeiae 73]
          Length = 348

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 214/322 (66%), Gaps = 1/322 (0%)

Query: 23  FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
           +ARNR+ I GSST+ PY KI+AE F E +  FK P +ESGGS  G+KEFCRGIGD+TIDI
Sbjct: 23  YARNRVHIVGSSTVLPYGKIVAEIFGEMYSNFKVPVIESGGSGAGIKEFCRGIGDNTIDI 82

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI 142
           V++SR +  NEL  C   GV D++E+ IG+DGI+  +D +     L   DLY+ALA+ +I
Sbjct: 83  VHTSRAMKPNELRSCFDAGVKDVEEMRIGYDGIVFATDINGPDWKLQPVDLYRALAAQVI 142

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           VD K+  N   KWS +  D P+  I  Y+P  KHGTRE+ E+KVL  GC  S    +M+ 
Sbjct: 143 VDGKLQPNEFMKWSAVNSDLPDWTITAYIPGEKHGTREIFEEKVLAIGCKASGAIEQMKA 202

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
           +   N + ++ AC +VR+DG AI++DGDY+ETLAR+   K   G  GL FY+NNAD LK+
Sbjct: 203 L-GMNDKAINAACVTVRKDGKAIDIDGDYSETLARLTSGKIGIGVFGLFFYENNADKLKV 261

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
             I+GI PS  TI +G Y ISRPL FYVK+ H   V G++EYV   +SD+M+   S L +
Sbjct: 262 ASINGIYPSAETISNGSYLISRPLFFYVKKLHLAIVPGMQEYVDLFLSDQMIGLHSPLTE 321

Query: 323 YGLIPISNEERKSVRDSIAVGK 344
           YGLIPIS  ER+  RD+   GK
Sbjct: 322 YGLIPISERERQVQRDAFYSGK 343


>gi|83953659|ref|ZP_00962380.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83841604|gb|EAP80773.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sulfitobacter sp. NAS-14.1]
          Length = 346

 Score =  322 bits (826), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 149/302 (49%), Positives = 209/302 (69%), Gaps = 1/302 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI  +E++ C  +GV+DI EV IG+DGI+  SD +  +   T ED YKAL++ ++VD
Sbjct: 83  ASRKIKSSEVEACATNGVTDIIEVQIGYDGIVFASDINGNTFEFTPEDWYKALSAEVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++V NP K WS++   FPE  I  Y+P  KHGTREV E+KV+  GC  + +F   +   
Sbjct: 143 GEIVANPNKMWSDVNASFPEQPIQAYIPGTKHGTREVFEEKVILAGCEATGDFEAFKAAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG+++++DGDYTETLARIE NKD  G  GL+FY+NN D L +  
Sbjct: 203 GDDKKAAEKACIALRTDGVSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDKLTVAN 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GI P++ TI SG YP+SRPL FYVK+ H   + GL+EY  F V+DE+  PD  L +YG
Sbjct: 263 MSGIEPTVETISSGDYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVADEIAGPDGPLAEYG 322

Query: 325 LI 326
           L+
Sbjct: 323 LV 324


>gi|83942439|ref|ZP_00954900.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sulfitobacter sp. EE-36]
 gi|83846532|gb|EAP84408.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sulfitobacter sp. EE-36]
          Length = 346

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 147/302 (48%), Positives = 209/302 (69%), Gaps = 1/302 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I  +E++ C  +GV+DI EV IG+DGI+  SD +  +   T ED YKAL++ ++VD
Sbjct: 83  ASRQIKSSEVEACAANGVTDIIEVQIGYDGIVFASDINGNTFEFTPEDWYKALSAEVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++V NP K WS++   FPE  I  Y+P  KHGTREV E+KV+  GC  + +F   +   
Sbjct: 143 GEIVANPNKMWSDVNASFPEQPIQAYIPGTKHGTREVFEEKVILAGCEATGDFEAFKAAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG+++++DGDYTETLARIE NKD  G  GL+FY+NN D L +  
Sbjct: 203 GDDKKAAEKACIALRTDGVSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDKLTVAN 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+ P++ TI SG YP+SRPL FYVK+ H   + GL+EY  F V+DE+  PD  L +YG
Sbjct: 263 MSGVEPTVETISSGDYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVADEIAGPDGPLAEYG 322

Query: 325 LI 326
           L+
Sbjct: 323 LV 324


>gi|319406573|emb|CBI80215.1| periplasmic phosphate binding protein [Bartonella sp. 1-1C]
          Length = 348

 Score =  320 bits (820), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 155/323 (47%), Positives = 218/323 (67%), Gaps = 1/323 (0%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
           ++ARNR+ I GSST+ PY KI+AE F E + +FK P +ESGGS  G+KEFCRGIG++T+D
Sbjct: 22  SYARNRVHIVGSSTVLPYGKIVAEVFGEMYSDFKVPVIESGGSGAGIKEFCRGIGNNTVD 81

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           IV++SR +  +EL  C   GV DI+E+ IG+DGI+  +D +     L   DLY+ALA+ +
Sbjct: 82  IVHTSRAMKSDELRSCFNAGVKDIEEMRIGYDGIVFATDINGPDWKLQPVDLYRALAAQV 141

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
           IVD K+  N   KWS +  D P+  I  Y+P  KHGTREVLE+KVL  GC  S    +M+
Sbjct: 142 IVDGKLQPNKFMKWSAVNSDLPDWTITAYIPGEKHGTREVLEEKVLSIGCKASGAVEQMK 201

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
            +   + + ++  C +VR+DG  I++DGDY+ET AR+  +K   G  GL FY+NNAD LK
Sbjct: 202 ALGMSD-KAINATCIAVRKDGKVIDIDGDYSETFARLTSSKTGIGVFGLFFYENNADKLK 260

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +  I+G+ P++ TI  G Y I+RPL FYVK+ H N V G++EYV F +SD+M+   S L 
Sbjct: 261 VASINGVYPTVETISDGTYLIARPLFFYVKKLHLNIVPGMQEYVDFFLSDQMIGLHSPLT 320

Query: 322 QYGLIPISNEERKSVRDSIAVGK 344
           +YGL+P+S  ER+  RD+ + GK
Sbjct: 321 EYGLVPLSERERQLQRDAFSSGK 343


>gi|121602675|ref|YP_989480.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Bartonella bacilliformis KC583]
 gi|120614852|gb|ABM45453.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Bartonella bacilliformis KC583]
          Length = 348

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 158/319 (49%), Positives = 215/319 (67%), Gaps = 1/319 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+RI+IAGSST+ PY KI+AE F E +P F+ P VESGGS  G+KEFCRGIG  TIDIV
Sbjct: 24  ARDRIQIAGSSTVLPYVKIVAETFGEVYPNFRIPVVESGGSGAGIKEFCRGIGKSTIDIV 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR +  +EL  C   GV DI+EV IG+DGI+  +D       L   D+YKALA+ ++V
Sbjct: 84  NTSRAMKPSELRSCFDAGVKDIEEVRIGYDGIVFATDISGPDWELRPIDIYKALAAQVMV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           + K+  N ++KWS +    P+  IA+Y+P  KHGTREV E+K+L EGC  S     M+ +
Sbjct: 144 NGKLQPNKVRKWSAVNSALPDWVIAVYIPGEKHGTREVFEEKLLIEGCKDSGAVKAMKAL 203

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              N ++++ AC +VR+DG AI++DGDY+ET AR+  +K   G    SFY+NNAD +K+V
Sbjct: 204 -GMNDKEINAACIAVRKDGKAIDIDGDYSETFARLTSHKTGIGVFSWSFYENNADKIKVV 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+ + P   TI SG YP+SRPL FYVK++H   V GL EYV F +S+EM+ PD  L +Y
Sbjct: 263 RINDVEPITETIFSGQYPVSRPLFFYVKKEHLGIVPGLWEYVDFFLSEEMIGPDGPLAEY 322

Query: 324 GLIPISNEERKSVRDSIAV 342
           GL+    +ER+  RDS + 
Sbjct: 323 GLVIAPEKERQEQRDSFSA 341


>gi|90418936|ref|ZP_01226847.1| periplasmic phosphate-binding protein, ABC-type transporter
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90337016|gb|EAS50721.1| periplasmic phosphate-binding protein, ABC-type transporter
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 350

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 153/325 (47%), Positives = 206/325 (63%), Gaps = 7/325 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           +  ++++AGSST+ PY++I+AENF E FP+F TP VESGGSS GLK+FC+G+G DTID+ 
Sbjct: 25  SNEQVQVAGSSTVLPYAQIVAENFGEVFPDFPTPIVESGGSSAGLKQFCQGVGPDTIDVA 84

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I  +EL  C   GV+D+QEV  G+DGI+  SD      +LT E ++KA+A+ ++ 
Sbjct: 85  NASRAIRPSELKACADAGVTDVQEVRFGYDGIVFASDAAGPDFALTPEMVFKAMAAKIVQ 144

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D KVV NP   WSEI    P+ +I  ++P+  HGTREV E+KVL  GC  S       + 
Sbjct: 145 DGKVVDNPYGNWSEIDASLPDQKITAFIPASNHGTREVFEEKVLAAGCEASGAI----EA 200

Query: 204 FKYNVQQLSVA---CTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
           F  +      A   C  +R D    E+ GDYTETL+RI+ +K   G  GL+FY+ N D L
Sbjct: 201 FTASGMDEDAAEDQCLQIRNDNTVSEISGDYTETLSRIDADKQAIGVFGLAFYEQNQDKL 260

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           K+  I+ IVPS   I SG YP+SRPL FYVK+ H   V GL EYV F +SD+M  PDS L
Sbjct: 261 KVATINDIVPSADAIASGEYPVSRPLYFYVKKAHIGVVPGLSEYVQFFLSDQMTGPDSPL 320

Query: 321 FQYGLIPISNEERKSVRDSIAVGKS 345
            +YGL+P    ER+  R +   G +
Sbjct: 321 VEYGLVPAPEAEREEQRSTFEAGDT 345


>gi|49475055|ref|YP_033096.1| periplasmic phosphate binding protein [Bartonella henselae str.
           Houston-1]
 gi|49237860|emb|CAF27055.1| Periplasmic phosphate binding protein [Bartonella henselae str.
           Houston-1]
          Length = 348

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 151/321 (47%), Positives = 214/321 (66%), Gaps = 1/321 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+I GSST+ PY KI+AE F E +P FK P +ESGG+  G+KEFCRGIG++ IDIV
Sbjct: 24  ARDQIQITGSSTVLPYQKIVAEIFGEIYPHFKIPVIESGGTGGGIKEFCRGIGENAIDIV 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR +  +EL  C   GV D++E+ IG+DGI+  +D +     L   D+Y+ALA+ ++ 
Sbjct: 84  NASRAMKLSELQSCFDAGVKDVEEIRIGYDGIVFATDINGPDWKLQPVDIYRALAARIMK 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+  N + KWS +    P   IA Y+P  KHGTREV E+K+L  GC  S     M+ +
Sbjct: 144 DGKLQSNNVSKWSAVNSALPGWTIAAYIPGEKHGTREVFEEKLLAAGCKESGAVDAMKSL 203

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + + + +AC +VR+DG  I++DGDY+ET AR+  NK   G  GLSFY+NNAD LK+ 
Sbjct: 204 -GMDDKAIHIACVAVRKDGKVIDIDGDYSETFARLTSNKTGVGVFGLSFYQNNADRLKVA 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I G  P++ TI SG YP+SRPL FYVK+ H   + GLREYV F +SD+M+ P+  L +Y
Sbjct: 263 DISGFTPTVETISSGKYPVSRPLFFYVKKAHLGIIPGLREYVDFFLSDQMIGPNGPLAEY 322

Query: 324 GLIPISNEERKSVRDSIAVGK 344
           GL+  S +ER++ R + + G+
Sbjct: 323 GLVVASEKERQAQRSAFSAGR 343


>gi|319403655|emb|CBI77240.1| periplasmic phosphate binding protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 348

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 216/323 (66%), Gaps = 1/323 (0%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
           ++ARNR+ I GSST+ PY KI+AE F E + +FK P +ESGGS  G+KEFCRGIG  T+D
Sbjct: 22  SYARNRVHIVGSSTVLPYGKIVAEVFGEMYSDFKVPVIESGGSGAGIKEFCRGIGKKTVD 81

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           IV++SR +  +EL  C   GV DI+E+ IG+DGI+  +D +     L   DLY+ALA+ +
Sbjct: 82  IVHTSRAMKSDELRSCFDAGVKDIEEMRIGYDGIVFATDINGPDWKLQPVDLYRALAAQV 141

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
           IVD K+  N   KWS +  D P+  I  Y+P  KHGTREVLE+KVL  GC  S    +M+
Sbjct: 142 IVDGKLQPNKFMKWSAVNSDLPDWTITAYIPGEKHGTREVLEEKVLSIGCKASGAVEQMK 201

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
            +   + + ++  C +VR+DG  I++DGDY+ET AR+  +K   G  GL FY+NNAD LK
Sbjct: 202 ALGMSD-KAINATCIAVRKDGKVIDIDGDYSETFARLTSSKTGIGVFGLFFYENNADKLK 260

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +  I+GI P++ TI  G Y I+RPL FYVK+ H N V G++EYV F +SD+M+   S L 
Sbjct: 261 VASINGIYPTVETISDGTYLIARPLFFYVKKLHLNIVPGMQEYVDFFLSDQMIGLHSPLT 320

Query: 322 QYGLIPISNEERKSVRDSIAVGK 344
           +YGL+P+S  ER+  RD+ + GK
Sbjct: 321 EYGLVPLSERERQLQRDAFSSGK 343


>gi|119387035|ref|YP_918090.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Paracoccus denitrificans PD1222]
 gi|119377630|gb|ABL72394.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Paracoccus denitrificans PD1222]
          Length = 342

 Score =  318 bits (814), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 154/302 (50%), Positives = 207/302 (68%), Gaps = 3/302 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I+++GSST+ PYS I+AE F E   +F TP VESGGSS GLK+FC G+GD+TIDI N
Sbjct: 24  RDQIQVSGSSTVLPYSTIVAEAFGENT-DFPTPVVESGGSSAGLKKFCEGVGDNTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I ++E++ CK  GV+DI EV IG+DGI+  SD      + T  D + ALA+ ++VD
Sbjct: 83  ASRPIKESEIEACKAAGVTDIMEVRIGYDGIVFASDIGGNDFAFTPADWFNALAAEIVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            KVV NP  KW+EIR D P+  I  +VP  KHGTREV E+KV+  GC  S     ++   
Sbjct: 143 GKVVPNPHTKWNEIRSDLPDQEILAFVPGTKHGTREVFEEKVIAAGCEESGAAEVLK--A 200

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           +    + + AC ++R DG +I++DGDYTETLARI+  K+  G  GLSFY+NN D LK+  
Sbjct: 201 EKGEDEGASACMALRTDGKSIDIDGDYTETLARIQSAKNGIGVFGLSFYENNTDKLKVAT 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           I G+ PS  +I SG YP+SRPL FYVK+QH ++V GL+E+  F VSDE+  PD  L  YG
Sbjct: 261 IAGVQPSTESIASGEYPVSRPLFFYVKKQHIDTVPGLKEFAEFFVSDELAGPDGPLAAYG 320

Query: 325 LI 326
           L+
Sbjct: 321 LV 322


>gi|319405126|emb|CBI78732.1| periplasmic phosphate binding protein [Bartonella sp. AR 15-3]
          Length = 348

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 156/323 (48%), Positives = 215/323 (66%), Gaps = 1/323 (0%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
           ++ARNR+ I GSST+ PY KI+AE F E +  FK P +ESGGS  G+KEFCRGIG++TID
Sbjct: 22  SYARNRVHIVGSSTVLPYGKIVAEIFGEIYSNFKVPIIESGGSGAGIKEFCRGIGNNTID 81

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           IV++SR +  +EL  C   GV DI+E+ IG+DGI+  +D +     L   D Y+ALA+ +
Sbjct: 82  IVHTSRAMKPDELRSCFNTGVKDIEEMRIGYDGIVFATDINGPDWKLQPVDFYRALAAQV 141

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
           IVD K+  N   KWS +  + P+  I  Y+P  KHGTREV E+KVL  GC  S    +M+
Sbjct: 142 IVDGKLQPNEFMKWSAVNSNLPDWTITAYIPGEKHGTREVFEEKVLAIGCKASGAVEQMK 201

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
            +   + + ++ AC +VR+DG A+++DGDY+ET AR+  +K   G   LSFY+NNAD LK
Sbjct: 202 ALGMSD-KAINAACIAVRKDGKAVDIDGDYSETFARLTSSKTGIGVFSLSFYENNADKLK 260

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
              I+GI PS+ TI  G Y ISRPL FYVK+ H N V G++EY+   +SD+M+   S L 
Sbjct: 261 AASINGIYPSVETISDGSYLISRPLFFYVKKLHLNIVPGMQEYIDLFLSDQMIGLHSPLA 320

Query: 322 QYGLIPISNEERKSVRDSIAVGK 344
           +YGL+PIS  ER+  RD+ + GK
Sbjct: 321 EYGLVPISERERQVQRDAFSSGK 343


>gi|312115109|ref|YP_004012705.1| phosphate-binding periplasmic protein [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220238|gb|ADP71606.1| putative phosphate-binding periplasmic protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 361

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 152/328 (46%), Positives = 210/328 (64%), Gaps = 16/328 (4%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++++IAGSST+FPY+KI+AENF++     K P VESGGS  GLK+FC G+G+D IDI 
Sbjct: 25  ARDQVKIAGSSTVFPYAKIVAENFAKANAGLKAPVVESGGSGAGLKQFCDGVGEDKIDIA 84

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           NSSR+I + E + C K+GV+D+ EV  G+DGI+  SD    + +   +D + ALA  ++V
Sbjct: 85  NSSRRIKKGEQETCTKNGVADVVEVKFGYDGIVFASDVKGAAFAYEAKDWFNALAPEIVV 144

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS--------- 194
           D K+V NP K W E+   FP   I  Y+P  KHGTREV E+KVL  GC  +         
Sbjct: 145 DGKLVANPNKTWKEVNAAFPGWEIVAYIPGEKHGTREVFEEKVLVAGCKATGADKLIAEK 204

Query: 195 -RNFSKMRDMFKYNVQQLSVACTSVRQDG---IAIEVDGDYTETLARIEVNKDVFGFVGL 250
            +      D      ++   AC  VR+D     AI++DGDYTETLAR++ NK+  G  GL
Sbjct: 205 LKAAGTAEDKLHGATEK---ACAKVRKDDGGKHAIDIDGDYTETLARLQANKESIGVFGL 261

Query: 251 SFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS 310
           +FY+NN D L++  + G+ PS+ TI +G YP+SRPL FYVK+ H   + GL+EY  F VS
Sbjct: 262 AFYENNTDKLRVATVGGVTPSVETISAGKYPVSRPLFFYVKKAHVGVIPGLKEYSEFFVS 321

Query: 311 DEMMAPDSQLFQYGLIPISNEERKSVRD 338
           D+M+  D  L QYGL+P+   E K+VR+
Sbjct: 322 DKMIGEDGPLAQYGLVPLPEAEAKAVRE 349


>gi|254465409|ref|ZP_05078820.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacterales bacterium Y4I]
 gi|206686317|gb|EDZ46799.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacterales bacterium Y4I]
          Length = 346

 Score =  312 bits (799), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 147/321 (45%), Positives = 211/321 (65%), Gaps = 3/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E+  C ++GV+DI EV IG+DGI+  SD    +   T  D + AL+  ++VD
Sbjct: 83  ASRKIKDKEIAACAENGVTDIIEVRIGYDGIVFASDSSANAFEFTPSDWFLALSDKILVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++  NP   W+++ PDFP V I  +VP  KHGTREV E KV+  GC  +  F   ++  
Sbjct: 143 GELADNPNTTWADVNPDFPAVDIQAFVPGTKHGTREVFEDKVILAGCEETGAFEAFKEAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG ++++DGDYTETLARIE NK+  G  GL+FY+NN D L++  
Sbjct: 203 GGDKKAAEKACIALRTDGKSVDIDGDYTETLARIESNKNGIGVFGLAFYENNTDKLQVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+VPS  +I SG YP+SRPL FYVK+ H   + GL+EY  F V+DE+   D  L +YG
Sbjct: 263 MSGVVPSTESIASGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVADEVAGEDGPLAEYG 322

Query: 325 LI--PISNEERKSVRDSIAVG 343
           L+  P   E +++V +   +G
Sbjct: 323 LVADPELAETQETVANEAVMG 343


>gi|259415703|ref|ZP_05739623.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Silicibacter sp. TrichCH4B]
 gi|259347142|gb|EEW58919.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Silicibacter sp. TrichCH4B]
          Length = 346

 Score =  311 bits (797), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 211/317 (66%), Gaps = 3/317 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I + E+  C + GV+DI EV IG+DGI+  SD +      T  D + AL+  + VD
Sbjct: 83  ASRAIKEKEIKACAEAGVTDIIEVRIGYDGIVFASDINGNGFEFTPTDWFLALSDKVSVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP K W+++  DFP   I  ++P  KHGTREV E+KV+  GC  +  F   ++  
Sbjct: 143 GKLVDNPNKTWADVNGDFPAQAIQAFIPGTKHGTREVFEEKVILAGCEETGAFELFKEAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG+++++DGDYTETLARIE NKD  G  GL+FY+NN D L++  
Sbjct: 203 GGDEKAAEKACIALRTDGVSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDKLQVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GIVPS  +I +G YP+SRPL FYVK+ H   + GL+EY  F VSDE+  PD  L +YG
Sbjct: 263 MSGIVPSTESIATGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVSDEVAGPDGPLSEYG 322

Query: 325 LIPISNEERKSVRDSIA 341
           L  +++ E    ++++A
Sbjct: 323 L--VADPELAKTQEAVA 337


>gi|163746359|ref|ZP_02153717.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanibulbus indolifex HEL-45]
 gi|161380244|gb|EDQ04655.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanibulbus indolifex HEL-45]
          Length = 346

 Score =  308 bits (790), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 208/322 (64%), Gaps = 3/322 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TIDI N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I   E+  C ++GV+DI EV +G+DGI+  SD D  +   T  D YKAL++ ++VD
Sbjct: 83  ASRQIKDAEVAVCAENGVTDIIEVRVGYDGIVFASDIDGNTFEFTPTDWYKALSAKVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            +V  NP   W ++ P FP   I  ++P  KHGTREV E+KV+  GC  + +     +  
Sbjct: 143 GEVTTNPYTTWDQVNPAFPAQPIQAFIPGTKHGTREVFEEKVILAGCEETGDLEAFAEAA 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +     C S+R DG ++++DGDYTETLARIE N+D  G  GL+FY+NN D L++  
Sbjct: 203 GGDEKAAEKECISLRTDGKSVDIDGDYTETLARIESNQDGIGVFGLAFYENNTDKLQVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+ P+  +I SG YP+SRPL FYVK+ H   + GL+EY  F V+DE+  PD  L +YG
Sbjct: 263 MGGVEPTTESIASGDYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVADEVAGPDGPLAEYG 322

Query: 325 LI--PISNEERKSVRDSIAVGK 344
           L+  P   E +  V D   +G 
Sbjct: 323 LVSDPELAETQSVVADETVLGN 344


>gi|99081103|ref|YP_613257.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ruegeria sp. TM1040]
 gi|99037383|gb|ABF63995.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Ruegeria sp. TM1040]
          Length = 346

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 143/318 (44%), Positives = 209/318 (65%), Gaps = 3/318 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R ++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TIDI N
Sbjct: 24  REQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I + E+  C + GV+DI EV IG+DGI+  SD D      T  D + AL+  ++VD
Sbjct: 83  ASRAIKEKEIKACAEAGVTDIIEVRIGYDGIVFASDIDGNGFEFTPTDWFLALSDKVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
             +V NP K W+++   FP   I  ++P  KHGTREV E KV+  GC  +  F  +++  
Sbjct: 143 GALVDNPNKTWADVNAAFPAQPIQAFIPGTKHGTREVFEDKVILAGCEETGAFDLLKEAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG+++++DGDYTETLARI+ NKD  G  GL+FY+NN D L++  
Sbjct: 203 GGDKKAAEKACIALRTDGVSVDIDGDYTETLARIDSNKDGIGVFGLAFYENNTDKLQVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+VPS  +I +G YP+SRPL FYVK+ H   + GL+E+  F V+DE+  PD  L +YG
Sbjct: 263 MSGVVPSTESIATGEYPVSRPLYFYVKKAHIGVIPGLKEFAEFFVADEVAGPDGPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAV 342
           L  +++ E    ++++A 
Sbjct: 323 L--VADPELAKTQEAVAA 338


>gi|163761563|ref|ZP_02168635.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Hoeflea phototrophica DFL-43]
 gi|162281277|gb|EDQ31576.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Hoeflea phototrophica DFL-43]
          Length = 343

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 148/303 (48%), Positives = 205/303 (67%), Gaps = 4/303 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++++IAGSST+ PY+ I+AE F E F EF TP VESGGS  G K+ C G+G++TIDI 
Sbjct: 23  ARDQVQIAGSSTVLPYASIVAEAFGENF-EFPTPVVESGGSGAGRKKLCEGVGENTIDIA 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           NSS +I Q+++D C  +GV++IQEV IG+DGI+  SD +    + T  D + ALA+ ++ 
Sbjct: 82  NSSSRIKQSDIDLCASNGVTEIQEVRIGYDGIVFASDINGPEYAFTPADWHNALAAKVMK 141

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D ++V NP K W+EIR D P   I  +VP  KHGTREV ++KV+  GC  +      +  
Sbjct: 142 DGQLVDNPYKTWNEIRADLPAQEILAFVPGTKHGTREVFDEKVIIAGCEENGAAEAHKAA 201

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +V     AC  +R DG++I++DGDYTETLAR++ NK+  G  GLSFY+NN D L++ 
Sbjct: 202 GAEDVDD---ACMQLRTDGVSIDIDGDYTETLARVDANKNGIGVFGLSFYQNNTDKLQVG 258

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + G+VPS+ +I SG YP+SRPL FYVK  H + + GL+EYV F VSDE+  PD  L  Y
Sbjct: 259 TMGGVVPSVESIASGEYPVSRPLYFYVKNAHLDVIPGLQEYVEFFVSDEIAGPDGPLAAY 318

Query: 324 GLI 326
           GL+
Sbjct: 319 GLV 321


>gi|146277956|ref|YP_001168115.1| ABC-type phosphate transport system periplasmic component-like
           protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145556197|gb|ABP70810.1| ABC-type phosphate transport system periplasmic component-like
           protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 347

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 147/317 (46%), Positives = 208/317 (65%), Gaps = 3/317 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+ AGSST+ PY+ I+AE F E F +F TP VESGGS  G K+ C G+G++TIDI N
Sbjct: 24  RDNIQTAGSSTVLPYATIVAEAFGENF-DFPTPVVESGGSGAGRKKLCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D C ++GV++I EV IG+DGI+  SD      + T  D + ALA+ ++VD
Sbjct: 83  SSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIGGPDFAFTPADWFNALAAQIVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            +VV NP  +W+++ P+ P+  I  ++P  KHGTREV ++KV+  GC  S          
Sbjct: 143 GQVVANPNGRWNQVNPELPDQPILAFIPGTKHGTREVFDEKVIVAGCEESGAMEAFAAAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +  +    C ++R DG ++++DGDYTETL+RI+ NK+  G  GLSFY+NN D LK+  
Sbjct: 203 GGDEDKAHDMCMALRTDGASVDIDGDYTETLSRIDANKNAIGVFGLSFYQNNTDKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           +  +VPS+ TI SG YP+SRPL FYVK  H + + GL+EYV F VSDEM  PD  L  YG
Sbjct: 263 MSDVVPSVETIASGDYPVSRPLFFYVKMAHLDVIPGLQEYVEFFVSDEMAGPDGPLAAYG 322

Query: 325 LIPISNEERKSVRDSIA 341
           L  +S+ E  + +D IA
Sbjct: 323 L--VSDPELAATQDMIA 337


>gi|56696821|ref|YP_167183.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ruegeria pomeroyi DSS-3]
 gi|56678558|gb|AAV95224.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ruegeria pomeroyi DSS-3]
          Length = 346

 Score =  306 bits (783), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 210/317 (66%), Gaps = 3/317 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E+  C ++GV+DI EV IG+DGI+  SD    +   T  D + AL+  ++VD
Sbjct: 83  ASRKIKDKEVAVCAENGVTDIIEVRIGYDGIVFASDIAGNTFEFTPSDWFLALSDKIMVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++V NP   W+++   FP   I  ++P  KHGTREV E KV+  GC  +  F  ++   
Sbjct: 143 GQLVDNPNSTWADVNAAFPAQPIQAFIPGTKHGTREVFEDKVILAGCEATGAFEALKAAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG+++++DGDYTETLARIE NKD  G  GL+FY+NN D L++  
Sbjct: 203 GDDKKAAEKACIALRTDGVSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDKLQVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GIVPS  +I +G YP+SRPL FYVK+ H   + GL+EY  F ++DE+  PD  L +YG
Sbjct: 263 MSGIVPSTESIATGEYPVSRPLYFYVKKAHIGVIPGLKEYAEFFIADEIAGPDGPLAEYG 322

Query: 325 LIPISNEERKSVRDSIA 341
           L  +S+ E    ++++A
Sbjct: 323 L--VSDPELAKTQEAVA 337


>gi|110679869|ref|YP_682876.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter denitrificans OCh 114]
 gi|109455985|gb|ABG32190.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter denitrificans OCh 114]
          Length = 346

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 149/324 (45%), Positives = 209/324 (64%), Gaps = 5/324 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F EF TP VESGGSS GLK FC G+G++T+DI N
Sbjct: 24  RDQVQVAGSSTVLPYAAIVAEAFGENF-EFPTPVVESGGSSAGLKRFCEGVGENTVDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIV 143
           SSR I + E+  C ++GV+DI EV IG+DGI+  S +   + +     D Y ALA+ L V
Sbjct: 83  SSRPIREREIAACAENGVTDIIEVRIGYDGIVFASQQTGPAFTEFQPSDWYTALAANLPV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D ++V NP   W  + P  P V IA ++P  KHGTREV E+KVL +GC  +     M DM
Sbjct: 143 DGEMVANPNMTWDAVNPALPAVDIAAFIPGTKHGTREVFEEKVLLQGCEDTGAMQAMMDM 202

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC +VR DG ++++DGDYTETLARIE N +  G  GL+FY+NN D LK+ 
Sbjct: 203 -GMDEDAAESACMAVRTDGKSVDIDGDYTETLARIESNANGIGVFGLAFYENNTDKLKVA 261

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + G+ P+  TI +G YP+SRPL FY+K+ H   + GL+++  F VSD++  PD  L +Y
Sbjct: 262 TMGGVEPTTETISTGEYPVSRPLFFYIKKAHIGVIPGLKDFAEFFVSDDIAGPDGPLAEY 321

Query: 324 GLI--PISNEERKSVRDSIAVGKS 345
           GL+  P   E + +V D   +G +
Sbjct: 322 GLVSDPALAETQAAVADEDVLGSN 345


>gi|254504985|ref|ZP_05117136.1| hypothetical protein SADFL11_5024 [Labrenzia alexandrii DFL-11]
 gi|222441056|gb|EEE47735.1| hypothetical protein SADFL11_5024 [Labrenzia alexandrii DFL-11]
          Length = 365

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 152/320 (47%), Positives = 210/320 (65%), Gaps = 9/320 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+++++AGSST+ PY+ I+AE F E   +F TP VESGGSS GLK FC G+G++TID+ 
Sbjct: 45  ARDQVQVAGSSTVLPYASIVAEVFGEN-TDFPTPVVESGGSSAGLKRFCEGVGENTIDVA 103

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLI 142
           N+SRKI + E+  C ++GV+DI EV IG+DGI+  S +D  +  + T    + ALA  ++
Sbjct: 104 NASRKIREKEIKACAENGVTDIMEVRIGYDGIVFASQKDGPAFTAFTPVQWHNALAPKVL 163

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           VD  +V NP  KWSE+    P+V IA ++P  KHGTREV E+KVL  GC  S     M D
Sbjct: 164 VDGAIVDNPYTKWSEVDASLPDVEIAAFIPGTKHGTREVFEEKVLLIGCEESGAMKAMMD 223

Query: 203 --MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
             M + + +    AC +VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D L
Sbjct: 224 GGMSEDDAED---ACLAVRTDGKSVDIDGDYTETLARIDSNPNGVGVFGLAFYENNTDKL 280

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           K+  +  I PS  TI +G YP+SRPL FYVK+ H   + GL+EY  F V+DE+  P   L
Sbjct: 281 KVATMSDIAPSTETISTGEYPVSRPLFFYVKKAHIGVIPGLKEYAQFFVADEIAGPQGPL 340

Query: 321 FQYGLIPISNEERKSVRDSI 340
            QYGL  +S+ E  + + SI
Sbjct: 341 AQYGL--VSDPELAATQASI 358


>gi|163731860|ref|ZP_02139307.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter litoralis Och 149]
 gi|161395314|gb|EDQ19636.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter litoralis Och 149]
          Length = 336

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 147/322 (45%), Positives = 209/322 (64%), Gaps = 5/322 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F EF TP VESGGSS GLK FC G+G++T+DI N
Sbjct: 14  RDQVQVAGSSTVLPYAAIVAEAFGENF-EFPTPVVESGGSSAGLKRFCEGVGENTVDIAN 72

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIV 143
           +SR+I + E+  C ++GV+DI EV IG+DGI+  S +   + +     D Y ALA+ L V
Sbjct: 73  ASRQIREREIAACAENGVTDIIEVRIGYDGIVFASQQTGPAFTEFQPSDWYTALAAELPV 132

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K++ NP   W  +    P V IA ++P  KHGTREV E+KVL +GC  +     M DM
Sbjct: 133 DGKMIANPNATWDSVNAALPAVDIAAFIPGTKHGTREVFEEKVLLQGCEDTGAMQAMMDM 192

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC +VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK+ 
Sbjct: 193 -GMDEDAAESACMAVRTDGKSVDIDGDYTETLARIDSNTNGIGVFGLAFYENNTDKLKVA 251

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + G+ P+  TI +G YP+SRPL FY+K+ H   + GL+++  F VSDE+  PD  L +Y
Sbjct: 252 TMGGVQPTTETISTGDYPVSRPLFFYIKKAHIGVIPGLKDFAEFFVSDEIAGPDGPLAEY 311

Query: 324 GLI--PISNEERKSVRDSIAVG 343
           GL+  P  +E + +V D   +G
Sbjct: 312 GLVSDPALSETQAAVADEKVLG 333


>gi|86138914|ref|ZP_01057486.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. MED193]
 gi|85824561|gb|EAQ44764.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. MED193]
          Length = 355

 Score =  303 bits (775), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 213/326 (65%), Gaps = 8/326 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 28  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I + E+  C + GV+DI EV IG+DGI+  SD +    + T  D + AL+  ++VD
Sbjct: 87  ASRAIKEKEIKACAEAGVTDIIEVRIGYDGIVFASDINGNEFAYTPTDWFLALSDEILVD 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM---- 200
            K+V NP K W+++   FP   +  ++P  KHGTREV E KV+  GC  +  F  +    
Sbjct: 147 GKMVPNPNKTWADVNASFPAQSLQAFIPGTKHGTREVFEDKVILAGCEATGAFEHLLAQA 206

Query: 201 -RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
             D  K   +    AC ++R DG+++++DGDYTETLARIE NKD  G  GL+FY+NN D 
Sbjct: 207 EGDTPKAQKKAAEKACIALRTDGVSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDK 266

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           L++  + GIVPS  +I +G YP+SRPL FYVK+ H   + GL+EY  F +SDE+  PD  
Sbjct: 267 LQVATMSGIVPSTESIATGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFISDEVAGPDGP 326

Query: 320 LFQYGLI--PISNEERKSVRDSIAVG 343
           L +YGL+  P  ++ +++V +   +G
Sbjct: 327 LSEYGLVADPELSQTQETVANEATMG 352


>gi|118589312|ref|ZP_01546718.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Stappia aggregata IAM 12614]
 gi|118438012|gb|EAV44647.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Stappia aggregata IAM 12614]
          Length = 346

 Score =  302 bits (774), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 209/320 (65%), Gaps = 9/320 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++++IAGSST+ PY+ I+AE F E   +F TP VESGGSS GLK+FC G+G++TIDI 
Sbjct: 25  ARDQVQIAGSSTVLPYASIVAEAFGEN-TDFPTPVVESGGSSAGLKKFCTGVGENTIDIA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLI 142
           N+SR I + E+  C + GV DI EV IG+DGI+  S +D  + +  T    + AL+  ++
Sbjct: 84  NASRAIREKEIKACAEAGVKDIIEVRIGYDGIVFASQKDGPAFNEFTQVQWFNALSPKVL 143

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
            D ++V NP  KWSE+    P+  IA ++P  KHGTREV E+KVL  GC  S     M D
Sbjct: 144 KDGQIVDNPYTKWSEVDASLPDAEIAAFIPGTKHGTREVFEEKVLAVGCEESGALKAMID 203

Query: 203 --MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
             M + + +    AC +VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D L
Sbjct: 204 GGMSEDDAED---ACIAVRTDGKSVDIDGDYTETLARIDSNPNGVGVFGLAFYENNTDKL 260

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           K+  + G+ PS  TI +G YP+SRPL FY+K+ H   + GL+EY  F VSDE+  PD  L
Sbjct: 261 KVATMAGVAPSTETIAAGEYPVSRPLFFYIKKAHIGVIPGLKEYAQFFVSDEIAGPDGPL 320

Query: 321 FQYGLIPISNEERKSVRDSI 340
            QYGL  +S+ E  + + SI
Sbjct: 321 AQYGL--VSDPELAATQASI 338


>gi|254475568|ref|ZP_05088954.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ruegeria sp. R11]
 gi|214029811|gb|EEB70646.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ruegeria sp. R11]
          Length = 351

 Score =  302 bits (773), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 210/322 (65%), Gaps = 8/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I   E+  C ++GV+DI EV IG+DGI+  SD +      T  D + AL+  ++VD
Sbjct: 83  ASRRIKDKEIKACAENGVTDIIEVQIGYDGIVFASDINGNGFEYTPSDWFLALSDEILVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF-----SK 199
            K+V NP K W+++   FP   I  ++P  KHGTREV E KV+  GC  +  F     + 
Sbjct: 143 GKMVANPNKTWADVNTAFPAQDIQAFIPGTKHGTREVFEDKVILAGCEATGAFDVLLAAA 202

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
             D  K   +    AC S+R DG+++++DGDYTETLARIE NKD  G  GL+FY+NN D 
Sbjct: 203 EGDSDKAKHKAAEKACISLRTDGVSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDK 262

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           L++  + G+VPS  +I +G YP+SRPL FYVK+ H   + GL+EY  F V+DE+  PD  
Sbjct: 263 LQVATMSGVVPSTESIATGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVADEVAGPDGP 322

Query: 320 LFQYGLIPISNEERKSVRDSIA 341
           L +YGL  +S+ E    + ++A
Sbjct: 323 LAEYGL--VSDPELSKTQAAVA 342


>gi|254438938|ref|ZP_05052432.1| hypothetical protein OA307_3808 [Octadecabacter antarcticus 307]
 gi|198254384|gb|EDY78698.1| hypothetical protein OA307_3808 [Octadecabacter antarcticus 307]
          Length = 343

 Score =  301 bits (772), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 149/318 (46%), Positives = 206/318 (64%), Gaps = 4/318 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ ++IAGSST+ PY+ I+AE F E   +F TP VESGGSS GLK FC G+G +TIDI 
Sbjct: 23  ARDNVQIAGSSTVLPYAAIVAEFFGEN-TDFPTPVVESGGSSAGLKRFCEGVGANTIDIA 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I  +EL  C ++GV+DI EV IG+DGI+  SD D  S + T  D Y ALA+ + +
Sbjct: 82  NASRAIKDSELAICAENGVTDIVEVRIGYDGIVFASDIDGNSFAFTPSDWYTALAADMPM 141

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D  +  NP   WS++  DF    I  ++P  KHGTREV E+KVL +GC  +   + M DM
Sbjct: 142 DGTMAANPNTDWSQVNADFAMQPIVAFIPGTKHGTREVFEEKVLLQGCEDTGAMAAMIDM 201

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +       C +VR DG+++++DGDYTETLARIE + +  G  GLSFY+NN D L++ 
Sbjct: 202 -GMDEDTAESTCMAVRTDGLSVDIDGDYTETLARIEADTNGIGVFGLSFYENNTDKLQVA 260

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + G+VP+  TI +G YP+SRPL FY+K  H   + GL+E+ SF V+DE+  PD  L  Y
Sbjct: 261 TMVGVVPTTQTISAGDYPVSRPLYFYIKAAHVGVIPGLQEFASFFVADELAGPDGPLAAY 320

Query: 324 GLIPISNEERKSVRDSIA 341
           GL  +S+ E    + ++A
Sbjct: 321 GL--VSDPELADTQAAVA 336


>gi|307941520|ref|ZP_07656875.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseibium sp. TrichSKD4]
 gi|307775128|gb|EFO34334.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseibium sp. TrichSKD4]
          Length = 345

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 148/322 (45%), Positives = 210/322 (65%), Gaps = 9/322 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+++++AGSST+ PY+ I+AE F E   +F TP VESGGSS GLK FC G+G++TID+ 
Sbjct: 25  ARDQVQVAGSSTVLPYASIVAEAFGENT-DFPTPVVESGGSSSGLKRFCEGVGENTIDVA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLI 142
           N+SRKI + E+  C ++GV+DI EV IG+DGI+  S +D  +  + T    + ALA  ++
Sbjct: 84  NASRKIREKEIKACAENGVTDIIEVRIGYDGIVFASQKDGPAFTAFTPVQWHNALAPKVL 143

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
            D ++V NP  KWSE+    P+V IA ++P  KHGTREV E+KVL  GC  S     M D
Sbjct: 144 KDGQIVDNPYNKWSEVDASLPDVEIAAFIPGTKHGTREVFEEKVLLVGCEESGAMKAMMD 203

Query: 203 --MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
             M + + +    AC +VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D L
Sbjct: 204 GGMSEDDAED---ACLAVRTDGKSVDIDGDYTETLARIDSNPNGVGVFGLAFYENNTDKL 260

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           K+  +  + PS  TI +G YP+SRPL FYVK+ H   + GL+EY  F  +DE+  P   L
Sbjct: 261 KVATMSDVAPSTETIATGTYPVSRPLFFYVKKAHIGVIPGLKEYAQFFTADEIAGPQGPL 320

Query: 321 FQYGLIPISNEERKSVRDSIAV 342
            QYGL  +++ E  + + SI+ 
Sbjct: 321 AQYGL--VADPELAATQASISA 340


>gi|159044082|ref|YP_001532876.1| periplasmic-binding protein [Dinoroseobacter shibae DFL 12]
 gi|157911842|gb|ABV93275.1| periplasmic binding protein [Dinoroseobacter shibae DFL 12]
          Length = 341

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 145/321 (45%), Positives = 210/321 (65%), Gaps = 4/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++T+DI N
Sbjct: 24  RDQVQVAGSSTVLPYAAIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTLDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I   E+  C ++GV++I EV IG+DGI+  SD +  S + T ED YKALA+   +D
Sbjct: 83  ASRQIRDAEVAVCAENGVTEIIEVRIGYDGIVFASDINGPSFAFTPEDWYKALAAEHFID 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++V N L+ W ++ PDFP   I  +VP  KHGTREV E+KV+ +GC     F  M D  
Sbjct: 143 GELVANSLETWDQVNPDFPAQPIQAFVPGTKHGTREVFEEKVILQGCQDGGFFQAMLDA- 201

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +       C S+R DG ++++DGDYTETLARI  + +  G  GL+FY+NN D L++  
Sbjct: 202 GVDEDTAEEKCMSLRTDGRSVDIDGDYTETLARIASDTNGIGVFGLAFYENNTDKLQVAT 261

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++G+VP+   I +G YP+SRPL FY+K+ H   + GL+E+  F V+DE+  PD  L  YG
Sbjct: 262 MNGVVPTTEAIAAGDYPVSRPLFFYIKKAHIGVIPGLQEFAEFFVADEIAGPDGPLAAYG 321

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L  +S+      +  +A G+S
Sbjct: 322 L--VSDPALGETQTLVASGQS 340


>gi|126736263|ref|ZP_01752005.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. CCS2]
 gi|126714084|gb|EBA10953.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. CCS2]
          Length = 344

 Score =  300 bits (767), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 146/325 (44%), Positives = 210/325 (64%), Gaps = 4/325 (1%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
           +FAR+ +++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC GIG +T+D
Sbjct: 20  SFARDNVQVAGSSTVLPYAAIVAEIFGENF-DFPTPVVESGGSSAGLKRFCEGIGANTLD 78

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR I   E++ C ++GV+DI EV IG+DGI+  SD +  S   T ED YKALA+  
Sbjct: 79  IANASRAIRPAEIEVCAENGVTDIIEVRIGYDGIVFASDINGNSFEFTPEDWYKALANEH 138

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
            +D  +V N  + W ++ PDFP   I  ++P  KHGTREV E+KV+  GC     F  M 
Sbjct: 139 FIDGALVANTFETWDQVNPDFPAQPIQAFIPGTKHGTREVFEEKVILAGCEDGGFFQAML 198

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
           D    +       C ++R DG ++++DGDYTETLARIE + +  G  GLSFY+NN D L+
Sbjct: 199 DA-GVDEDTAEGKCMAIRTDGRSVDIDGDYTETLARIEADTNGIGVFGLSFYENNTDKLQ 257

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +  ++G+VP+  +I +  YP+SRPL FY+K  H   + G++E+  F VSD++  PD  L 
Sbjct: 258 VATMNGVVPTTESIAAAEYPVSRPLYFYIKAGHIGVIPGVKEFAEFFVSDDIAGPDGPLA 317

Query: 322 QYGLI--PISNEERKSVRDSIAVGK 344
           +YGL+  P  +E +++V +   +G 
Sbjct: 318 EYGLVSDPELSEVQETVMNETVIGS 342


>gi|126737847|ref|ZP_01753577.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. SK209-2-6]
 gi|126721240|gb|EBA17944.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. SK209-2-6]
          Length = 355

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 147/326 (45%), Positives = 216/326 (66%), Gaps = 8/326 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 28  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E+  C ++GV+DI EV IG+DGI+  SD +  S   T  D + AL+  ++VD
Sbjct: 87  ASRKIKAKEVKACAENGVTDIIEVRIGYDGIVFASDINANSFEYTPTDWFLALSDKIMVD 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM---- 200
            ++V NP K W+++  +FP V I  +VP  KHGTREV E KV+  GC  +  F  +    
Sbjct: 147 GQLVDNPNKTWADVNSNFPAVEIQAFVPGTKHGTREVFEDKVILAGCEATGAFEHLLAHA 206

Query: 201 -RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
             +  K   +    AC ++R DG ++++DGDYTETLARIE NKD  G  GL+FY+NN D 
Sbjct: 207 EGETAKAKKKAAEKACIALRTDGRSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDK 266

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           L++  + GIVPS  +I +G YP+SRPL FYVK+ H   + GL+EY  F V++E+   D  
Sbjct: 267 LQVATMSGIVPSTESIATGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVAEEVAGEDGP 326

Query: 320 LFQYGLIPISNEERKSVRDSIAVGKS 345
           L +YGL  +++ E ++ +++++  K+
Sbjct: 327 LAEYGL--VADPELEATQEAVSDEKT 350


>gi|84684960|ref|ZP_01012860.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667295|gb|EAQ13765.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 343

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 142/306 (46%), Positives = 200/306 (65%), Gaps = 7/306 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TIDI 
Sbjct: 23  ARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDIA 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLI 142
           N+SR I + E+  C + GV+DI EV IG+DGI+  S  +     + T  D++ ALA  ++
Sbjct: 82  NASRAIREKEIAACAEAGVTDIIEVRIGYDGIVFASQLNGPEFTAFTESDIFNALAPKVM 141

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           VD ++V NP  KWS+   D P+  I  ++P  KHGTREV E+KV+  GC  +     M  
Sbjct: 142 VDGELVDNPHTKWSDFNADLPDAEILAFIPGTKHGTREVFEEKVIAAGCEAT---GAMEA 198

Query: 203 MFKYNVQQLSV--ACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
           M    + +     AC  VR DG+++++DGDYTETLARI+ N +  G  GL+FY+NN D L
Sbjct: 199 MIAGGMSEDDAEDACLMVRTDGMSVDIDGDYTETLARIDANTNAIGVFGLAFYENNTDKL 258

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           K+  + G+ P+  TI +G YP+SRPL FY+K+ H   + GL+EY  F V+DE+  PD  L
Sbjct: 259 KVATMSGVEPTTETIAAGDYPVSRPLYFYIKKAHIGVIPGLKEYAEFFVADEIAGPDGPL 318

Query: 321 FQYGLI 326
             YGL+
Sbjct: 319 SNYGLV 324


>gi|126462030|ref|YP_001043144.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126103694|gb|ABN76372.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 347

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 205/317 (64%), Gaps = 3/317 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+ AGSST+ PY+ I+AE F E F ++ TP VESGGS  G K+ C G+G++TIDI N
Sbjct: 24  RDNIQSAGSSTVLPYATIVAEAFGENF-DYPTPVVESGGSGAGRKKLCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D C ++GV++I EV IG+DGI+  SD      + T  D +KALA+ ++VD
Sbjct: 83  SSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIQGPDFAFTPADWFKALAAQVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP K W ++  DF +  I  ++P  KHGTREV ++KV+  GC  S          
Sbjct: 143 GKLVANPNKSWKDVNGDFSDQPILAFIPGTKHGTREVFDEKVILAGCEESGAMEAFAAAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +  +    C ++R DG ++++DGDYTETL+RI  NK+  G  GLSFY+NN D LK+  
Sbjct: 203 GGDEDKAEELCMTLRTDGASVDIDGDYTETLSRISANKNAIGVFGLSFYQNNTDKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+ PS+ TI +G YP+SRPL FYVK  H + + GL+EY+ F VSDEM  PD  L  YG
Sbjct: 263 MSGVSPSVETIAAGDYPVSRPLFFYVKNAHLDVIPGLQEYIEFFVSDEMAGPDGPLAAYG 322

Query: 325 LIPISNEERKSVRDSIA 341
           L  +S+ E    ++ +A
Sbjct: 323 L--VSDPELAKTQEMVA 337


>gi|85703112|ref|ZP_01034216.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Roseovarius sp. 217]
 gi|85672040|gb|EAQ26897.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Roseovarius sp. 217]
          Length = 345

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 146/317 (46%), Positives = 206/317 (64%), Gaps = 3/317 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ PY+ I+AE F E F EF TP VESGGS  G K+ C G+G++TIDI N
Sbjct: 23  RDNIQIAGSSTVLPYAAIVAEAFGENF-EFPTPVVESGGSGAGRKKLCEGVGENTIDIAN 81

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D C  +GV++I EV IG+DGI+  SD +  S + T  D + ALA+ ++ D
Sbjct: 82  SSSRIKQSDIDLCASNGVTEIMEVRIGYDGIVFASDINGPSYAFTPADWHAALAAQVVKD 141

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
             +  N  K WS++R D P   I  +VP  KHGTREV ++KV+  GC  +  +       
Sbjct: 142 GALADNTNKVWSDVRADLPGDEILAFVPGTKHGTREVFDEKVIIAGCEENGTYDAHLAAN 201

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG +I++DGDYTETLAR++ NK+  G  GLSFY+NN D L++  
Sbjct: 202 GGDEKAAEKACMALRTDGASIDIDGDYTETLARVDANKNGIGVFGLSFYQNNTDKLQVAT 261

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GI PS+ TI SG YP+SRPL FYVK  H + + G++EY+ F VSDE+  PD  L  YG
Sbjct: 262 MGGIEPSVETIASGEYPVSRPLFFYVKNAHLDVIPGMQEYIEFFVSDEIAGPDGPLAAYG 321

Query: 325 LIPISNEERKSVRDSIA 341
           L  +S+ E    ++ +A
Sbjct: 322 L--VSDPELAKTQEMVA 336


>gi|149914851|ref|ZP_01903380.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. AzwK-3b]
 gi|149811039|gb|EDM70876.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. AzwK-3b]
          Length = 346

 Score =  299 bits (765), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 148/323 (45%), Positives = 203/323 (62%), Gaps = 5/323 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ +++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TIDI N
Sbjct: 24  RDNVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSSGLKRFCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLIV 143
           +SR I + E+  C + GV+DI EV IG+DGI+  S  D  +  +    D Y ALA  ++ 
Sbjct: 83  ASRAIREKEVKACAEAGVTDIIEVRIGYDGIVFASQIDGPAFTAFEPADWYNALAPKVLK 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D  +V NP   WSE   D P V IA ++P  KHGTREV E+KVL  GC  +     M + 
Sbjct: 143 DGALVDNPYTMWSEFNADLPAVEIAAFIPGTKHGTREVFEEKVLAHGCEATGAMKAMEEA 202

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +   +  AC +VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK+ 
Sbjct: 203 -GMDEDAIEDACIAVRTDGRSVDIDGDYTETLARIDSNAEGVGVFGLAFYENNTDKLKVA 261

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            +  + PS  TI SG YP+SRPL FYVK+ H   + GL+E+  F VSDE+  PD  L  Y
Sbjct: 262 TMSDVAPSTETIASGEYPVSRPLFFYVKKAHIGVIPGLKEFAEFFVSDEIAGPDGPLANY 321

Query: 324 GLI--PISNEERKSVRDSIAVGK 344
           GL+  P   + +  + D + +G+
Sbjct: 322 GLVSDPELAQTQAKISDEVTMGE 344


>gi|310814684|ref|YP_003962648.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ketogulonicigenium vulgare Y25]
 gi|308753419|gb|ADO41348.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ketogulonicigenium vulgare Y25]
          Length = 340

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 138/302 (45%), Positives = 193/302 (63%), Gaps = 5/302 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ PY+ I+AE+F E FPEF  P VESGGSS GL+ FC GIG++  DI N
Sbjct: 23  RDNIQIAGSSTVLPYASIVAESFGENFPEFPVPVVESGGSSGGLQRFCAGIGENQTDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR I   E++ C  +GV+DI EV +G+DGI+  S  +    + T  D YKALA+ ++VD
Sbjct: 83  SSRPIRAGEIETCAANGVTDIIEVRVGYDGIVFASALNGPEFAFTPADWYKALAAEVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++V NP   W ++ P  P  +I  ++P  +HGTREV ++KVL  GC  S     +    
Sbjct: 143 GEIVPNPYTTWDQVNPALPAQQILAFIPGTRHGTREVFDEKVLVAGCEESGAAEVLS--- 199

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
               +    AC ++R DG+++++DGDYTETLARI  N    G  GLSFY+NN D L++  
Sbjct: 200 --AARGDEAACVALRTDGVSVDIDGDYTETLARIAANPQALGVFGLSFYENNTDTLRVAT 257

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           +  I P++  I +G YP+SRPL FY+K+ H   + GL+EY  F +SD+M  P   L QYG
Sbjct: 258 MSDIEPTVEAIATGTYPVSRPLYFYIKKAHIGVIPGLKEYAEFFMSDDMAGPAGPLAQYG 317

Query: 325 LI 326
           L+
Sbjct: 318 LV 319


>gi|77463158|ref|YP_352662.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides 2.4.1]
 gi|77387576|gb|ABA78761.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides 2.4.1]
          Length = 347

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 205/317 (64%), Gaps = 3/317 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+ AGSST+ PY+ I+AE F E F ++ TP VESGGS  G K+ C G+G++TIDI N
Sbjct: 24  RDNIQSAGSSTVLPYATIVAEAFGENF-DYPTPVVESGGSGAGRKKLCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D C ++GV++I EV IG+DGI+  SD      + T  D +KALA+ ++VD
Sbjct: 83  SSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIQGPDFAFTPADWFKALAAQVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP K W ++  DF +  I  ++P  KHGTREV ++KV+  GC  S          
Sbjct: 143 GKLVANPNKSWKDVNGDFSDQPILAFIPGTKHGTREVFDEKVVLAGCEESGAMEAFAAAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +  +    C ++R DG ++++DGDYTETL+RI  NK+  G  GLSFY+NN D LK+  
Sbjct: 203 GGDEDKAEELCMTLRTDGASVDIDGDYTETLSRISANKNAIGVFGLSFYQNNTDKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+ PS+ TI +G YP+SRPL FYVK  H + + GL+EY+ F VSDEM  PD  L  YG
Sbjct: 263 MSGVSPSVETIAAGDYPVSRPLFFYVKNAHLDVIPGLQEYIEFFVSDEMAGPDGPLAAYG 322

Query: 325 LIPISNEERKSVRDSIA 341
           L  +S+ E    ++ +A
Sbjct: 323 L--VSDPELAKTQEMVA 337


>gi|114706438|ref|ZP_01439340.1| putative phosphate-binding periplasmic protein [Fulvimarina pelagi
           HTCC2506]
 gi|114538299|gb|EAU41421.1| putative phosphate-binding periplasmic protein [Fulvimarina pelagi
           HTCC2506]
          Length = 350

 Score =  298 bits (764), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 143/341 (41%), Positives = 208/341 (60%), Gaps = 1/341 (0%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F  LM    L         +   +++AGSST+ PY++IIAEN+ E FP++ TP VESGGS
Sbjct: 6   FTSLMVGTSLAFAAPALAQSSEAVQVAGSSTVLPYAQIIAENYGETFPDYPTPVVESGGS 65

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
           S GLK+FC+G+G +TIDI NSSR+I   E+  C   GV++I E+  G+DGI+  S     
Sbjct: 66  SAGLKQFCQGVGPETIDIANSSRQIRDLEVQACNDAGVNEISEIKFGYDGIVFASAASGE 125

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           S +LT E +YKA+ + +  D ++  N    WS++ P  P+  I+ ++P+  HGTREV E+
Sbjct: 126 SFALTPEMVYKAMGAQVPQDGEMGENSFSSWSDVDPSLPDQEISAFIPASNHGTREVFEE 185

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
           K++ +GC  S     M D    +   +  AC  VR DG   E+ GDYTETLARI+ N   
Sbjct: 186 KLMLQGCEDSGAMQVMMDG-GMDEDAVEDACMQVRNDGAIGEISGDYTETLARIDANPQA 244

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G  GL+FY+ N D L++  ++ + P+   I +G YP+SRPL FYVKR H   V GL+EY
Sbjct: 245 VGVFGLAFYEQNQDKLQVATVNDVTPTAEAIATGEYPVSRPLFFYVKRAHLGVVPGLQEY 304

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           V F +S++M    S   +YGL+P+S +ER++  D    G++
Sbjct: 305 VQFFLSEQMTGEGSPTVEYGLVPLSADERQTQMDQFESGET 345


>gi|83951999|ref|ZP_00960731.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseovarius nubinhibens ISM]
 gi|83837005|gb|EAP76302.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseovarius nubinhibens ISM]
          Length = 352

 Score =  298 bits (763), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 145/308 (47%), Positives = 203/308 (65%), Gaps = 7/308 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ +++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDNVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLIV 143
           SSRKI + E+  C + GV+DI EV IG+DGI+  S +      + T  DL+ AL+  +++
Sbjct: 83  SSRKIREKEIKACAEAGVTDIIEVRIGYDGIVFASQKTGPEFTTFTQADLFNALSPKVVI 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP +KWS+   D P+V IA ++P  KHGTREV E+KVL +GC  +  +  ++  
Sbjct: 143 DGKLVDNPYQKWSDFNADLPDVEIATFIPGTKHGTREVFEEKVLVQGCEDTGAYELLKAE 202

Query: 204 FK-----YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
            +        +    AC +VR DG ++++DGDYTETLAR++ N +  G  GL+FY+NN D
Sbjct: 203 AEGEDDKAKGKAAHKACYNVRTDGKSVDIDGDYTETLARLDSNSNGVGVFGLAFYENNTD 262

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
            LK+  +  + PS  TI SG YP+SRPL FYVK+ H   + GL+EY  F VSDE+  PD 
Sbjct: 263 KLKVATMADVAPSTETIASGEYPVSRPLYFYVKKAHIGVIPGLKEYAEFFVSDEIAGPDG 322

Query: 319 QLFQYGLI 326
            L  YGL+
Sbjct: 323 PLSDYGLV 330


>gi|163743304|ref|ZP_02150685.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Phaeobacter gallaeciensis 2.10]
 gi|161383492|gb|EDQ07880.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Phaeobacter gallaeciensis 2.10]
          Length = 351

 Score =  297 bits (761), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 144/307 (46%), Positives = 201/307 (65%), Gaps = 6/307 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I   E+  C ++GV+DI EV IG+DGI+  +D    +   T  D + AL+  ++VD
Sbjct: 83  ASRRIKDKEIKACAENGVTDIIEVQIGYDGIVFANDIKGNAFEYTPTDWFLALSDEILVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM---- 200
            K+V NP K W+++   FP   I  ++P  KHGTREV E KV+  GC  +  F  +    
Sbjct: 143 GKMVANPNKTWADVNSAFPAQDIQAFIPGTKHGTREVFEDKVILAGCEATGAFEHLLTHA 202

Query: 201 -RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
             D  K   +    AC S+R DG ++++DGDYTETLARIE NKD  G  GL+FY+NN D 
Sbjct: 203 EGDSDKAKKKAAEKACISLRTDGKSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDK 262

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           L++  + GIVP+  +I  G YP+SRPL FYVK+ H   + GL+EY  F V+DE+  PD  
Sbjct: 263 LQVATMSGIVPTTESIAEGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVADEVAGPDGP 322

Query: 320 LFQYGLI 326
           L +YGL+
Sbjct: 323 LAEYGLV 329


>gi|221639015|ref|YP_002525277.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides KD131]
 gi|221159796|gb|ACM00776.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           precursor [Rhodobacter sphaeroides KD131]
          Length = 347

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 205/317 (64%), Gaps = 3/317 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+ AGSST+ PY+ I+AE F E F ++ TP VESGGS  G K+ C G+G++TIDI N
Sbjct: 24  RDNIQSAGSSTVLPYATIVAEAFGENF-DYPTPVVESGGSGAGRKKLCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D C ++GV++I EV IG+DGI+  SD      + T  D +KALA+ ++VD
Sbjct: 83  SSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIQGPDFAFTPADWFKALAAQVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP K W ++  +F +  I  ++P  KHGTREV ++KV+  GC  S          
Sbjct: 143 GKLVANPNKSWKDVNGEFSDQPILAFIPGTKHGTREVFDEKVILAGCEESGAMEAFAAAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +  +    C ++R DG ++++DGDYTETL+RI  NK+  G  GLSFY+NN D LK+  
Sbjct: 203 GGDEDKAEELCMTLRTDGASVDIDGDYTETLSRISANKNAIGVFGLSFYQNNTDKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+ PS+ TI +G YP+SRPL FYVK  H + + GL+EY+ F VSDEM  PD  L  YG
Sbjct: 263 MSGVSPSVETIAAGDYPVSRPLFFYVKNAHLDVIPGLQEYIEFFVSDEMAGPDGPLAAYG 322

Query: 325 LIPISNEERKSVRDSIA 341
           L  +S+ E    ++ +A
Sbjct: 323 L--VSDPELAKTQEMVA 337


>gi|332558032|ref|ZP_08412354.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides WS8N]
 gi|332275744|gb|EGJ21059.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides WS8N]
          Length = 347

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 205/317 (64%), Gaps = 3/317 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+ AGSST+ PY+ I+AE F E F ++ TP VESGGS  G K+ C G+G++TIDI N
Sbjct: 24  RDNIQSAGSSTVLPYATIVAEAFGENF-DYPTPVVESGGSGAGRKKLCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D C ++GV++I EV IG+DGI+  SD      + T  D +KALA+ ++VD
Sbjct: 83  SSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIQGPDFAFTPADWFKALAAQVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP K W ++  +F +  I  ++P  KHGTREV ++KV+  GC  S          
Sbjct: 143 GKLVANPNKSWKDVNGEFSDQPILAFIPGTKHGTREVFDEKVILAGCEESGAMEAFAAAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +  +    C ++R DG ++++DGDYTETL+RI  NK+  G  GLSFY+NN D LK+  
Sbjct: 203 GGDEDKAEELCMTLRTDGASVDIDGDYTETLSRISANKNAIGVFGLSFYQNNTDKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+ PS+ TI +G YP+SRPL FYVK  H + + GL+EY+ F VSDEM  PD  L  YG
Sbjct: 263 MSGVSPSVETIAAGDYPVSRPLFFYVKNAHLDVIPGLQEYIEFFVSDEMAGPDGPLAAYG 322

Query: 325 LIPISNEERKSVRDSIA 341
           L  +S+ E    ++ +A
Sbjct: 323 L--VSDPELAKTQEMVA 337


>gi|18181925|dbj|BAB83861.1| periplasmic phosphate binding protein [Rhodobacter sphaeroides f.
           sp. denitrificans]
          Length = 347

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 144/317 (45%), Positives = 203/317 (64%), Gaps = 3/317 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+ AGSST+ PY+ I+AE F E F +F TP VESGGS  G K+ C G+G++TIDI N
Sbjct: 24  RDNIQSAGSSTVLPYATIVAEAFGENF-DFPTPVVESGGSGAGRKKLCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D C ++GV++I EV IG+DGI+  SD      + T  D +KALA+ ++VD
Sbjct: 83  SSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIQGPDFAFTPADWFKALAAQVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP K W ++  D  +  I  ++P  KHGTREV ++KV+  GC  S          
Sbjct: 143 GKLVANPNKSWKDVNGDLSDQPILAFIPGTKHGTREVFDEKVILAGCEESGAMEAFAAAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +  +    C ++  DG ++++DGDYTETL+RI  NKD  G  GLSFY+NN D LK+  
Sbjct: 203 GGDEDKAEELCMTLYTDGASVDIDGDYTETLSRISANKDAIGVFGLSFYQNNTDKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+ PS+ TI +G YP+SRPL FYVK  H + + GL+EY+ F VSDEM  PD  L  YG
Sbjct: 263 MSGVTPSVETIAAGDYPVSRPLYFYVKNAHLDVIPGLQEYIEFFVSDEMAGPDGPLAAYG 322

Query: 325 LIPISNEERKSVRDSIA 341
           L  +S+ E    ++ +A
Sbjct: 323 L--VSDPELAKTQEMVA 337


>gi|255261824|ref|ZP_05341166.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thalassiobium sp. R2A62]
 gi|255104159|gb|EET46833.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thalassiobium sp. R2A62]
          Length = 341

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 140/303 (46%), Positives = 198/303 (65%), Gaps = 1/303 (0%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ ++IAGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+GD TIDI 
Sbjct: 22  ARDNVQIAGSSTVLPYAAIVAEAFGENF-DFPTPVVESGGSSSGLKRFCEGVGDTTIDIA 80

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I  +E++ C  +GV+DI EV IG+DGI+  SD +    + +  D + AL++ ++V
Sbjct: 81  NASRAIKSSEIEACAANGVTDIIEVRIGYDGIVFASDVNSNDFAFSPTDWFLALSNTILV 140

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D  +V NP   W ++   FP+  I  +VP  KHGTREV E KV+ EGC  +  F  +   
Sbjct: 141 DGAMVENPNTTWEKVNASFPDQPIQAFVPGTKHGTREVFEDKVILEGCEATGAFEAIMAA 200

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +    AC  +R DG ++++DGDYTETLARIE + +  G  GLSFY+NN D L++ 
Sbjct: 201 NGGDKKAAEGACIELRTDGRSVDIDGDYTETLARIESDANSIGVFGLSFYENNTDKLRVA 260

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++ +VPS  +I +G YP+SRPL FY+K  H   + G++EY  F V+DE+  PD  L +Y
Sbjct: 261 TMNDVVPSTESIATGEYPVSRPLYFYIKAAHIGVIPGVKEYAEFFVADEIAGPDGPLAEY 320

Query: 324 GLI 326
           GL+
Sbjct: 321 GLV 323


>gi|163736450|ref|ZP_02143869.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Phaeobacter gallaeciensis BS107]
 gi|161390320|gb|EDQ14670.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Phaeobacter gallaeciensis BS107]
          Length = 351

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 143/307 (46%), Positives = 200/307 (65%), Gaps = 6/307 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I   E+  C ++GV+DI EV IG+DGI+  +D    +   T  D + AL+  ++ D
Sbjct: 83  ASRRIKDKEVKACAENGVTDIIEVQIGYDGIVFANDIKGNAFEYTPTDWFLALSDEILAD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM---- 200
            K+V NP K W+++   FP   I  ++P  KHGTREV E KV+  GC  +  F  +    
Sbjct: 143 GKMVANPNKTWADVNSAFPAQDIQAFIPGTKHGTREVFEDKVILAGCEATGAFEHLLAHA 202

Query: 201 -RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
             D  K   +    AC S+R DG ++++DGDYTETLARIE NKD  G  GL+FY+NN D 
Sbjct: 203 EGDSDKAKKKAAEKACISLRTDGKSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDK 262

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           L++  + GIVP+  +I  G YP+SRPL FYVK+ H   + GL+EY  F V+DE+  PD  
Sbjct: 263 LQVATMSGIVPTTESIAEGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVADEVAGPDGP 322

Query: 320 LFQYGLI 326
           L +YGL+
Sbjct: 323 LAEYGLV 329


>gi|294679019|ref|YP_003579634.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Rhodobacter capsulatus SB 1003]
 gi|294477839|gb|ADE87227.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacter capsulatus SB 1003]
          Length = 351

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 140/311 (45%), Positives = 203/311 (65%), Gaps = 14/311 (4%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I+ AGSST+ PY+ I+AE F E F +FKTP VE GGS  G K+ C G+G++TIDI N
Sbjct: 24  RDQIQAAGSSTVLPYATIVAEAFGENF-DFKTPVVEGGGSGAGRKKLCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D CK +GV +I EV IG+DGI+  SD      + T  D++ A+++ ++ D
Sbjct: 83  SSSRIKQSDIDTCKANGVDEIMEVRIGYDGIVFASDIKGPDFAFTPADIFGAISAKVVKD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V N  K W+E+    P   I  ++P  KHGTREV + +VL+EGC  +  +    D++
Sbjct: 143 GKLVDNTAKTWAEVNAKLPAQDILTFIPGTKHGTREVFDIEVLEEGCKATGAY----DLY 198

Query: 205 KYNVQ---------QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
               +          +   C ++R DG+A+++DGDYTETL+RI+ NK+  G  GLSFY+N
Sbjct: 199 MATAEGADEDAKKKDVVKKCGALRTDGVAVDIDGDYTETLSRIDANKNAIGVFGLSFYQN 258

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           N D L++  I+GIVPS  TI  G YP+SRPL FYVK+ H   + GL+E+++F VSDEM  
Sbjct: 259 NTDKLRVATINGIVPSTETIAKGDYPVSRPLYFYVKKAHLGVIPGLKEFITFFVSDEMAG 318

Query: 316 PDSQLFQYGLI 326
           P+  L  YGL+
Sbjct: 319 PEGPLAAYGLV 329


>gi|114765349|ref|ZP_01444466.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pelagibaca bermudensis HTCC2601]
 gi|114542329|gb|EAU45358.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseovarius sp. HTCC2601]
          Length = 346

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 142/305 (46%), Positives = 198/305 (64%), Gaps = 7/305 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ +++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TIDI N
Sbjct: 24  RDNVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLIV 143
           +SR I   E++ C  +GV+DI EV IG+DGI+  S +      +    DLY ALA  ++V
Sbjct: 83  ASRAIRAGEVETCAANGVTDIIEVRIGYDGIVFASQQTGPEFTAFEPSDLYNALAEQVLV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D ++V NP   W++   D P+V IA ++P  KHGTREV E+KVL +GC    +   M  M
Sbjct: 143 DGELVANPHTTWADFNGDLPDVEIAAFIPGTKHGTREVFEEKVLLQGC---EDTGAMEAM 199

Query: 204 FKYNVQQLSV--ACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
               + +     AC +VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK
Sbjct: 200 VAGGMSEDDAEDACMAVRTDGKSVDIDGDYTETLARIDSNPNGIGVFGLAFYENNTDKLK 259

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +  + G+ P+  TI  G YP+SRPL FYVK+ H   + GL+EY  F V++E+  P+  L 
Sbjct: 260 VATMSGVQPTTETIAEGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVANEIAGPNGPLA 319

Query: 322 QYGLI 326
            YGL+
Sbjct: 320 NYGLV 324


>gi|149202575|ref|ZP_01879547.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Roseovarius sp. TM1035]
 gi|149143857|gb|EDM31891.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Roseovarius sp. TM1035]
          Length = 345

 Score =  295 bits (755), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 143/317 (45%), Positives = 208/317 (65%), Gaps = 3/317 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ PY+ I+AE F E F +F TP VESGGS  G K+ C G+G++TIDI N
Sbjct: 23  RDNIQIAGSSTVLPYAAIVAEAFGENF-DFPTPVVESGGSGAGRKKLCEGVGENTIDIAN 81

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D C ++GV++I EV IG+DGI+  SD +  + + T  D + ALA+ +  D
Sbjct: 82  SSSRIKQSDIDLCAQNGVTEIMEVRIGYDGIVFASDINGPAYAFTPADWHAALAAQVSKD 141

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
             +  N  K WS++R D P   I  +VP  KHGTREV ++KV+  GC  +  +       
Sbjct: 142 GALADNTNKVWSDVRADLPGDEILAFVPGTKHGTREVFDEKVIIAGCEENGTYDLHLAAN 201

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG++I++DGDYTETLAR++ NK+  G  GLSFY+NN D L++  
Sbjct: 202 GGDEKAAEKACMALRTDGVSIDIDGDYTETLARVDANKNGIGVFGLSFYQNNTDKLQVAT 261

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+VPS+ +I SG YP+SRPL FYVK  H + + G++EY+ F VSDE+  PD  L  YG
Sbjct: 262 MGGVVPSVESIASGEYPVSRPLFFYVKNAHLDVIPGMQEYIEFFVSDEISGPDGPLSAYG 321

Query: 325 LIPISNEERKSVRDSIA 341
           L  +S+ E    ++ +A
Sbjct: 322 L--VSDPELAKTQEMVA 336


>gi|126731223|ref|ZP_01747030.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sagittula stellata E-37]
 gi|126708134|gb|EBA07193.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sagittula stellata E-37]
          Length = 346

 Score =  295 bits (754), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 145/305 (47%), Positives = 195/305 (63%), Gaps = 7/305 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ +++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TIDI N
Sbjct: 23  RDNVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDIAN 81

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLIV 143
           +SR I + E+  C   GV+DI EV IG+DGI+  S  D  +  +    D+Y ALA  ++ 
Sbjct: 82  ASRAIREKEIAACADAGVTDIIEVRIGYDGIVFASQIDGPAFTAFEPADIYNALAPKVVK 141

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD- 202
           D ++V NP   WSE   D PE  I  ++P  KHGTREV E+KVL  GC  +     M D 
Sbjct: 142 DGELVDNPYTMWSEFNGDLPEAEIMAFIPGTKHGTREVFEEKVLAAGCEATGALQAMLDS 201

Query: 203 -MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
            M + + +    AC +VR DG ++++DGDYTETLA I+ N +  G  GL+FY+NN D LK
Sbjct: 202 GMSEDDAED---ACIAVRTDGRSVDIDGDYTETLASIDSNSNGIGVFGLAFYENNTDKLK 258

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +  + GI P   TI SG YP+SRPL FY+K+ H   + GL+EY  F V+DE+  PD  L 
Sbjct: 259 VATVSGIEPKTETIASGEYPVSRPLYFYIKKAHLGVIPGLKEYAEFFVADEIAGPDGPLS 318

Query: 322 QYGLI 326
            YGL+
Sbjct: 319 AYGLV 323


>gi|254462738|ref|ZP_05076154.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacterales bacterium HTCC2083]
 gi|206679327|gb|EDZ43814.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 349

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 136/328 (41%), Positives = 217/328 (66%), Gaps = 3/328 (0%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
             T   AR++++IAGSST+ PY+ I+AE F E F ++ TP VESGGSS GLK FC G+G 
Sbjct: 20  AATVAIARDQVQIAGSSTVLPYASIVAEAFGENF-DYPTPVVESGGSSAGLKRFCEGVGK 78

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKAL 137
           +TIDI N+SR+I  +EL+ C+ +GV+DI E+ IG+DGI+  S++     + T  D + AL
Sbjct: 79  NTIDIANASRQIKPSELEVCQANGVTDIIELRIGYDGIVFASEKGGNEFAYTAADWFLAL 138

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
           +  ++++ K+V NP + WS +  D  +  +  ++P  KHGTREV E KV+  GC  +   
Sbjct: 139 SDQILIEGKLVDNPNQSWSSVNADLQDQPLKAFIPGTKHGTREVFEDKVILAGCEATGAL 198

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
             ++D    + +    AC ++R DG+++++DGDYTETLARIE NK+  G  GL+FY+NN 
Sbjct: 199 DALKDANGGDEKAAEKACITLRTDGVSVDIDGDYTETLARIESNKNGIGIFGLAFYENNT 258

Query: 258 DVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           D L++  ++G++P++ +I SG YP+SRPL  Y+K+ H   + GL+++  F V DE+   D
Sbjct: 259 DKLQVATMEGVIPTVESISSGEYPVSRPLYMYLKQAHLEVIPGLKDFAEFFVLDEIAGED 318

Query: 318 SQLFQYGLIPISNEERKSVRDSIAVGKS 345
             L +YGL  +++ E ++ ++ +A G++
Sbjct: 319 GPLAEYGL--VADPELETTQEIVANGQT 344


>gi|260427703|ref|ZP_05781682.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Citreicella sp. SE45]
 gi|260422195|gb|EEX15446.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Citreicella sp. SE45]
          Length = 346

 Score =  292 bits (748), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 141/303 (46%), Positives = 194/303 (64%), Gaps = 3/303 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ ++IAGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TIDI N
Sbjct: 24  RDNVQIAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLIV 143
           +SR I + E+  C   GV+DI +V IG+DGI+  S +      +    DLY ALA  ++V
Sbjct: 83  ASRAIREKEIAACADAGVTDIIQVRIGYDGIVFASQKTGPEFTAFEPADLYNALAEQVLV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D ++  NP   W+E   + P+V IA ++P  KHGTREV E+KVL +GC  +     M D 
Sbjct: 143 DGEMKPNPYNTWAEFNSELPDVEIAAFIPGTKHGTREVFEEKVLLQGCEDTGAMQAMIDG 202

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC +VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK+ 
Sbjct: 203 -GMSEDDAEGACMAVRTDGKSVDIDGDYTETLARIDSNANGVGVFGLAFYENNTDKLKVA 261

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + G+ P+  TI  G YP+SRPL FY+K+ H   + GL+E+  F VSDE+  P   L  Y
Sbjct: 262 TMSGVQPTTETIAEGEYPVSRPLFFYIKKAHIGVIPGLKEFAEFFVSDEIAGPSGPLANY 321

Query: 324 GLI 326
           GL+
Sbjct: 322 GLV 324


>gi|254450420|ref|ZP_05063857.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Octadecabacter antarcticus 238]
 gi|198264826|gb|EDY89096.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Octadecabacter antarcticus 238]
          Length = 328

 Score =  292 bits (747), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 144/318 (45%), Positives = 207/318 (65%), Gaps = 4/318 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ ++IAGSST+ PY+ I+AE F E   +F TP VESGGSS GLK FC G+G++TIDI 
Sbjct: 8   ARDNVQIAGSSTVLPYAAIVAEFFGEN-TDFPTPVVESGGSSAGLKRFCEGVGENTIDIA 66

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I  +E+  C ++GV+DI EV IG+DGI+  SD +  S + T  D Y ALA+ + +
Sbjct: 67  NASRAIKDSEIAICAENGVTDIVEVRIGYDGIVFASDINGNSFAFTPSDWYTALAAEMPM 126

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D  +V N    WS++  DF +  I  ++P  KHGTREV E+KVL +GC  +   + M +M
Sbjct: 127 DGAMVANLNTDWSQVNADFADQPIVSFIPGTKHGTREVFEEKVLLQGCEDTGAMAAMIEM 186

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC +VR DG+++++DGDYTETLARIE + +  G  GLSFY+NN D L++ 
Sbjct: 187 -GMDEDTAEGACMAVRTDGLSVDIDGDYTETLARIEADTNGIGVFGLSFYENNTDKLQVA 245

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            +  +VP+  +I +G YP+SRPL FY+K  H   + GL+E+ SF V+DE+  P   L  Y
Sbjct: 246 TMSDVVPTTQSISTGEYPVSRPLYFYIKAAHVGVIPGLKEFASFFVADELAGPSGPLADY 305

Query: 324 GLIPISNEERKSVRDSIA 341
           GL  +S+ E    + ++A
Sbjct: 306 GL--VSDPELADTQAAVA 321


>gi|89069581|ref|ZP_01156925.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanicola granulosus HTCC2516]
 gi|89044916|gb|EAR51006.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanicola granulosus HTCC2516]
          Length = 344

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 201/319 (63%), Gaps = 5/319 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           +R+ ++IAGSST+ PY+ I+AE F E   +F TP VESGGSS GL  FC G+G++TIDI 
Sbjct: 25  SRDNVQIAGSSTVLPYASIVAEVFGEN-TDFPTPVVESGGSSAGLARFCEGVGENTIDIA 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLI 142
           N+SR I + EL+EC  +GV+DI EV IG+DGI+  S  D     +    D + ALA+ L 
Sbjct: 84  NASRAIREGELEECAANGVTDIIEVRIGYDGIVFASRIDGPDFTAFEASDWFTALAAELP 143

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           VD ++V NP   W+E+  D P+  I  ++P  KHGTREV E+KVL +GC  +       D
Sbjct: 144 VDGEIVENPHTTWNEVDADLPDAEILAFIPGTKHGTREVFEEKVLLQGCEDTGALQAFLD 203

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
               +      AC +VR DG ++++DGDYTETLAR++ N    G  GLSFY+NN D LK+
Sbjct: 204 S-GMDEDAAESACMAVRTDGASVDIDGDYTETLARLDSNPQGVGVFGLSFYENNTDKLKV 262

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
             + G+ P+  TI +G YP+SRPL FY+K  H   + GL+E+  F V+DE+  PD  L  
Sbjct: 263 ATMGGVEPTTETIAAGDYPVSRPLYFYIKAAHLGVIPGLKEFAQFFVADELAGPDGPLAA 322

Query: 323 YGLIPISNEERKSVRDSIA 341
           YGL  +S+ E  + +  +A
Sbjct: 323 YGL--VSDPELAATQAKVA 339


>gi|84501122|ref|ZP_00999357.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanicola batsensis HTCC2597]
 gi|84391189|gb|EAQ03607.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanicola batsensis HTCC2597]
          Length = 346

 Score =  290 bits (742), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 139/305 (45%), Positives = 200/305 (65%), Gaps = 7/305 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E   ++ TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAELFGEN-TDYPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLIV 143
           +SR I + E+  C  +GV+DI EV IG+DGI+  S +   +  +    D++ A+ + ++V
Sbjct: 83  ASRAIREKEVAACADNGVTDIIEVRIGYDGIVFASQQSGPAFTAFEPTDIFNAIGAQVLV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD- 202
           D ++V NP   W+E   + P+  IA+++P  KHGTREV E+KVL  GC  +     M D 
Sbjct: 143 DGEIVDNPYNTWAEFNSELPDTEIAMFIPGTKHGTREVFEEKVLLIGCEETGAMQAMIDG 202

Query: 203 -MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
            M + + +    AC  VRQDG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK
Sbjct: 203 GMSEDDAED---ACLDVRQDGKSVDIDGDYTETLARIDANTNGIGVFGLAFYENNTDKLK 259

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +  + G+ PS  TI SG YP+SRPL FYVK+ H   + GL+EY  F V+DE+  P   L 
Sbjct: 260 VATMSGVSPSTETIASGEYPVSRPLFFYVKKAHIGVIPGLKEYAQFFVADEIAGPGGPLS 319

Query: 322 QYGLI 326
            YGL+
Sbjct: 320 NYGLV 324


>gi|89054780|ref|YP_510231.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Jannaschia sp. CCS1]
 gi|88864329|gb|ABD55206.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Jannaschia sp. CCS1]
          Length = 344

 Score =  289 bits (739), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 138/326 (42%), Positives = 206/326 (63%), Gaps = 2/326 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M F  + +    V  +       +R+ ++IAGSST+ PY+ I+AE F E F +F TP VE
Sbjct: 1   MSFAKLSVSVLAVTAITTAASAQSRDNVQIAGSSTVLPYATIVAEAFGENF-DFPTPVVE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GL+ FC G+G++T DI NSSR I ++E+  C ++GV+DI EV  G+DGI+  SD
Sbjct: 60  SGGSSTGLRRFCEGVGENTTDIANSSRSIRESEIATCAENGVTDIIEVRFGYDGIVFASD 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +  S   T  D + ALA+ L VD ++V NP   WS++R   P+  I+ +VP  +HGTRE
Sbjct: 120 INGPSFEFTQSDWHLALAAELPVDGEMVANPNTNWSQVRDGLPDQPISAFVPGTRHGTRE 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V +++V+ +GC  + + + + DM   +      AC  +R DG+++++DGDYTETLARI  
Sbjct: 180 VFDERVILQGCEDNGSMAAIMDM-GMDEDAAEEACMELRADGVSVDIDGDYTETLARINA 238

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           + +  G  GL+FY+NN  VL++  + G+VP++  I +G YP+SRPL FY+K  H   + G
Sbjct: 239 DANGIGVFGLAFYENNTSVLQVATMAGVVPTVDAIATGEYPVSRPLYFYIKAAHLGVIPG 298

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLI 326
           L+EY  F VSD++      L  YGL+
Sbjct: 299 LQEYADFFVSDDIAGDWGPLAAYGLV 324


>gi|299769226|ref|YP_003731252.1| putative phosphate transporter [Acinetobacter sp. DR1]
 gi|298699314|gb|ADI89879.1| putative phosphate transporter [Acinetobacter sp. DR1]
          Length = 343

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 201/322 (62%), Gaps = 8/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S+    +  L    ++ ALA+ L  +
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASNSHKAAYKLKPYHVFAALAAQLPSN 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM-RDM 203
            K+V NP   W++I    P   I + +P+  HGTREV ++K++  GC     F  + +D 
Sbjct: 147 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVDAGCEAYEYFKNLDKDA 206

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K        AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++ 
Sbjct: 207 QKK-------ACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVA 259

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + VS +     S+  + 
Sbjct: 260 TVNNVVPSEKTVLNGTYPVSRPLFFYVKGEHLKSVKGLPQYVEYFVSKKATGKGSKAERD 319

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GLI +S+ ER  V      GK+
Sbjct: 320 GLIAMSDAERAKVLADFKAGKT 341


>gi|184158974|ref|YP_001847313.1| phosphate ABC transporter periplasmic protein [Acinetobacter
           baumannii ACICU]
 gi|183210568|gb|ACC57966.1| ABC-type phosphate transport system, periplasmic component
           [Acinetobacter baumannii ACICU]
          Length = 343

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 201/322 (62%), Gaps = 8/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S     +  L    ++ ALA+ L   
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASSSSKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM-RDM 203
            K+V NP  KW++I    P   I + +P+  HGTREV ++K+++ GC     F  + +D 
Sbjct: 147 GKLVPNPYTKWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCEAYEYFKSLDKDA 206

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K        AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++ 
Sbjct: 207 QKK-------ACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVA 259

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + +S +     S+  + 
Sbjct: 260 TVNNVVPSEKTVLNGTYPVSRPLYFYVKGEHLKSVKGLPQYVEYFLSKKATGKGSKAERD 319

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GLI +S+ ER  V      GK+
Sbjct: 320 GLIAMSDAERAKVLADFKAGKT 341


>gi|262278266|ref|ZP_06056051.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter calcoaceticus RUH2202]
 gi|262258617|gb|EEY77350.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter calcoaceticus RUH2202]
          Length = 343

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 202/322 (62%), Gaps = 8/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSRKI   E++ C K GV  IQE+ IG+DGI+  S+ +  +  L    ++ ALA+ L   
Sbjct: 87  SSRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASNSNKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM-RDM 203
            K+V NP   W++I    P   I + +P+  HGTREV ++K+++ GC     F  + +D 
Sbjct: 147 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCEAYGYFKSLDKDA 206

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K        AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++ 
Sbjct: 207 QKK-------ACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVA 259

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL ++V + VS +     S+  + 
Sbjct: 260 TVNNVVPSEKTVLNGTYPVSRPLFFYVKGEHLKSVKGLPQFVEYFVSKKATGKGSKAERD 319

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GLI +S+ ER  V      GK+
Sbjct: 320 GLIAMSDAERAKVLADFKAGKT 341


>gi|293609758|ref|ZP_06692060.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828210|gb|EFF86573.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122980|gb|ADY82503.1| putative phosphate transporter (ABC superfamily, PerI-bind)
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 343

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 139/322 (43%), Positives = 201/322 (62%), Gaps = 8/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S+    +  L    ++ ALA+ L   
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASNSHKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM-RDM 203
            K+V NP   W++I    P   I + +P+  HGTREV ++K+++ GC     F  + +D 
Sbjct: 147 GKLVPNPYTNWNQIDKTLPNEPITLVIPASNHGTREVFQEKMVEAGCEAYEYFKSLDKDA 206

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K        AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++ 
Sbjct: 207 QKK-------ACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVA 259

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + VS +     S+  + 
Sbjct: 260 TVNNVVPSEKTVLNGTYPVSRPLYFYVKGEHLKSVKGLPQYVEYFVSKKATGKGSKAERD 319

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GLI +S+ ER  V      GK+
Sbjct: 320 GLIAMSDAERAKVLADFKAGKT 341


>gi|254509599|ref|ZP_05121666.1| putative phosphate ABC transporter periplasmic phosphate-binding
           protein [Rhodobacteraceae bacterium KLH11]
 gi|221533310|gb|EEE36298.1| putative phosphate ABC transporter periplasmic phosphate-binding
           protein [Rhodobacteraceae bacterium KLH11]
          Length = 346

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 142/320 (44%), Positives = 198/320 (61%), Gaps = 9/320 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ +++AGSST+ PY+ I+AE F E   +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDNVQVAGSSTVLPYASIVAELFGEN-TDFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS-VSLTVEDLYKALASYLIV 143
           +SR I + E+  C ++GV+DI EV IG+DGI+  S +   +  +    D+Y A+ S ++ 
Sbjct: 83  ASRAIREKEIKACAENGVTDIMEVRIGYDGIVFASQQAGPAFTAFQPADIYNAIGSKVMK 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D  +V N    W+E   D P+V IA+++P  KHGTREV E KVL  GC    +   M  M
Sbjct: 143 DGALVDNSYNSWAEFNGDLPDVEIAMFIPGTKHGTREVFEDKVLLAGC---ESTGAMEAM 199

Query: 204 FKYNVQQLSV--ACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
               + +     AC  VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK
Sbjct: 200 IAGGMSEDDAEDACLDVRADGKSVDIDGDYTETLARIDTNPNGIGVFGLAFYENNTDKLK 259

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +  +  I PS  TI SG YP+SRPL FYVK+ H   + GL+EY  F   DE+      L 
Sbjct: 260 VATMGDIAPSTETIASGEYPVSRPLFFYVKKAHIGVIPGLKEYAQFFTHDEIAGGSGPLA 319

Query: 322 QYGLIPISNEERKSVRDSIA 341
            YGL  +++ E    +D+IA
Sbjct: 320 NYGL--VADPELAKTQDAIA 337


>gi|169795175|ref|YP_001712968.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter baumannii AYE]
 gi|213158161|ref|YP_002320212.1| phosphate ABC transporter, substrate-binding protein [Acinetobacter
           baumannii AB0057]
 gi|301345430|ref|ZP_07226171.1| phosphate ABC transporter, substrate-binding protein [Acinetobacter
           baumannii AB056]
 gi|301511735|ref|ZP_07236972.1| phosphate ABC transporter, substrate-binding protein [Acinetobacter
           baumannii AB058]
 gi|301596644|ref|ZP_07241652.1| phosphate ABC transporter, substrate-binding protein [Acinetobacter
           baumannii AB059]
 gi|169148102|emb|CAM85965.1| putative phosphate transporter (ABC superfamily, peri-bind)
           [Acinetobacter baumannii AYE]
 gi|213057321|gb|ACJ42223.1| phosphate ABC transporter, substrate-binding protein [Acinetobacter
           baumannii AB0057]
          Length = 343

 Score =  283 bits (724), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 201/322 (62%), Gaps = 8/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S  +  +  L    ++ ALA+ L   
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASSSNKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM-RDM 203
            K+V NP   W++I    P   I + +P+  HGTREV ++K+++ GC     F  + +D 
Sbjct: 147 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCEAYEYFKSLDKDA 206

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K        AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++ 
Sbjct: 207 QKK-------ACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVA 259

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + +S +     S+  + 
Sbjct: 260 TVNNVVPSEKTVLNGTYPVSRPLYFYVKGEHLKSVKGLPQYVEYFLSKKATGKGSKAERD 319

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GLI +S+ ER  V      GK+
Sbjct: 320 GLIAMSDAERAKVLADFKAGKT 341


>gi|126642484|ref|YP_001085468.1| putative phosphate transporter [Acinetobacter baumannii ATCC 17978]
 gi|332857056|ref|ZP_08436362.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6013150]
 gi|332869994|ref|ZP_08438970.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6013113]
 gi|332874755|ref|ZP_08442625.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6014059]
 gi|332726871|gb|EGJ58385.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6013150]
 gi|332732494|gb|EGJ63745.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6013113]
 gi|332737016|gb|EGJ67973.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6014059]
          Length = 348

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 200/322 (62%), Gaps = 8/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 32  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 91

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S     +  L    ++ ALA+ L   
Sbjct: 92  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASSSSKAAYKLKPYHVFAALAAQLPSK 151

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM-RDM 203
            K+V NP   W++I    P   I + +P+  HGTREV ++K+++ GC     F  + +D 
Sbjct: 152 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCEAYEYFKSLDKDA 211

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K        AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++ 
Sbjct: 212 QKK-------ACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVA 264

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + +S +     S+  + 
Sbjct: 265 TVNNVVPSEKTVLNGTYPVSRPLYFYVKGEHLKSVKGLPQYVEYFLSKKATGKGSKAERD 324

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GLI +S+ ER  V      GK+
Sbjct: 325 GLIAMSDAERAKVLADFKAGKT 346


>gi|169632868|ref|YP_001706604.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter baumannii SDF]
 gi|215482723|ref|YP_002324921.1| Protein sphX precursor [Acinetobacter baumannii AB307-0294]
 gi|239501138|ref|ZP_04660448.1| putative phosphate transporter [Acinetobacter baumannii AB900]
 gi|260556655|ref|ZP_05828873.1| sphX [Acinetobacter baumannii ATCC 19606]
 gi|169151660|emb|CAP00450.1| putative phosphate transporter (ABC superfamily, peri-bind)
           [Acinetobacter baumannii]
 gi|193077953|gb|ABO12866.2| putative phosphate transporter [Acinetobacter baumannii ATCC 17978]
 gi|213987049|gb|ACJ57348.1| Protein sphX precursor [Acinetobacter baumannii AB307-0294]
 gi|260409914|gb|EEX03214.1| sphX [Acinetobacter baumannii ATCC 19606]
 gi|322508956|gb|ADX04410.1| Putative phosphate transporter [Acinetobacter baumannii 1656-2]
 gi|323518942|gb|ADX93323.1| putative phosphate transporter [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 343

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 200/322 (62%), Gaps = 8/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S     +  L    ++ ALA+ L   
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASSSSKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM-RDM 203
            K+V NP   W++I    P   I + +P+  HGTREV ++K+++ GC     F  + +D 
Sbjct: 147 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCEAYEYFKSLDKDA 206

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K        AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++ 
Sbjct: 207 QKK-------ACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVA 259

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + +S +     S+  + 
Sbjct: 260 TVNNVVPSEKTVLNGTYPVSRPLYFYVKGEHLKSVKGLPQYVEYFLSKKATGKGSKAERD 319

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GLI +S+ ER  V      GK+
Sbjct: 320 GLIAMSDAERAKVLADFKAGKT 341


>gi|260772585|ref|ZP_05881501.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Vibrio metschnikovii CIP 69.14]
 gi|260611724|gb|EEX36927.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Vibrio metschnikovii CIP 69.14]
          Length = 340

 Score =  281 bits (720), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 147/340 (43%), Positives = 202/340 (59%), Gaps = 6/340 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+F    L+    +         AR  I+IAGSST+ P+S I+AE F + F +F TP V 
Sbjct: 1   MKFGRNALLLASTVATAISAPAMARETIQIAGSSTVLPFSSIVAEEFGQTFAQFNTPIVG 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  GL++FC+G+G +TIDI NSSR I  NEL  CK +GV+++ EV IG+DGI+  S 
Sbjct: 61  SGGSGGGLRQFCQGVGVNTIDIANSSRAIRPNELANCKANGVNEVIEVKIGYDGIVFASR 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            D  S +L  E ++KA A+ +  + K+V NP   W +I P  P+  I + +P   HGTRE
Sbjct: 121 TDSGSFALKPEHVFKAGAAQIPQNGKMVNNPYTNWKQIDPSLPDQDILLVIPGSNHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KV+  GC        M    K N       C ++R DG  +EV GDYTETLAR++ 
Sbjct: 181 VYEEKVVHPGCATFAEVKAMDSKAKENF------CNAIRTDGRVVEVAGDYTETLARLDA 234

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
            ++  G  GLSFY  N D LK+  +DG+ PS+ TI +G YP+SRPL FY+K  H   V G
Sbjct: 235 QRNALGVFGLSFYDQNRDRLKVATVDGVTPSLETISTGEYPVSRPLFFYIKNAHVGVVPG 294

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L EY  F V++++    S L + GLIP+ + ER  V + I
Sbjct: 295 LLEYAQFFVNEQIGGMGSPLEEAGLIPMDDAERAQVSNDI 334


>gi|260549703|ref|ZP_05823920.1| sphX [Acinetobacter sp. RUH2624]
 gi|260407220|gb|EEX00696.1| sphX [Acinetobacter sp. RUH2624]
          Length = 343

 Score =  281 bits (718), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 137/322 (42%), Positives = 199/322 (61%), Gaps = 8/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S     +  L    ++ ALA+ L   
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASSSHKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM-RDM 203
            K+V NP   W++I    P   I + +P+  HGTREV ++K++  GC     F  + +D 
Sbjct: 147 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVDAGCESYEYFKNLDKDA 206

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K        AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++ 
Sbjct: 207 QKK-------ACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVA 259

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++ ++PS  T+++G YP+SRPL FYVK +H  SV GL +YV + +S +     S+  + 
Sbjct: 260 SVNNVLPSEKTVLNGTYPVSRPLFFYVKGEHLKSVKGLPQYVEYFLSKKATGKGSKAERD 319

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GLI +S+ ER  V      GK+
Sbjct: 320 GLIAMSDAERAKVLADFKAGKT 341


>gi|262368531|ref|ZP_06061860.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter johnsonii SH046]
 gi|262316209|gb|EEY97247.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter johnsonii SH046]
          Length = 341

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 139/321 (43%), Positives = 207/321 (64%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ PY+ I+AE F   FP+FK P V SGGSS GLK+FC G+GD+TIDI N
Sbjct: 25  RDTIQIAGSSTVLPYASIVAEEFGNTFPQFKAPVVGSGGSSGGLKQFCNGVGDNTIDIAN 84

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   EL  CKK GV+ + E+ IG+DGI+  S+    +  L  + +Y ALA+ L  +
Sbjct: 85  ASRKIKDTELAACKKAGVNQVIEIKIGYDGIVFASNASKAAYKLRPQHVYAALAAQLPSN 144

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP  +W++I    P   I + +P+  HGTREV ++K++  GC     ++ ++ M 
Sbjct: 145 GKMVANPYTRWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVDAGC---ETYAAIKAMD 201

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           K   ++   AC++ R+DG  IE+ GDYTETLAR++ +    G  GL FY  N D L++  
Sbjct: 202 KDAQKK---ACSTFRKDGKVIEIAGDYTETLARLKTSPSAVGVFGLGFYDQNRDKLRVAT 258

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ + PS  TI++G YP+SRPL FYVK +H  S+ GL+EY  + +S ++    S+L + G
Sbjct: 259 VNNVAPSEKTILNGSYPVSRPLFFYVKGEHLKSIKGLKEYTEYFISKKVSGKGSKLERAG 318

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S++ER +V  +   GK+
Sbjct: 319 LISMSDKERAAVLANFKAGKA 339


>gi|110635450|ref|YP_675658.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Mesorhizobium sp. BNC1]
 gi|110286434|gb|ABG64493.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chelativorans sp. BNC1]
          Length = 346

 Score =  278 bits (712), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 144/316 (45%), Positives = 202/316 (63%), Gaps = 8/316 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           +R+ I+IAGSST+ P++ I+AE F   FPEFKTP V SGGSS GL++FC+G+G++TIDI 
Sbjct: 26  SRDTIQIAGSSTVLPFASIVAEEFGNAFPEFKTPVVGSGGSSGGLRQFCQGVGENTIDIA 85

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           NSSR+I  +E++ C + GV+ I E+ IG DGI+  +  D    +L    ++KA+A+ + V
Sbjct: 86  NSSRRIRASEIEACNQAGVNQILEIQIGFDGIVFATSADKGDFALEPVHVFKAVAAKVPV 145

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           + ++V NP K WSEI    P+  IA+ +P+  HGTREV E+KVL  GC  +         
Sbjct: 146 EGEMVDNPYKSWSEIDSSLPDQPIAVAIPASNHGTREVFEEKVLHAGCEAAELPEME--- 202

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                + +  ACT++RQD + +E+ GDYTETLAR++ N D  G  GLSFY  N D LK+ 
Sbjct: 203 ----EEAMEAACTAIRQD-VVVEIAGDYTETLARLQSNPDTVGVFGLSFYDQNRDTLKVA 257

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + G+ PS+ TI SG YP+SRPL FYVK +H   V G+ EYV F +SD+M      L   
Sbjct: 258 TMSGVTPSLETIASGEYPVSRPLYFYVKGEHIGQVPGIEEYVEFFMSDQMAGAGGTLEGA 317

Query: 324 GLIPISNEERKSVRDS 339
           G+IP   E+   V D+
Sbjct: 318 GMIPQPEEKTAEVVDA 333


>gi|262376067|ref|ZP_06069298.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter lwoffii SH145]
 gi|262309161|gb|EEY90293.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter lwoffii SH145]
          Length = 343

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 143/345 (41%), Positives = 218/345 (63%), Gaps = 6/345 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MRF  + L   V       T   AR+ I+IAGSST+ PY+ I+AE F   FP+FKTP V 
Sbjct: 1   MRFTNIALALAVTGATAVTTAHAARDTIQIAGSSTVLPYASIVAEEFGNTFPQFKTPVVG 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLK+FC G+GD+TIDI NSSR+I   EL ECKK+GV+ + E+ IG+DGI+  S+
Sbjct: 61  SGGSSGGLKQFCNGVGDNTIDIANSSRQIKSTELAECKKNGVNQVLEIKIGYDGIVFASN 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +  +  L  + ++ ALA+ L  + K+V NP  +W++I    P   I + +P+  HGTRE
Sbjct: 121 ANKAAYKLRPQHVFAALAAQLPSNGKMVANPYTRWNQIDKALPNEPITLVIPASNHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V ++K++  GC     ++ ++ + K   ++   ACT+ R+DG  +E+ GDYTETLAR++ 
Sbjct: 181 VFQEKMVDAGC---ETYAAIKSLDKDAKKK---ACTTFRKDGRVVEIAGDYTETLARLKT 234

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +    G  GL FY  N D L++  ++ + PS  TI++G YP+SRPL FYVK +H  S+ G
Sbjct: 235 SPSAVGVFGLGFYDQNRDRLRVATVNNVAPSEKTILNGAYPVSRPLFFYVKGEHLKSIKG 294

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L ++  + ++ ++    S+L + GLI +S++ER +V  +   GK+
Sbjct: 295 LPQFTEYFLNKKVSGKGSKLEKAGLISMSDKERAAVLANFKAGKA 339


>gi|262372058|ref|ZP_06065337.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter junii SH205]
 gi|262312083|gb|EEY93168.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter junii SH205]
          Length = 343

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 144/342 (42%), Positives = 211/342 (61%), Gaps = 8/342 (2%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           ++ L   V      GT   AR+ I+IAGSST+ PY+ I+AE F   FP+FK P V SGGS
Sbjct: 7   YIALALAVSGATVAGTANAARDTIQIAGSSTVLPYASIVAEEFGNTFPQFKAPVVGSGGS 66

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
           S GLK+FC+G+GD+TIDI NSSR I   E+  CKK GV+ IQE+ IG+DGI+  S+    
Sbjct: 67  SGGLKQFCQGVGDNTIDIANSSRAIKDTEIAACKKAGVNQIQEIKIGYDGIVFASNVKKA 126

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           +  L    ++ AL++ L  + K+V NP   W++I    P   I + +P+  HGTREV ++
Sbjct: 127 AYKLKPYHVFTALSAQLPSNGKLVPNPYTTWNQIDKSLPNEPITLVIPASNHGTREVFQE 186

Query: 185 KVLQEGCVRSRNFSKMRDMFK-YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           K+++ GC       +  D FK  + +    AC++ R+DG  IE+ GDYTETLAR++ +  
Sbjct: 187 KMVEAGC-------EAYDYFKNLDKEAQKKACSTFRKDGRVIEIAGDYTETLARLKTSPS 239

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GL FY  N D L++  ++ +VPS  TI+SG YP+SRPL FYVK +H  S+ GL +
Sbjct: 240 AVGVFGLGFYDLNRDKLRVATVNNVVPSEKTILSGQYPVSRPLFFYVKGEHLKSIKGLPQ 299

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           YV + ++ ++    S+L + GLI +S++ER  +      GK+
Sbjct: 300 YVEYFLNKKVSGKGSKLEKAGLIALSDKERAKILADFKAGKT 341


>gi|255318363|ref|ZP_05359596.1| ABC-type phosphate transport system, periplasmic component
           [Acinetobacter radioresistens SK82]
 gi|262378593|ref|ZP_06071750.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter radioresistens SH164]
 gi|255304355|gb|EET83539.1| ABC-type phosphate transport system, periplasmic component
           [Acinetobacter radioresistens SK82]
 gi|262299878|gb|EEY87790.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter radioresistens SH164]
          Length = 343

 Score =  273 bits (699), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 140/321 (43%), Positives = 206/321 (64%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ PY+ I+AE F   FP+FKTP V SGG+S GLK+FC+G+GD+TIDI N
Sbjct: 27  RDTIQIAGSSTVLPYASIVAEEFGNTFPQFKTPVVGSGGTSGGLKQFCQGVGDNTIDIAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I   EL  CKK GV+ +QE+ IG+DGI+  S+ +  +  L    +Y ALA  L   
Sbjct: 87  ASREIKDTELASCKKAGVNKVQEIKIGYDGIVFASNANKAAFKLKPYHVYAALAEKLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP  +W++I    P   I + +P+  HGTREV ++K++  GC ++  ++K  D  
Sbjct: 147 GKLVANPYTRWNQIDKTLPNEPITLVIPASNHGTREVFQEKMVDLGC-KAYEYNKNLDK- 204

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + Q+    C++ R+DG  IE+ GDYTETL+R++ N    G  GL FY  N D L++  
Sbjct: 205 --DTQK--TVCSTFRKDGRVIEISGDYTETLSRLKTNPSAVGVFGLGFYDQNRDRLRVAT 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ + PS  TI+SG YP+SRPL FYVK +H  SV GL +YV + ++ ++    S+L + G
Sbjct: 261 VNNVTPSEATILSGKYPVSRPLFFYVKGEHLKSVKGLEQYVEYFLNKKVSGKGSKLEKAG 320

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V  +   GK+
Sbjct: 321 LISLSDSERAKVLANFKAGKT 341


>gi|50084401|ref|YP_045911.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter sp. ADP1]
 gi|49530377|emb|CAG68089.1| putative phosphate transporter (ABC superfamily, peri-bind)
           [Acinetobacter sp. ADP1]
          Length = 343

 Score =  272 bits (695), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 139/321 (43%), Positives = 202/321 (62%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ PY+ I+AE F   FP+FKTP V SGG+S GLK+FC+G+GD+TIDI N
Sbjct: 27  RDTIQIAGSSTVLPYASIVAEEFGNTFPQFKTPVVGSGGTSGGLKQFCQGVGDNTIDIAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRK+   EL  CKK GV+ +QE+ IG+DGI+  S+       L    ++ ALA  L  +
Sbjct: 87  ASRKVKDTELAACKKAGVNQVQEIKIGYDGIVFASNLSKPVYKLKPAFVFAALAEKLPSN 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++V NP  +W++I    P   I + +P+  HGTREV ++K+++ GC     F KM    
Sbjct: 147 GQLVANPYTRWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCEAYDYFKKM---- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + ++   AC++ R+DG  IE+ GDYTETLAR++ +    G  GL FY  N D L++  
Sbjct: 203 --DKEEQKKACSAFRKDGRVIEISGDYTETLARLKTSPSAVGVFGLGFYDQNRDKLRVAT 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ + PS  TI++G YP+SRPL FYVK +H  S+ GL +YV F ++ +     S+L + G
Sbjct: 261 VNNVAPSEKTILNGSYPVSRPLFFYVKGEHVKSIKGLPQYVEFFLNKKTSGKGSKLEKAG 320

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V      GKS
Sbjct: 321 LISMSDSERAKVLADFKAGKS 341


>gi|294649819|ref|ZP_06727221.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Acinetobacter haemolyticus ATCC 19194]
 gi|292824302|gb|EFF83103.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Acinetobacter haemolyticus ATCC 19194]
          Length = 348

 Score =  271 bits (694), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 140/320 (43%), Positives = 202/320 (63%), Gaps = 6/320 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ I+AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TIDI N
Sbjct: 32  RDTIQIAGSSTVLPFASIVAEEFGNTFPQFKTPVVGSGGSSGGLKQFCQGVGDNTIDIAN 91

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR +  +E+  C K GV+ IQE+ IG+DGI+  S+ +  +  L    ++ A+A+ L  +
Sbjct: 92  SSRPMRSSEVSTCAKAGVNKIQEIKIGYDGIVFASNINKAAYKLKPYHVFTAIAAELPSN 151

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P   HGTREV ++K++  GC     +  ++++ 
Sbjct: 152 GKMVPNPYTHWNQIDKSLPNEPITLVIPGSNHGTREVFQEKMVDAGC---EAYEYIKNLD 208

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           K   ++   ACT+ RQ G  IE+ GDYTETLAR+       G  GLSFY  N D L++  
Sbjct: 209 KDAQKK---ACTTFRQGGRVIEIAGDYTETLARLRTTPSAVGVFGLSFYDQNRDKLRVAT 265

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  TI+SG YP+SRPL FYVK +H NS+ GL +YV F ++       S+L + G
Sbjct: 266 VNNVVPSEATILSGKYPVSRPLYFYVKGEHLNSIKGLPQYVEFFLNKRTSGKGSKLERAG 325

Query: 325 LIPISNEERKSVRDSIAVGK 344
           LIP+S+ ER  +      GK
Sbjct: 326 LIPLSDSERAKILADFKAGK 345


>gi|226952524|ref|ZP_03822988.1| phosphate transporter [Acinetobacter sp. ATCC 27244]
 gi|226836751|gb|EEH69134.1| phosphate transporter [Acinetobacter sp. ATCC 27244]
          Length = 348

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 140/320 (43%), Positives = 202/320 (63%), Gaps = 6/320 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ I+AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TIDI N
Sbjct: 32  RDTIQIAGSSTVLPFASIVAEEFGNTFPQFKTPVVGSGGSSGGLKQFCQGVGDNTIDIAN 91

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR +  +E+  C K GV+ IQE+ IG+DGI+  S+ +  +  L    ++ A+A+ L  +
Sbjct: 92  SSRPMRSSEVPTCAKAGVNKIQEIKIGYDGIVFASNINKAAYKLKPYHVFTAIAAELPSN 151

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P   HGTREV ++K++  GC     +  ++++ 
Sbjct: 152 GKMVPNPYTHWNQIDKSLPNEPITLVIPGSNHGTREVFQEKMVDAGC---EAYEYIKNLD 208

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           K   ++   ACT+ RQ G  IE+ GDYTETLAR+       G  GLSFY  N D L++  
Sbjct: 209 KDAQKK---ACTTFRQGGRVIEIAGDYTETLARLRTTPSAVGVFGLSFYDQNRDKLRVAT 265

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  TI+SG YP+SRPL FYVK +H NS+ GL +YV F ++       S+L + G
Sbjct: 266 VNNVVPSEATILSGKYPVSRPLYFYVKGEHLNSIKGLPQYVEFFLNKRTSGKGSKLERAG 325

Query: 325 LIPISNEERKSVRDSIAVGK 344
           LIP+S+ ER  +      GK
Sbjct: 326 LIPLSDSERAKILADFKAGK 345


>gi|218513268|ref|ZP_03510108.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli 8C-3]
          Length = 238

 Score =  249 bits (635), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 149/214 (69%), Gaps = 1/214 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE D CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRPINKNEADACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
                Q   AC +VR+DG A+++DGDY ETLARI
Sbjct: 204 SDKAAQ-GKACVAVRKDGAAVDIDGDYPETLARI 236


>gi|83310474|ref|YP_420738.1| ABC-type phosphate transport system [Magnetospirillum magneticum
           AMB-1]
 gi|82945315|dbj|BAE50179.1| ABC-type phosphate transport system [Magnetospirillum magneticum
           AMB-1]
          Length = 341

 Score =  238 bits (607), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 185/311 (59%), Gaps = 7/311 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++IRI GSST++P+S  +AE F +   +FKTP VES G+  G++ FC G+G+   DI 
Sbjct: 24  ARDQIRIVGSSTVYPFSTAVAEAFGKAG-KFKTPVVESTGTGGGMRLFCSGVGESFPDIT 82

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR+I  +E++ C K+GV+ I EV IG+DGI+ ++ +     +LT E +YKA A  + V
Sbjct: 83  NASRRIEPSEVEFCTKNGVTGITEVVIGYDGIVFMNSKAGPDFTLTREQMYKATAKDVPV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
             K+V NP K WS+I P  P+  I +Y P+  HGTR+   + VL   C +     +++DM
Sbjct: 143 GGKLVPNPYKNWSDIDPSLPKEPILVYGPAPNHGTRDAYVELVLDPACAKQ---PELKDM 199

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K   ++   AC +VR+DG  +EV  +YT    +I  N    G +  S+   N D +K  
Sbjct: 200 EKAAKKK---ACQTVREDGAWVEVSENYTVIQQKITSNPAALGVITFSYLDQNRDKVKAA 256

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
           P+DG+V +   I S  YP+SRPL FYVK+QH   V G++EYV+   SD+    +  L   
Sbjct: 257 PVDGVVATYDAIASNKYPVSRPLFFYVKKQHVGMVPGVKEYVTEFTSDKAWGKEGYLADK 316

Query: 324 GLIPISNEERK 334
           GLI   +  RK
Sbjct: 317 GLIASPDAIRK 327


>gi|304394454|ref|ZP_07376375.1| phosphate ABC transporter periplasmic-binding protein [Ahrensia sp.
           R2A130]
 gi|303293364|gb|EFL87743.1| phosphate ABC transporter periplasmic-binding protein [Ahrensia sp.
           R2A130]
          Length = 345

 Score =  235 bits (600), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 182/321 (56%), Gaps = 4/321 (1%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T   AR++I + GSST+FP++  +AE F +    F TP VES GS  GLK FC G G +T
Sbjct: 21  TPAAARDQINVVGSSTVFPFATAVAERFGKGT-SFGTPVVESTGSGGGLKLFCSGTGANT 79

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI N+SR+I  +E++ C  +GV +I EV +G+DGI+L + R    +++ ++D+Y ALA 
Sbjct: 80  PDITNASRRIKASEVELCASNGVKEIVEVKVGYDGIVLANSRATAPLAVDIKDIYNALAK 139

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            + VD K+V NP   W+E+ P  P  +I +  P    GTR+   + V++EGC      + 
Sbjct: 140 EVEVDGKIVANPYTMWNEVNPALPATKIEVLGPPPTSGTRDAFVELVMEEGCDMFPAIAA 199

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           ++D  K    + S  C SVR+DG  +E   +    + ++E N D +G  G SF   NAD 
Sbjct: 200 LKDSDK---DRHSTVCKSVREDGGYVEAGENDNLIIQKLEANADAYGIFGFSFLDQNADK 256

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           ++   I G  P+   I  G YP+SR L FYVK+ H   + G+ E+++   S+  M  D  
Sbjct: 257 VQGATIGGKEPTFENIADGAYPVSRSLFFYVKKAHVGVIPGIEEFLAEFTSEGAMGEDGY 316

Query: 320 LFQYGLIPISNEERKSVRDSI 340
           L   GLIP+  +E   +RD +
Sbjct: 317 LADKGLIPMPEDEMAKIRDDV 337


>gi|46202104|ref|ZP_00053761.2| COG0226: ABC-type phosphate transport system, periplasmic component
           [Magnetospirillum magnetotacticum MS-1]
          Length = 341

 Score =  233 bits (595), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 120/312 (38%), Positives = 182/312 (58%), Gaps = 9/312 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++IRI GSST++P+S  +AE F +   +FKTP VES G+  G++ FC G+G+   DI 
Sbjct: 24  ARDQIRIVGSSTVYPFSTAVAEAFGKTG-KFKTPVVESTGTGGGMRLFCSGVGETFPDIT 82

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR+I  +E++ C K+GV+ I EV IG+DGI+ ++ +     +LT E +YKA A  ++V
Sbjct: 83  NASRRIEPSEVEFCTKNGVTGITEVVIGYDGIVFMNSKAGPDFALTREQMYKATAKDVVV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM-RD 202
             K+V NP K WS+I P  P+  I +Y P+  HGTR+   + VL   C +      M +D
Sbjct: 143 GGKLVPNPYKNWSDIDPSLPKEPILVYGPAPNHGTRDAYVELVLDPACGKQPEIKAMDKD 202

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
             K        AC +VR+DG  +EV  +YT    ++  N    G +  S+   N D +K 
Sbjct: 203 AGKK-------ACRTVREDGAWVEVSENYTVIQQKVTSNPAALGVITFSYLDQNRDKVKA 255

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
            P+DG++ +   I +  YP+SRPL FY+K+QH   + G++EYV+   SD+    +  L  
Sbjct: 256 APVDGVIATYDAIATNKYPVSRPLFFYIKKQHVGMIPGVKEYVAEFTSDKAWGKEGYLAD 315

Query: 323 YGLIPISNEERK 334
            GLI   +  RK
Sbjct: 316 KGLIASPDASRK 327


>gi|84514493|ref|ZP_01001857.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Loktanella vestfoldensis SKA53]
 gi|84511544|gb|EAQ07997.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Loktanella vestfoldensis SKA53]
          Length = 335

 Score =  232 bits (591), Expect = 7e-59,   Method: Compositional matrix adjust.
 Identities = 122/315 (38%), Positives = 179/315 (56%), Gaps = 16/315 (5%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           +R  ++ AGSST+ PY+ I+AE F     +F TP VE GGSS G +  C G+G+ TIDI 
Sbjct: 11  SRANVQAAGSSTVLPYANIVAEAFGAET-DFATPVVEGGGSSTGRRMLCEGVGEGTIDIA 69

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           NSS  +  +E + C   G++ I EV  G+DGI+  SD +  S +      + ALA+   +
Sbjct: 70  NSSSLMKDSERETCIAAGITPI-EVRFGYDGIVFASDINGASFAFEPVHWHIALAAEHFI 128

Query: 144 DDKVVFNPLKKWSEIRP---------DFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
           D  +V N L  W+++           D P+  I  ++P   HGTREV  +KVL +GC + 
Sbjct: 129 DGALVPNTLTNWAQVAEIAQSLGVAGDLPDQEINAFIPGTNHGTREVFNEKVLLDGCEQG 188

Query: 195 RNFSKMRDMFKYNVQQLSV--ACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSF 252
              + M       V + +   AC + R DG +++++GDY +TLA ++      G  GLSF
Sbjct: 189 GFLAAM---LAAGVDEDTAEDACMNTRTDGRSVDIEGDYPQTLANLDSTPTGIGVFGLSF 245

Query: 253 YKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           Y+NN D L++  + G+ PS  TI  G YP+SRPL FYVK++H   + GL E+V F +SDE
Sbjct: 246 YENNTDRLQVATMSGVTPSTETISVGEYPVSRPLQFYVKQEHIGVIPGLLEFVEFFISDE 305

Query: 313 MMAPDSQLFQYGLIP 327
           +  P   L  YGL+P
Sbjct: 306 IAGPGGPLSDYGLVP 320


>gi|71083869|ref|YP_266589.1| phosphate ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062982|gb|AAZ21985.1| phosphate ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
          Length = 338

 Score =  231 bits (590), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 120/316 (37%), Positives = 184/316 (58%), Gaps = 9/316 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++IRI GSST++PY+ ++AENF +   +FKTP +ES G+  G+K FC G+G D  DI 
Sbjct: 22  ARDQIRIVGSSTVYPYATVVAENFGKTG-KFKTPVIESTGTGGGMKLFCAGVGTDHPDIT 80

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I   E   C+K+GV++I E+ +G+DGI L    D    + T E L++ALA+ + V
Sbjct: 81  NASRAIKSKEKALCEKNGVTEIIEIIVGNDGISLAHAVDSPDSNFTKEQLWRALANEVDV 140

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP K+WS+I P  P  +I I +     GTR+     V+ +GC +     + + +
Sbjct: 141 DGKLVANPYKQWSDIDPSLPSKKIEILIAPPTSGTRDAWNSLVMSKGCSK-----EAKAL 195

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           F     + S  CT +R+DG A+E   + T  + ++  N D +GF G S+   N D +K  
Sbjct: 196 FG---DKASSECTKIREDGYAVEAGENDTLIVQKLASNPDAYGFFGYSYLVGNKDKVKAA 252

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+G+ PS+  I    YPI+RPL FYVK+ H   V G+  ++    S + M P   L + 
Sbjct: 253 AIEGVKPSLEGIQDYSYPIARPLFFYVKKAHIGVVPGIDAFIKDFTSKKAMGPRGYLAEI 312

Query: 324 GLIPISNEERKSVRDS 339
           GL+P++  +   VR +
Sbjct: 313 GLVPLAKAKYDVVRTA 328


>gi|262277659|ref|ZP_06055452.1| phosphate ABC transporter [alpha proteobacterium HIMB114]
 gi|262224762|gb|EEY75221.1| phosphate ABC transporter [alpha proteobacterium HIMB114]
          Length = 339

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 118/339 (34%), Positives = 191/339 (56%), Gaps = 11/339 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           ++  F +++ FV +     +   AR++I+I GSST++PY+ ++AE F +   +FKTP +E
Sbjct: 4   LKTLFFLILSFVFV-----SNAIARDQIKIVGSSTVYPYATVVAERFGKS-GKFKTPVIE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G+K FC G+G +  DI N+SR I  +E + C K+GV DI E+ +G+DGI     
Sbjct: 58  STGTGGGMKLFCAGVGTNHPDITNASRAIKSSEKELCSKNGVKDIIEIVVGNDGISFAHS 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                 + T E L++ALA  + VD K+V NP KKWS+I    P   I I VP    GTR+
Sbjct: 118 VKAKDANFTKEHLWRALAHDVDVDGKLVVNPYKKWSDIDKSLPNYGIKILVPPPTSGTRD 177

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
                V+ +GC ++      +  ++   ++   AC  +R+DG AIE   + T  + ++  
Sbjct: 178 AWNSLVMAKGCSKT-----AKAAYEAVGKKAKKACVKLREDGFAIEAGENDTLIVNKLSA 232

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           + ++FG  G S+   N D +K   ++G+VPS+  I +  YPI+RPL FYVK+ H   V G
Sbjct: 233 DPELFGLFGFSYLVANKDKIKAAKVNGVVPSLEGIQNYSYPIARPLFFYVKKAHIGVVPG 292

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           + E++    + +   P   L   GL+P+S ++    R+S
Sbjct: 293 IHEFLKDFTAKKATGPRGYLTDVGLVPLSPDKYNLTRNS 331


>gi|256830444|ref|YP_003159172.1| periplasmic phosphate binding protein [Desulfomicrobium baculatum
           DSM 4028]
 gi|256579620|gb|ACU90756.1| periplasmic phosphate binding protein [Desulfomicrobium baculatum
           DSM 4028]
          Length = 338

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 120/337 (35%), Positives = 191/337 (56%), Gaps = 16/337 (4%)

Query: 5   FVVLMCFVVLEVYCGTG-TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           F+    F +  +  GTG   AR++++I+GSST+FP+S  +AE       +F  P VES G
Sbjct: 4   FLNKAIFALALLLVGTGMAHARDQVKISGSSTVFPFSSYVAEELGAT-TKFAAPVVESTG 62

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K F  G+G  T DI NSSR++  +E +   K+GV+DI E  IG DGI +   +D 
Sbjct: 63  SGGGHKLFGAGMGVGTPDIANSSRRMKDSEFENAAKNGVTDITEAKIGFDGIAVAQSKDN 122

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
             +S+++E+L  A+A+ ++VD K+V NP K W+EI P  P  +I  Y P    GTR+  E
Sbjct: 123 DPMSISLEELATAVAADIMVDGKLVPNPYKMWNEINPQLPARKIVFYGPPTSSGTRDAFE 182

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           + V+++   +   + K                 ++RQD   +    +    + ++  +KD
Sbjct: 183 EMVVEKIFGKKEGYEK--------------GYHAIRQDNAYVPAGENDNLIVQKLAKDKD 228

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
            FG  G SF + NAD ++   I+G+ P+  ++ SG YPISR L FYVK  H++++ GL+E
Sbjct: 229 AFGIFGYSFLEENADSIQGAAINGVTPNPESVASGQYPISRSLFFYVKNAHYDAIPGLKE 288

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           YV   +S++M+  D  L   GLIP+ + ER + R+++
Sbjct: 289 YVELFMSEKMIGKDGLLKSIGLIPLPDAERATARENV 325


>gi|254472022|ref|ZP_05085423.1| phosphate ABC transporter, periplasmic binding protein
           [Pseudovibrio sp. JE062]
 gi|211959224|gb|EEA94423.1| phosphate ABC transporter, periplasmic binding protein
           [Pseudovibrio sp. JE062]
          Length = 339

 Score =  227 bits (578), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 183/316 (57%), Gaps = 10/316 (3%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+I GSST+FP++  +AE F +    FKTP VES GS  G+K FC G+G++T DI 
Sbjct: 25  ARDQIQIVGSSTVFPFATAVAEQFGQKT-NFKTPVVESTGSGGGIKLFCEGVGENTPDIT 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR++   EL +C + GV+ + EVT+G DGI+L + +    + LT++ ++ ALA  + V
Sbjct: 84  NASRRMKAKELVKCNEAGVTPV-EVTVGFDGIVLANSKAGAQLDLTLDQVFLALAKEVPV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           + K+V NP +KWS+I P  P  +I +  P    GTR+   +  +Q GC +    +++   
Sbjct: 143 EGKLVANPYQKWSDIDPSLPNTKIEVLGPPPTSGTRDAFAELAMQGGCKKVAGAAELGLK 202

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K        AC  VR+DG  IE   +    + ++E N +  G  G SF   NAD ++  
Sbjct: 203 KK--------ACHEVREDGAYIEAGENDNLIVQKLEANPNALGIFGFSFLDQNADKMQGA 254

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+G+ P+   I +G YP+SR L FY+K++H   + G+ EY++   +++    +  L   
Sbjct: 255 NINGVAPTFDAIAAGDYPVSRSLFFYIKKEHVGVIPGIAEYLAEFTNEDTWGDEGYLADK 314

Query: 324 GLIPISNEERKSVRDS 339
           GLIP+   +R SV  S
Sbjct: 315 GLIPLPAADRASVSKS 330


>gi|262276142|ref|ZP_06053951.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Grimontia hollisae CIP 101886]
 gi|262219950|gb|EEY71266.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Grimontia hollisae CIP 101886]
          Length = 346

 Score =  226 bits (577), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 115/315 (36%), Positives = 182/315 (57%), Gaps = 5/315 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I I GSST++P++ ++AE F     EF  P +ES GS  GLK FC G+G++T DI N
Sbjct: 27  RDYISIVGSSTVYPFATVVAERFGRT-SEFSVPKIESTGSGGGLKLFCAGVGENTPDITN 85

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI-V 143
           +SRKI  +E+  C K+GV DI E+ IG+DGI   + +    + LT++DL+ ALA  +   
Sbjct: 86  ASRKIKSSEVALCAKNGVKDITEIKIGYDGIAFANSKKSQQLDLTLKDLFTALAKVVPDA 145

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           +  ++ NP   W ++ P  P ++I +  P    GTR+   +  ++ GC   + + +++ M
Sbjct: 146 NGNLIENPNNTWKDVNPSLPAIKIEVLGPPPTSGTRDAFVELAMEGGC---KQYPELKAM 202

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K + ++    C  +R+DG  IE   +    + +++ N + FG  G SF + NAD ++  
Sbjct: 203 KKQDSKKYKAVCHGIREDGAFIEAGENDNLIVQKLDANPNAFGIFGYSFLEQNADKVQGA 262

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I G+VP+   I  G YPISR L FYVK+ H N + GL+ YVS   S++ +  +  L   
Sbjct: 263 KIGGVVPTFDAIGDGSYPISRSLYFYVKKAHANVIPGLQAYVSAFTSEDAIGEEGYLTDR 322

Query: 324 GLIPISNEERKSVRD 338
           GLIP+S  + K VR+
Sbjct: 323 GLIPLSARDWKLVRN 337


>gi|330813175|ref|YP_004357414.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486270|gb|AEA80675.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Candidatus Pelagibacter sp. IMCC9063]
          Length = 337

 Score =  224 bits (572), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 181/316 (57%), Gaps = 9/316 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+I GSST++PY+ ++AE F +   +FKTP VES G+  G+K FC G+G    D+ 
Sbjct: 22  ARDQIQIVGSSTVYPYTTVVAEKFGKS-GKFKTPVVESTGTGGGMKLFCSGVGTQHPDVT 80

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I   E   C K+GV+DI E+ +G+DGI+          + T E L++ALA  + +
Sbjct: 81  NASRAIKSKEKALCAKNGVNDIIEIVVGNDGIVFSHSLKAKDANFTKEQLWRALAHDVDI 140

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           + K+V NP KKWS+I    P   I I VP    GTR+     V+ +GC ++      +D 
Sbjct: 141 NGKIVANPYKKWSDIDKSLPNFGIKIMVPPPTSGTRDAWNSLVMGKGCSKAYKELAGKDA 200

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K         C  +R+DG+AIE   + T  + ++  + ++FG  G S+   N D +K  
Sbjct: 201 KK--------GCPKLREDGLAIEAGENDTLIVNKLAADPELFGLFGYSYLIGNKDKIKAA 252

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+G+ PS+  I    YPI+RPL FYVK+ H   V G++E+++   S + M     L   
Sbjct: 253 SINGVKPSLEGIQDYSYPIARPLFFYVKKAHIGVVPGIKEFLNEFTSKKAMGNLGYLADI 312

Query: 324 GLIPISNEERKSVRDS 339
           GL+P+SN++ K+ R+S
Sbjct: 313 GLVPLSNDKYKTTRNS 328


>gi|144900231|emb|CAM77095.1| ABC-type phosphate transport system [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 343

 Score =  224 bits (570), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 107/311 (34%), Positives = 184/311 (59%), Gaps = 4/311 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++IR+ GSST++P++  +AE F +   +FKTP VES G+  G K FC G+G D  D+ 
Sbjct: 23  ARDQIRVVGSSTVYPFTTAVAEQFGKAG-KFKTPVVESTGTGGGFKLFCAGVGPDHPDLT 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I ++E++ C K+GV+D+ E+ +G+DGI+L + +    + +T + L+ ALA  + V
Sbjct: 82  NASRAIKKSEMESCAKNGVTDVVEMKVGYDGIVLAASKKAKHIDVTRKQLFLALAKEVPV 141

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           + K+V NP   W++I P  P  +I +  P    GTR+   + V++ G   +  F +++++
Sbjct: 142 NGKLVENPYTTWNQIDPSLPASKIEVLGPPPTSGTRDAFLELVMESG---AEAFPEIKEL 198

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K + +      +S+R+DG  +E   +    + +++ N + FG  G SF   N+D L+  
Sbjct: 199 KKTDEKAFKKVFSSIREDGAYVEAGENDNLIVQKLDANANAFGIFGYSFLDQNSDKLQGS 258

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            +DG+ P+   I +G YP+SRPL  Y K+ H   + G++EY++   S++       L   
Sbjct: 259 MVDGVAPTFEAIAAGKYPVSRPLFVYAKKAHVGQIPGIKEYLAEYTSEKAWGKSGYLADK 318

Query: 324 GLIPISNEERK 334
           GLIP+ + ERK
Sbjct: 319 GLIPMPDSERK 329


>gi|260574719|ref|ZP_05842722.1| phosphate ABC transporter, periplasmic binding protein [Rhodobacter
           sp. SW2]
 gi|259023136|gb|EEW26429.1| phosphate ABC transporter, periplasmic binding protein [Rhodobacter
           sp. SW2]
          Length = 352

 Score =  222 bits (565), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 119/322 (36%), Positives = 185/322 (57%), Gaps = 5/322 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++R+ GSST+FPY++  AENF+        P VES G+  G+K FC GIG+   D+ N
Sbjct: 24  RDQVRVVGSSTVFPYAQAAAENFANA-TGMAAPVVESTGTGGGMKIFCEGIGEGFADVTN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV-SVSLTVEDLYKALASYLIV 143
           +SR + ++E + C K+GV+DI EV +G+DG+ L   RD   + +LT + +Y+ALA+ + V
Sbjct: 83  ASRAMKKSEYELCAKNGVTDITEVMLGYDGLTLAVSRDSTYAWALTEKQIYQALAAEVDV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K V NP KKWSEI P  P+V I  Y P    GTR+   +  + +GC +      M++ 
Sbjct: 143 DGKWVANPYKKWSEIDPSLPDVAIIAYGPPPTSGTRDAFVELAMHDGCKQLDYVKAMKET 202

Query: 204 F-KYNVQQ-LSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
             K +  + ++ +C+ +RQDG  +E   +    + RIE +    G  G SF   N D LK
Sbjct: 203 ASKEDYDKFITDSCSRMRQDGPFVEAGENDNLIVQRIEADPTAVGIFGYSFLFENGDKLK 262

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
            +P+DG+ P+  TI    Y ++RPL  Y+K  H   + GL E+V   VSD  M     + 
Sbjct: 263 GIPVDGVEPTAETIADFSYGVARPLFIYIKNAHRGVIPGLNEFVEEFVSDAAMGDGGYMQ 322

Query: 322 QYGLIPISNEERKSVRDSIAVG 343
           + GL P+ + E+ + + ++A G
Sbjct: 323 ERGLTPL-DAEKLAAQQAVATG 343


>gi|307544716|ref|YP_003897195.1| ABC transporter periplasmic protein [Halomonas elongata DSM 2581]
 gi|307216740|emb|CBV42010.1| ABC-type transport system periplasmic substrate-binding protein
           [Halomonas elongata DSM 2581]
          Length = 341

 Score =  221 bits (564), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 119/317 (37%), Positives = 183/317 (57%), Gaps = 15/317 (4%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+++RI GSST++P++  +AE F     E+ TP +ES GS  GL+ FC G+GDDT DI 
Sbjct: 28  ARDQVRIVGSSTVYPFASYVAEEFGATT-EYPTPVIESTGSGGGLRLFCNGVGDDTPDIT 86

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR++  +E + C+++GV+DI E  IG+DGI      +  ++ +T E ++ ALA+ + V
Sbjct: 87  NASRRMKPSEFERCEENGVTDITEAFIGYDGIAFAQSGENDAMPVTREQIFLALAAQVPV 146

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D ++V NP  +WS+I    P+ +IA+Y P    GTR+  E+ V++         +   DM
Sbjct: 147 DGELVDNPYTQWSDIDESLPDRKIAVYGPPTTSGTRDAFEELVME---------AASEDM 197

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
             Y       A T +R DG  I+   +    + R+  NKD FG  G SF + N+D L   
Sbjct: 198 EAY-----GEAYTDIRSDGAYIDAGENDNLIVQRLAENKDAFGIFGYSFLEENSDSLIGS 252

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            IDG+ P+   I SG YP+SR L FYVK QH  +V  + EY +  +S++M+     L   
Sbjct: 253 SIDGVKPTPEAIGSGEYPVSRSLFFYVKNQHAENVPPMYEYANMFMSEQMIGDMGYLKGI 312

Query: 324 GLIPISNEERKSVRDSI 340
           GLIP   + R+  R+++
Sbjct: 313 GLIPAPQDMREEARNAV 329


>gi|221134921|ref|ZP_03561224.1| phosphate binding protein, putative [Glaciecola sp. HTCC2999]
          Length = 345

 Score =  221 bits (562), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 113/341 (33%), Positives = 192/341 (56%), Gaps = 7/341 (2%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
            F+  LM   +  V   +    R+ I + GSST++P+S ++AE F +   +F TP +ES 
Sbjct: 1   MFYRKLMALSLAAVATTSMAAGRDTISVVGSSTVYPFSTVVAERFGKA-TDFATPKIEST 59

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           G+  G+K FC G+G DT D+ N+SR+I  +EL+ CK +GV ++ EV +G+DGI+  +   
Sbjct: 60  GTGGGMKLFCAGVGVDTPDMSNASRRIKASELEMCKANGVDEVVEVLVGYDGIVFSNAIG 119

Query: 123 MVSVSLTVEDLYKALASYLIVDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
             ++S+++++++ ALA  +   D    ++ NP   W+E+ P  P+++I++Y P    GTR
Sbjct: 120 APNISISLQEIFLALAKEIPNPDGSATLIENPYNNWNEVNPSLPDMKISVYGPPPTSGTR 179

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   +  L+ GC   + +S ++ + K +  +    C SVR+DG  IE   +    + ++ 
Sbjct: 180 DAFAELALEGGC---KTYSWIKALKKADKNRYKSICHSVREDGAYIETGENDNLIVQKLT 236

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            N   FG  G SF   N+D L+   + G  P+   I  G YPISRPL FYVK+ H   V 
Sbjct: 237 TNPKAFGIFGFSFLDQNSDTLQGSKVSGAYPTFEDIADGAYPISRPLYFYVKKAHVGKVP 296

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           G+ E++    S++ +  +      GLIP+S E+ + +R S+
Sbjct: 297 GIMEFLEEFTSEDAIGDEGYTTDKGLIPLSYEKLEEMRKSV 337


>gi|83591937|ref|YP_425689.1| phosphate ABC transporter periplasmic binding protein
           [Rhodospirillum rubrum ATCC 11170]
 gi|83574851|gb|ABC21402.1| phosphate ABC transporter, periplasmic binding protein
           [Rhodospirillum rubrum ATCC 11170]
          Length = 342

 Score =  220 bits (560), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 178/309 (57%), Gaps = 4/309 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++IRI GSST++P++  +AENF +    FKTP +ES GS  GLK FC G+G +  DI N
Sbjct: 23  RDQIRIVGSSTVYPFATTVAENFGKT-SSFKTPVIESTGSGGGLKLFCAGVGVEHPDIAN 81

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I ++E++ C K+GV +I EV IG DGI+L + +   + +LT   +++ALA  + VD
Sbjct: 82  ASRRIKKSEVETCAKNGVKEITEVQIGFDGIVLANTKTAPAFNLTKGQIFQALAKEVPVD 141

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K V NP   WS+I    P   I +  P    GTR+   + V++ GC+         D+ 
Sbjct: 142 GKWVANPYSNWSQIDAKLPNEEIEVLGPPPTSGTRDAFVELVMETGCLE---LPACADLK 198

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           K + ++ S    S+R+DG  IE   +    + +++ N    G  G SF   N+D ++   
Sbjct: 199 KADEKKFSSVFASLREDGRFIEAGENDNLIVQKLQSNPTALGIFGFSFLDQNSDKIQGSH 258

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           I+G+ P+   I S  Y +SRPL FYVK  H  +V G++EYV+   S++   P+  L + G
Sbjct: 259 IEGVAPTFEDIASSKYKVSRPLFFYVKNAHVGTVPGIKEYVAEFTSEKAWGPEGYLSEKG 318

Query: 325 LIPISNEER 333
           LIP+ +  R
Sbjct: 319 LIPLPDAVR 327


>gi|209966521|ref|YP_002299436.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Rhodospirillum centenum SW]
 gi|209959987|gb|ACJ00624.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Rhodospirillum centenum SW]
          Length = 346

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 112/317 (35%), Positives = 172/317 (54%), Gaps = 7/317 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR +IRI GSST+FP++  + E F +    F  P +ES G+  G++ FC G+G D  DI 
Sbjct: 26  ARQQIRIVGSSTVFPFTATVVERFGQTT-SFPAPILESTGTGGGMRLFCAGVGADHPDIT 84

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
            +SR +  +E D+C+K+GV ++ E+ IG DGI     +    ++LT   L++ALA  + V
Sbjct: 85  GASRAMKASEFDQCQKNGVEEVTEIMIGFDGIAFAHAKSGPDINLTKAQLWQALAKEVEV 144

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           + ++V NP K+WS++ P  P   I +  P    GTR+   + V+  GC        +   
Sbjct: 145 NGQIVPNPHKRWSDVDPSLPNAPIEVLGPPPTSGTRDAWVELVMDTGCEEYPAVKSLAAA 204

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K  V      C ++R+DG+ IE   +    + R+E NKD +G  G S+ + N D LK  
Sbjct: 205 RKKAV------CQTMREDGVFIEAGENDNLIVQRLEQNKDAYGIFGFSYLEENLDKLKGA 258

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I G+ PS  TI SG YPISRPL  Y+K  H   + GL+E+V+  V +     D  L   
Sbjct: 259 TISGVTPSFETIASGEYPISRPLFIYLKNAHVGVIPGLKEFVTEYVGERAAGEDGYLADK 318

Query: 324 GLIPISNEERKSVRDSI 340
           GL+ +  E    V++++
Sbjct: 319 GLVAMPKERLAKVQETV 335


>gi|258404597|ref|YP_003197339.1| periplasmic phosphate binding protein [Desulfohalobium retbaense
           DSM 5692]
 gi|257796824|gb|ACV67761.1| periplasmic phosphate binding protein [Desulfohalobium retbaense
           DSM 5692]
          Length = 337

 Score =  219 bits (559), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 122/336 (36%), Positives = 188/336 (55%), Gaps = 16/336 (4%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           R  +  L   +VL +  GT + AR++IRI GSST+FP++  +AE F     ++ TP +ES
Sbjct: 3   RVLYCALALAMVLTIGLGTAS-ARDQIRIVGSSTVFPFASYVAEEFGATT-DYPTPVIES 60

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            GS  G+K F +G+G DT DI N+SR+I  +E   C+++GV DI +V IG+DGI +  + 
Sbjct: 61  TGSGGGMKLFSQGVGLDTPDISNASRQIKVSEFKRCQENGVEDIVQVVIGYDGIAIAHNI 120

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           D   ++LT E+L  A+A+ +  D K+V NP   W +I  D P   I +Y P    GTR+ 
Sbjct: 121 DNPELALTREELTLAVAAEVPQDGKLVKNPYTHWDQINGDLPNREILVYGPPTSSGTRDA 180

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
            E+ V++         +   D+  Y  +      T +RQDG+ +    +    + +++ N
Sbjct: 181 FEELVME---------AASEDIDGYGGE-----YTKIRQDGVYVPAGENDNLIVQKLDKN 226

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL 301
            +  G  G SF + N+D ++   IDG+ P    I SG YP+SR L FYVK+ H   V G+
Sbjct: 227 TEALGIFGYSFLEENSDRIQGALIDGVAPKPAAISSGEYPVSRSLFFYVKKAHLGEVDGM 286

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
            EYV   +S++M+     L   GLIP+  EER++ R
Sbjct: 287 EEYVDLFLSEKMIGDMGYLKGIGLIPLPKEEREAQR 322


>gi|254448631|ref|ZP_05062090.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [gamma proteobacterium HTCC5015]
 gi|198261820|gb|EDY86106.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [gamma proteobacterium HTCC5015]
          Length = 346

 Score =  219 bits (557), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 114/320 (35%), Positives = 183/320 (57%), Gaps = 7/320 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ + + GSST++P++ ++AENF    P FKTP +ES GS  G+K FC G+G +T D+ 
Sbjct: 23  ARDLVAVVGSSTVYPFAIVVAENFGRTGP-FKTPKIESTGSGGGMKLFCEGLGVNTPDVT 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR++  +E + C+++GV +I EV IG+DGI+L + R    + L++ D++ ALA  +  
Sbjct: 82  NASRRMKMSEYEMCQENGVKEITEVLIGYDGIVLANARQSQQLDLSLRDIFLALAKDVPN 141

Query: 144 DD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
            D   ++V NP K W+EI  + P+  I +  P    GTR+   +  ++ GC   + F  +
Sbjct: 142 PDGSEELVPNPYKTWNEINKNLPKTEIEVMGPPPTSGTRDAFNELAIEGGC---KTFPWL 198

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
           + +   +  +    C SVR+DG  +E   +    + ++E N D  G  G SF   NAD +
Sbjct: 199 KAIKSEDKNRYKAICRSVREDGAYVEAGENDNLIVQKLEANPDALGVFGFSFLDQNADKV 258

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           +   I G  P+  +I +G YP+SRPL FYVK  H   V G+  YV   VS +    +  L
Sbjct: 259 QGSKIGGQAPTFDSIATGDYPVSRPLYFYVKNAHVGKVPGIEGYVREFVSAKASGQEGYL 318

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + GLIP+S +E + +  S+
Sbjct: 319 TEKGLIPLSPKEHREMEKSV 338


>gi|301063444|ref|ZP_07203976.1| phosphate binding protein [delta proteobacterium NaphS2]
 gi|300442383|gb|EFK06616.1| phosphate binding protein [delta proteobacterium NaphS2]
          Length = 349

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 113/335 (33%), Positives = 185/335 (55%), Gaps = 7/335 (2%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           + ++  +V  V       AR+ + I GSST++P++ ++AE F +   +F TP +ES GS 
Sbjct: 4   ICVLALMVAFVLSAGVAVARDTVAIVGSSTVYPFATVVAEQFGKT-SKFNTPKIESTGSG 62

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            GLK FC G+G +  DI N+SR+I  +E   C+K+GV D+ EV IG+DGI+L + +    
Sbjct: 63  GGLKLFCAGVGVEHPDITNASRRIKVSECVMCEKNGVKDVIEVKIGYDGIVLANSKKTAP 122

Query: 126 VSLTVEDLYKALASYLIVD---DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
             LT  D++ ALA  +      +K+V NP K W ++ P+ P ++I +  P    GTR+  
Sbjct: 123 FKLTQRDIFLALAKDVPDPSGAEKLVLNPNKTWKDVNPELPAIKIEVLGPPPTSGTRDAF 182

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            +  ++ G    ++F  ++ M + + +Q    C ++R+DG  +E   +    + ++  N 
Sbjct: 183 VELGMEPG---GKSFKWIKAMKRKDKKQYKAICHTIREDGAYVEAGENDNLIVQKLNANP 239

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           D  G  G SF   N D ++   ID + P+  +I  G YP+SRPL FYVK+ H   + G +
Sbjct: 240 DALGIFGFSFLDQNTDKIQGSFIDNVPPTFDSIADGSYPLSRPLFFYVKKAHIQVIPGTK 299

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
           EY+    S++   PD  L   G+IP+  EER+  R
Sbjct: 300 EYLEEFTSEKAWGPDGYLADKGMIPMPEEEREYYR 334


>gi|320352743|ref|YP_004194082.1| PhoT family phosphate ABC transporter substrate-binding protein
           [Desulfobulbus propionicus DSM 2032]
 gi|320121245|gb|ADW16791.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Desulfobulbus propionicus DSM 2032]
          Length = 350

 Score =  218 bits (555), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 114/323 (35%), Positives = 180/323 (55%), Gaps = 12/323 (3%)

Query: 19  GTGTFA-----RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCR 73
           GT T A     R+ I I GSST++P++  +AE F +   +FKTP +ES G+  G+K FC 
Sbjct: 16  GTATLAPAADGRDYISIVGSSTVYPFATAVAEQFGKST-KFKTPKIESTGTGGGMKLFCA 74

Query: 74  GIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDL 133
           G G DT DI N+SR++   E+D C+K+GV+++ EV +G+DGI++ + +    + L+ ++L
Sbjct: 75  GAGVDTPDIANASRRMKPAEMDTCRKNGVAEVVEVKVGYDGIVIANSKKAEPMQLSRKEL 134

Query: 134 YKALASYLIV---DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEG 190
           + ALA  +      DK+V NP   W EI  + P+ +I +  P    GTR+   + V+ EG
Sbjct: 135 FLALAKEVPSPEGGDKLVANPYTTWKEINKELPDSKIEVLGPPPTSGTRDAFVELVMDEG 194

Query: 191 CVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGL 250
           C     F  ++ + K + ++    C +VR+DG  +E   +    + ++E N    G  G 
Sbjct: 195 CTA---FDSIKALKKSDEKKFKAVCQTVREDGAYVEAGENDNLIVQKLEANPKSLGIFGF 251

Query: 251 SFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS 310
           SF   NAD ++   +DG  P+   I +G Y +SRPL  YVK+ H   + G+ EY++   S
Sbjct: 252 SFLDQNADKIQGAVVDGEAPTFDNIAAGKYAVSRPLYIYVKKAHVGVIPGMAEYLAEFTS 311

Query: 311 DEMMAPDSQLFQYGLIPISNEER 333
           D     +  L + GLIP   EER
Sbjct: 312 DRAWGEEGYLAEKGLIPAPAEER 334


>gi|288956865|ref|YP_003447206.1| periplasmic binding protein [Azospirillum sp. B510]
 gi|288909173|dbj|BAI70662.1| periplasmic binding protein [Azospirillum sp. B510]
          Length = 349

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 113/314 (35%), Positives = 174/314 (55%), Gaps = 5/314 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           +R++IR  GSST+FP++  +AE F      FKTP VES G+  GLK FC G+G    DI 
Sbjct: 30  SRDQIRAVGSSTVFPFTTAVAEAFGRSG-RFKTPVVESTGTGGGLKLFCGGVGPAHPDIA 88

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR+I ++E+D+C  +GV+ + E+ IG+DGI L S R    VSL+   L+KALA  + V
Sbjct: 89  NASRRIKKSEIDQCAANGVTTVTELKIGYDGIALASSRKAAPVSLSTLVLWKALAKEVPV 148

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           +  +V NP K WS+I P  P   I +  P    GTR+ + + V+ +GC +    +++   
Sbjct: 149 NGALVANPYKLWSDIDPALPRTAIEMLGPPPTSGTRDTVNELVMLQGCGKVAEVARVVP- 207

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC ++R+DG  +E   +    + ++  N D FG  G S+   N D L+  
Sbjct: 208 ---DEAARERACMTIREDGAYVEAGENDNLIVQKLAANPDAFGIFGYSYLDQNRDTLQSA 264

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            +DG+  +  T+ +G Y ++RPL  YVK  H   + G+RE++    S+  M  D  L   
Sbjct: 265 TMDGVELTAETVAAGRYELARPLYIYVKNAHAGVIPGIREFIGEYTSERAMGDDGYLVDK 324

Query: 324 GLIPISNEERKSVR 337
           GLIP     R++ R
Sbjct: 325 GLIPEPKPLREAAR 338


>gi|90023395|ref|YP_529222.1| phosphate binding protein [Saccharophagus degradans 2-40]
 gi|89952995|gb|ABD83010.1| phosphate binding protein, putative [Saccharophagus degradans 2-40]
          Length = 347

 Score =  217 bits (553), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 113/316 (35%), Positives = 181/316 (57%), Gaps = 7/316 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ I I GSST+FP+SK++AE F +   ++++P VES G+  G K FC G+G    D+ 
Sbjct: 23  ARDSISIVGSSTVFPFSKVVAERFGKA-TDYRSPTVESTGTGGGFKAFCGGVGVAFPDMS 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR+I Q+ELD CK++GV ++ EV IG+DGI+L +  +   +SL+ +D++ ALA  +  
Sbjct: 82  NASRRIKQSELDMCKENGVKEVVEVLIGYDGIVLANAIEAKRLSLSAKDIFLALAKKIPN 141

Query: 144 DD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
            D    ++ NP   WS++ P  P+ +I +  P    GTR+   +  ++ GC   + F  +
Sbjct: 142 PDGSATLIDNPYTMWSDVNPSLPKSKIEVLGPPPTSGTRDAFVELAMEGGC---KKFGWI 198

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
            D+ K +  +    C  +R+DG  IE   +    + ++  N +  G  G SF   NAD +
Sbjct: 199 ADLKKSDKNKYKAICHVIREDGHFIEAGENDNLIVQKLASNPNALGIFGFSFLDQNADKV 258

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           +   IDG  P+  TI  G Y +SRPL FYVK+ H   + G+ EY++   S+     +  L
Sbjct: 259 QASKIDGAEPTFETIADGSYAVSRPLYFYVKKAHVGVIQGIEEYLAEFTSERAWGDEGYL 318

Query: 321 FQYGLIPISNEERKSV 336
            + G+IP+S EER  +
Sbjct: 319 TEKGMIPLSAEERAKI 334


>gi|254788386|ref|YP_003075815.1| phosphate binding protein [Teredinibacter turnerae T7901]
 gi|237686635|gb|ACR13899.1| phosphate binding protein [Teredinibacter turnerae T7901]
          Length = 347

 Score =  216 bits (549), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 112/316 (35%), Positives = 180/316 (56%), Gaps = 7/316 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ I I GSST+FP+SK++AE F     +FK+P VES G+  G K+FC G+G +  D+ 
Sbjct: 23  ARDSISIVGSSTVFPFSKVVAERFGRA-TKFKSPTVESTGTGGGFKQFCGGVGVNFPDMS 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR+I Q ELD CK +GV+DI EV IG+DGI++ +      + L+ +DL+ ALA  +  
Sbjct: 82  NASRRIKQAELDNCKANGVTDIVEVLIGYDGIVIANSVKAKQMKLSRKDLFLALAKKVPN 141

Query: 144 ---DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
               D +V NP K W ++ P  P ++I +  P    GTR+   +  ++ GC +   FS +
Sbjct: 142 PSGGDTLVDNPYKTWKDVNPTLPAIKIEVLGPPPTSGTRDAFVELAMEGGCSQ---FSFI 198

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
           +     +  +    C  +R+DG  IE   +    + ++  N +  G  G SF   NAD +
Sbjct: 199 KAYKSSDKNRFKEVCHILREDGAFIEAGENDNLIVQKLNANPNALGIFGFSFLDQNADKV 258

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           +   +DG +P+  TI  G YP+SRPL FYVK+ H   + G+ ++++   S++    +  L
Sbjct: 259 QASYVDGSLPTFDTIADGAYPVSRPLYFYVKKAHIGLIPGIEQFLAEFTSEKAWGDEGYL 318

Query: 321 FQYGLIPISNEERKSV 336
            + GLIP+  + R ++
Sbjct: 319 SEKGLIPLDEDRRATI 334


>gi|146329860|ref|YP_001210064.1| phosphate binding family protein [Dichelobacter nodosus VCS1703A]
 gi|146233330|gb|ABQ14308.1| phosphate binding family protein [Dichelobacter nodosus VCS1703A]
          Length = 335

 Score =  215 bits (548), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 121/339 (35%), Positives = 184/339 (54%), Gaps = 13/339 (3%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L   +V          +R+ I I GSST++P+S ++AE+F +    FKTP +ES G+  
Sbjct: 5   LLAAMIVAATGSVAAQSSRDHISIVGSSTVYPFSTLVAEHFGKT-SNFKTPKIESTGTGG 63

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC G+G +  DI N+SR I  +E+ +CK+ G ++  E  IG+DGI++ S +    +
Sbjct: 64  GFKLFCAGVGPEHADIANASRPIKDSEVKDCKEKG-AEFTEFKIGYDGIVMASSKTAAPM 122

Query: 127 SLTVEDLYKALASYLIVDD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           SLT E +Y ALA  +   D   +V NP KKWS+I    P+ +I +  P    GTR+   +
Sbjct: 123 SLTTEQIYLALAKKVPSKDGKSLVDNPYKKWSDIDKSLPDSKIEVLGPPPTSGTRDAFAE 182

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
             L  GC   +NF  ++ + K   ++ + AC  VR+DG  IE   +    + ++  N   
Sbjct: 183 MALDNGC---KNFEVIKALSK---EEKTAACQGVREDGAYIEAGENDNLIVNKLTANPAA 236

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G  G SF + N D ++ V I G  P+   I SG YP+SRPL  YVK  H   + G++E+
Sbjct: 237 VGIFGYSFLEENTDKVQAVTIAGKQPNFDNIASGEYPLSRPLFIYVKNMHIGVIPGIKEF 296

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEE---RKSVRDSI 340
           V   +S+E    D  L   GLIP+S +E    K+  DS+
Sbjct: 297 VQTFLSEEASGQDGYLKNNGLIPLSGDELAKAKAQADSL 335


>gi|88607657|ref|YP_505607.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Anaplasma phagocytophilum HZ]
 gi|88598720|gb|ABD44190.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Anaplasma phagocytophilum HZ]
          Length = 339

 Score =  215 bits (548), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 118/339 (34%), Positives = 183/339 (53%), Gaps = 14/339 (4%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           +RF F +    + LEV         + IR+ GSS++FP+   IAE F   F  ++TP +E
Sbjct: 4   VRFVFFLACALISLEVRA-------DHIRVVGSSSVFPFISSIAEEFGR-FSSYRTPVIE 55

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS +G   FC G    T D+  SSRKI   EL  C  +GV D+ E+ +G+DGI++ S 
Sbjct: 56  SVGSGMGFNMFCAGANPGTPDVAMSSRKIKDAELALCASNGVHDVIEIGLGYDGIVIASS 115

Query: 121 RDMVSVSLTVEDLYKALASYLIVDD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           R    + L ++DLY AL+ Y + D+  ++  N   KWSEIR D PE  I +Y P    GT
Sbjct: 116 RQKAQIDLRLKDLYSALSKYSLTDEYGQIPMNKYGKWSEIRSDLPEHDIEVYGPHKNAGT 175

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
            ++L   V++  CV ++NF    D + ++V++    C+ +R DG  IEV       + ++
Sbjct: 176 YDILLDYVVRAVCVSAKNFV---DTY-HDVEERKSICSEIRNDGKYIEVATSENVIIQKV 231

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
             N   FG +  SF   N + ++   + G+ P+  TI SG Y +SRP+  YVK++H N+ 
Sbjct: 232 SKNSSAFGILSFSFLIKNQNEVQGNKVAGVEPTYETIASGKYVLSRPMYIYVKKEHLNTT 291

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
            GLRE++   +  E +     L   G IP++ E+ +  R
Sbjct: 292 AGLREFIKEVLRPESIGSGGYLVNLGFIPLTEEKLQETR 330


>gi|332703029|ref|ZP_08423117.1| periplasmic phosphate-binding protein [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553178|gb|EGJ50222.1| periplasmic phosphate-binding protein [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 340

 Score =  215 bits (548), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 116/341 (34%), Positives = 189/341 (55%), Gaps = 17/341 (4%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           +     L+   +L +  G    AR++IRI GSST++P++  + E F     +FKTP +ES
Sbjct: 3   KLLATGLVALSMLAMGAGVAQ-ARDQIRIVGSSTVYPFASYVTEEFGSTT-KFKTPVIES 60

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            GS  G K F  G+GD+T DI N+SR++  +E +  +++GV DI E  IG DGI    ++
Sbjct: 61  TGSGGGFKLFTEGMGDNTPDITNASRRMKGSEFERAQQNGVGDIVEAIIGFDGIAFAQNK 120

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
              +++LT+E+L  A+A+ +  + K+V NP K W++I    P   I +Y P    GTR+ 
Sbjct: 121 SNQAMNLTLEELTLAVAAEVPQNGKLVPNPYKNWNQINSKLPARPIVVYGPPTSSGTRDA 180

Query: 182 LEKKVLQEGCVRSRNFSKMRDMF--KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
            E+ V++    +      ++D +  KY         T +RQDG+ I+   +    + R+ 
Sbjct: 181 FEELVMEHTSTK----GGLKDGYGGKY---------TKIRQDGVYIDAGENDNLIVQRLA 227

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            +K+ FG  G SF + N D ++   I+G+ P    I SG YPISR L FY+K+ H   V 
Sbjct: 228 QDKNAFGIFGYSFLEENQDRIQGASINGVEPKPEAISSGKYPISRSLYFYIKKAHIGKVP 287

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           G++EY    +S++M+ P   L + GLIP+ ++ RK  +  +
Sbjct: 288 GIKEYADLFMSEKMIGPKGLLKRIGLIPLPDDMRKKAQKQV 328


>gi|53804700|ref|YP_113429.1| phosphate binding protein [Methylococcus capsulatus str. Bath]
 gi|53758461|gb|AAU92752.1| putative phosphate binding protein [Methylococcus capsulatus str.
           Bath]
          Length = 351

 Score =  215 bits (547), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 117/320 (36%), Positives = 179/320 (55%), Gaps = 11/320 (3%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I I GSST++P++ ++AE+F +   +FKTP VES G+  G+K FC G G D  DI N
Sbjct: 27  RDTISIVGSSTVYPFATVVAEHFGKGG-KFKTPKVESTGTGGGIKLFCAGEGVDHPDIAN 85

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR++   E  +CKK+GV DI EV IG DGI+L   +    + L+ +D+Y ALA   I D
Sbjct: 86  ASRRMKDTEFQQCKKNGVKDIVEVKIGFDGIVLARSKKSKPMELSRKDIYLALAKQ-IPD 144

Query: 145 ------DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                 D ++ NP K W+E+ P  P  +I +  P    GTR+   +  L+ GC   + F 
Sbjct: 145 PDCGGCDNLIDNPYKTWNEVNPALPATKIEVLGPPPTSGTRDAFAELALEGGC---KEFK 201

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
            +  + K N  +    C +VR+DG  +E   +    + ++  N +  G  G SF + NAD
Sbjct: 202 WIAALKKDNEPEYKKVCHTVREDGAYVEAGENDNLIVQKLVANPNAVGIFGYSFLEENAD 261

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
            +    I+G+ PS  +I  G Y ISRPL FYVK+ H   + G+ EY++   S++    D 
Sbjct: 262 KVAAAKIEGVDPSFESIADGSYSISRPLYFYVKKSHVGMIPGIVEYIAEFTSEKAWGEDG 321

Query: 319 QLFQYGLIPISNEERKSVRD 338
            L + GL+P+  +ERK + +
Sbjct: 322 YLSERGLVPLPADERKEMAE 341


>gi|92113600|ref|YP_573528.1| periplasmic phosphate binding protein [Chromohalobacter salexigens
           DSM 3043]
 gi|91796690|gb|ABE58829.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chromohalobacter salexigens DSM 3043]
          Length = 341

 Score =  215 bits (547), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 115/316 (36%), Positives = 174/316 (55%), Gaps = 14/316 (4%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R ++RI GSST++P++  + E F     ++ TP +ES GS  GL+ FC G+G DT DI N
Sbjct: 28  REQLRIVGSSTVYPFASYVVEEFGATT-DYPTPVIESTGSGGGLRLFCNGVGLDTPDITN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR++  +E + C+++GV+DI E  IG+DGI          V+ T E L+ ALA+ +  D
Sbjct: 87  ASRRMKPSEFERCQENGVTDITEAKIGYDGIAFAESNTNEPVNFTREQLFLALAAKVPQD 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++V NP  KWS+I    P+  I +Y P    GTR+  E+ V++         +   +M 
Sbjct: 147 GELVDNPYTKWSDIDSSLPDREIMVYGPPTTSGTRDAFEELVME---------AASEEMD 197

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
            Y  +      T +RQDG  ++   +    + R++ N   FG  G SF + NAD L    
Sbjct: 198 AYGGE----GYTDIRQDGPYVDAGENDNLIVQRLQENTTAFGIFGYSFLEENADSLTAAS 253

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           IDG+ P    I SG YP+SR L FYVK QH +SV  +  YV   +S++M++P   L   G
Sbjct: 254 IDGVEPEPEAISSGEYPVSRSLFFYVKNQHADSVPAMYPYVDLFMSEQMISPMGYLKGLG 313

Query: 325 LIPISNEERKSVRDSI 340
           LIP+  + R+  R  +
Sbjct: 314 LIPLPEDAREQARSDV 329


>gi|163797109|ref|ZP_02191064.1| phosphate ABC transporter, periplasmic binding protein [alpha
           proteobacterium BAL199]
 gi|159177625|gb|EDP62178.1| phosphate ABC transporter, periplasmic binding protein [alpha
           proteobacterium BAL199]
          Length = 345

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 113/311 (36%), Positives = 177/311 (56%), Gaps = 4/311 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++IRI GSST+FP++ ++AENF +    +KTP +ES GS  GLK FC+G+G +  DI 
Sbjct: 25  ARDQIRIVGSSTVFPFATVVAENFGK-VTSYKTPVIESTGSGGGLKLFCQGVGTEHPDIT 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           NSSR+I ++E++ C  +GV++I E+ +G DGI+L + +      LT E ++ ALA  + V
Sbjct: 84  NSSRRIKKSEIELCATNGVAEITEIKVGFDGIVLANSKKAKHYDLTREQIFLALAKEVPV 143

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP  KWS+I    P+  I +  P    GTR+   + V++     + N + ++D+
Sbjct: 144 DGKLVANPYTKWSQIDKSLPDEPIEVLGPPPTSGTRDAFVELVMEHA---AENIAFLKDL 200

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +  +      S+R+DG  IE   +    + ++E N    G  G SF   NAD ++  
Sbjct: 201 KNSDKNKFKQVYGSMREDGKFIEAGENDNLIVQKLEANPAALGIFGFSFLDQNADKIQGS 260

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++G  P+   I  G YP+SR L FYVK  H   + G++EYV+   S +    +  L   
Sbjct: 261 TVEGNNPTFEKIADGAYPVSRSLYFYVKNAHVGVIPGIQEYVAEFTSTKAAGQEGYLTDK 320

Query: 324 GLIPISNEERK 334
           GLIP+   +RK
Sbjct: 321 GLIPLPEADRK 331


>gi|154250850|ref|YP_001411674.1| phosphate ABC transporter periplasmic-binding protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154154800|gb|ABS62017.1| phosphate ABC transporter, periplasmic binding protein
           [Parvibaculum lavamentivorans DS-1]
          Length = 359

 Score =  214 bits (546), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/316 (37%), Positives = 179/316 (56%), Gaps = 7/316 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I++ GSST+FP+S+  AE F+        P VES G+  G+K FC G+G    D+ 
Sbjct: 39  ARDQIQVVGSSTVFPFSQAAAEQFANETGS-PAPVVESTGTGGGMKIFCGGVGTGHPDVT 97

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
            +SR +  +E + C  +GV+DI EV +G DG+ +   R+   + LT + L++ALA  + V
Sbjct: 98  GASRAMKLSEYELCTSNGVTDITEVLLGFDGLSMAVSRNGQQLDLTKKQLFQALADKVEV 157

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP KKWS+I P  P V I++  P    GTR+   + V++EGC   + F  +  +
Sbjct: 158 DGKLVANPYKKWSDIDPSLPNVAISVMGPPPTSGTRDAWVELVMEEGC---KEFPAIEAL 214

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            K   ++   AC  +R DG  IE   +    + R+E +   +G  G SF   N D L+ V
Sbjct: 215 DKDAHKE---ACQRMRTDGPFIEAGENDNLIVQRLESDPTSYGIFGYSFLYENQDKLQPV 271

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+G+ P+  TI  G Y ISRP+ FYVK  H   + GL E+V+   SDE M     L + 
Sbjct: 272 KIEGVAPNEETIADGSYKISRPIFFYVKNAHRGVIPGLNEFVAEYTSDEAMGTGGYLEER 331

Query: 324 GLIPISNEERKSVRDS 339
           GLIP++++ R  V+ +
Sbjct: 332 GLIPLADDRRAEVQKA 347


>gi|254456439|ref|ZP_05069868.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083441|gb|EDZ60867.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Candidatus Pelagibacter sp. HTCC7211]
          Length = 344

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 120/339 (35%), Positives = 184/339 (54%), Gaps = 4/339 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   ++L  F+VL +   T   AR++I I GSST+FPY+ ++AE F +    FKTP +E
Sbjct: 1   MKKLTIILASFLVLTLSTVTSQ-ARDQITIVGSSTVFPYATVVAERFGK--KGFKTPIIE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G+G+   DI N+SR +   E   C K+G++DI E+ IG+DGI L   
Sbjct: 58  STGTGGGAKLFCAGVGEAHPDITNASRAMKDKEKALCAKNGITDIVEIIIGNDGITLAYS 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            D   V+ T E LY ALA + +VD K+V N  K W+EI    P   I + +P G  GTR+
Sbjct: 118 LDAEPVNFTKEHLYLALAKHTVVDGKLVDNIYKNWNEIDSSLPNKPIKVMIPPGTSGTRD 177

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
                V+++G  +    +  +  +    ++        R+DG+AIEV  + +  + ++  
Sbjct: 178 AWNSLVMKKGMTKEAK-ALYKAGYAAGNKKYKKPQKLYREDGLAIEVGENDSLIIQKLVE 236

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD+FGF G S+Y    D L+   IDG  PS+ +I    Y ++RPL FYVK+ H   + G
Sbjct: 237 DKDMFGFFGFSYYLAAKDKLQAASIDGGQPSLESIQDYSYAVARPLFFYVKKAHVGVIPG 296

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           L E+V        +     L   GL+P+     ++ RD+
Sbjct: 297 LHEFVKEFTKTGTIGKRGYLADIGLVPLDKAMYRTTRDN 335


>gi|114568947|ref|YP_755627.1| phosphate ABC transporter periplasmic binding protein [Maricaulis
           maris MCS10]
 gi|114339409|gb|ABI64689.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Maricaulis maris MCS10]
          Length = 351

 Score =  214 bits (544), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 120/320 (37%), Positives = 179/320 (55%), Gaps = 10/320 (3%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++IRI GSST+FP+S  +AE+F     +  TP VES GS  GL+ FC G+G +  DIVN
Sbjct: 25  RDQIRIVGSSTVFPFSTAVAESFGAKTGQ-PTPVVESTGSGGGLRLFCSGVGTEHPDIVN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILL-VSDRDMVSVSLTVEDLYKALASYLIV 143
           +SR++  +E + C+ +GV +I EV IG DGI++  +DR    V +T++ ++ ALA+ +  
Sbjct: 84  ASRRMRGSEYERCQDNGVREITEVRIGFDGIVIGAADRGAADVDMTLDQVWLALAAEVPA 143

Query: 144 DDKV---VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
           DD     + NP  +WS+I P  P  RI ++ P    GTR+   +  LQ+G        ++
Sbjct: 144 DDSCSSFIPNPNTRWSDIDPSLPRQRIEVFGPPPTSGTRDAFVELALQDGARHIACMDEL 203

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK-DVFGFVGLSFYKNNADV 259
           RD  +   +Q++   + +R+DG  I+  G+    + +  VN    FG  G SF   N+D 
Sbjct: 204 RDADRDRFEQIA---SRIREDGAWIDA-GENDNAIVQTLVNTPTAFGVFGFSFLDQNSDR 259

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           +  V IDG+ P    I  G YP+SR L FYVK QH   + GL  YV    S+E       
Sbjct: 260 ISAVSIDGVAPEFDNIADGSYPVSRSLFFYVKNQHAAIIPGLTGYVEEFTSEESWGEFGY 319

Query: 320 LFQYGLIPISNEERKSVRDS 339
           L   GLIP+ + ER + RD+
Sbjct: 320 LTDRGLIPLPDAERNATRDA 339


>gi|153870082|ref|ZP_01999555.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Beggiatoa sp. PS]
 gi|152073455|gb|EDN70448.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Beggiatoa sp. PS]
          Length = 347

 Score =  213 bits (543), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 114/339 (33%), Positives = 187/339 (55%), Gaps = 11/339 (3%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           +++L       +   +G   R+ I I GSST++P++ ++AE F +   +FKTP +ES G+
Sbjct: 7   YIILAFLTTPSLVLASG---RDVINIVGSSTVYPFATVVAERFGKS-SQFKTPKIESTGT 62

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G+K FC G+  +T DI N+SR++ Q+E D+C+K+GV++I EV +G+DGI+L +     
Sbjct: 63  GGGIKLFCAGVDINTPDITNASRRMKQSEFDQCQKNGVTEIVEVLVGYDGIVLANTIAKP 122

Query: 125 SVSLTVEDLYKALASYLIV----DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            + L+V D++ ALA  +         ++ NP K W ++ P  P  +I I  P    GTR+
Sbjct: 123 QMQLSVRDIFLALAKSVPAFQNGSPTLIANPYKTWRDVNPKLPANKIEILGPPPTSGTRD 182

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              +  L+ GC   + F  ++ + K +  +    C  VR+DG  IE   +    + ++  
Sbjct: 183 AFAELALEGGC---KTFEWIKALKKTDKSRYKAICHEVREDGAYIEAGENDNLIVQKLVA 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N    G  G SF   N+D+++   I+G      +I SG YPISRPL FYVK+ H   V G
Sbjct: 240 NPKAVGVFGFSFLDQNSDMIQGSIINGAEAEFDSIASGAYPISRPLYFYVKKAHIGVVPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           + EY++   S+     +  L   GLIP+ + +R++VR S
Sbjct: 300 IAEYIATFTSEAAYGEEGYLTDKGLIPLDDAKRQAVRQS 338


>gi|288940129|ref|YP_003442369.1| phosphate ABC transporter periplasmic binding protein
           [Allochromatium vinosum DSM 180]
 gi|288895501|gb|ADC61337.1| phosphate ABC transporter periplasmic binding protein
           [Allochromatium vinosum DSM 180]
          Length = 347

 Score =  212 bits (540), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 113/322 (35%), Positives = 179/322 (55%), Gaps = 7/322 (2%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T   AR+ I I GSST+FP+S  +AE F      F TP VES G+  G+K FC G+G D 
Sbjct: 19  TQAMARDTINIVGSSTVFPFSTAVAETFGRTT-SFNTPKVESTGTGGGMKLFCGGVGVDH 77

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI N+SR +  +E + C++ GV +I EV IG+DGI + + +   +  L+++D+Y ALA 
Sbjct: 78  PDITNASRAMKTSEFEACQEAGVKEITEVKIGYDGIAIANSKTSGAWDLSLKDVYLALAK 137

Query: 140 YLIVDDKVVF--NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
             + D K  F  NP K W ++  D PEV+I +  P    GTR+   +  ++ GC    + 
Sbjct: 138 D-VPDGKGGFMANPYKTWKDVNADLPEVKIEVLGPPPTSGTRDAFVELAMEGGC---DSI 193

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
            +++++ K +  +    C  +R+DG  IE   +    + ++  N    G  G SF   NA
Sbjct: 194 PEIKELKKTDKDKHKAVCHGIREDGAYIEAGENDNLIVQKLVANPSALGIFGYSFLDQNA 253

Query: 258 DVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           D ++   IDG+ P+  +I  G YP+SR + FYVK+ H  ++ G+ E+V    SD+   P+
Sbjct: 254 DKVQGAKIDGVDPTYDSISDGSYPVSRSIYFYVKKAHVGTIPGIEEFVKEFTSDKAWGPE 313

Query: 318 SQLFQYGLIPISNEERKSVRDS 339
             L   GLI + ++ER +V ++
Sbjct: 314 GYLADKGLIALPDDERAAVAEA 335


>gi|254480671|ref|ZP_05093918.1| hypothetical protein GPB2148_3762 [marine gamma proteobacterium
           HTCC2148]
 gi|214039254|gb|EEB79914.1| hypothetical protein GPB2148_3762 [marine gamma proteobacterium
           HTCC2148]
          Length = 380

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/349 (34%), Positives = 182/349 (52%), Gaps = 33/349 (9%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
            R+ + I GSST++P++ ++AE F      FK P +ES GS  GLK FC+G+G  T DI 
Sbjct: 25  GRDSVSIVGSSTVYPFATVVAERFGRST-SFKAPKIESTGSGGGLKLFCKGVGAGTPDIT 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI- 142
           NSSR+I ++E D+C+ +GV+D+ EV IG+DGI + + R    ++++++DLY ALA  +  
Sbjct: 84  NSSRRIKKSEYDDCQSNGVTDVIEVLIGYDGIAIANSRRAPQLAISLKDLYLALAKDIPD 143

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGC-------VRSR 195
            D +++ NP + W++I P  P  +I +  P    GTR+   +  L  G          S 
Sbjct: 144 ADGQLIPNPHQSWNDINPALPATKIEVMGPPPTSGTRDAFAELALGGGAKSIPALKTLSG 203

Query: 196 NFSKMRDMFKYNVQQLSVACT------------------------SVRQDGIAIEVDGDY 231
             S      K  ++QL +  +                        SVR+DG  IE   + 
Sbjct: 204 FDSSQEQEIKSAMEQLGIPVSVYQAYVESKGKKPKGKDIFKTVAYSVREDGAYIEAGEND 263

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVK 291
              + ++E N +  G  G SF   N D ++   IDG+ PS  TI  G YP+SRPL FY+K
Sbjct: 264 NLIVQKLEANPNALGIFGFSFLDENGDKVQGSVIDGVEPSFDTIADGDYPVSRPLYFYIK 323

Query: 292 RQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
             H   + G++EY     S + M+ D  L + GLIP+S EE   V+  +
Sbjct: 324 SAHVGRIPGIQEYAMEFASAKAMSEDGYLPEKGLIPLSKEELAQVQADV 372


>gi|58584551|ref|YP_198124.1| ABC-type phosphate transport system, periplasmic component
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418867|gb|AAW70882.1| ABC-type phosphate transport system, periplasmic component
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 338

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/334 (37%), Positives = 191/334 (57%), Gaps = 10/334 (2%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F+++  F VL         AR  +RI GSST+FP+   IAE+F+  F  FKTP VES GS
Sbjct: 5   FLLIFVFTVLIPLSNAD--ARKYVRIVGSSTVFPFISFIAEDFNRIF-SFKTPVVESIGS 61

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K FC GIG++T DI  SSR + + E++ CK++ V+++ EV IG+DGI++ +     
Sbjct: 62  GPGFKMFCSGIGENTPDIATSSRPVKEAEIELCKRNKVNEVVEVIIGYDGIVVANSNQSH 121

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
               T +DL++ L++Y   + K+V N  K WS++    P+  I IY P    GT E L  
Sbjct: 122 KFDFTKKDLFETLSAYSQDNGKLVKNNKKFWSDVNQTLPKTGIEIYGPHQNTGTYETLVN 181

Query: 185 KVL--QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            V+  Q  C+ SR F   ++ +K + ++   AC+++R DG  IEV  +    + +++ NK
Sbjct: 182 FVMTDQYSCMNSRIF---KESYK-DPEERKKACSNIRDDGRYIEVGINENIVIQKLKSNK 237

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           +  G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H N+V GLR
Sbjct: 238 NALGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPLYLYIKKEHLNTVDGLR 297

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSV 336
           E++   V D +      L + GLIP+SNE+ K V
Sbjct: 298 EFIR-EVIDSISTEGGYLSRLGLIPLSNEDIKRV 330


>gi|189345919|ref|YP_001942448.1| periplasmic phosphate binding protein [Chlorobium limicola DSM 245]
 gi|189340066|gb|ACD89469.1| periplasmic phosphate binding protein [Chlorobium limicola DSM 245]
          Length = 342

 Score =  211 bits (536), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 115/343 (33%), Positives = 184/343 (53%), Gaps = 13/343 (3%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           RF+    M      +  G+   AR +IRI GSST+FP++  +AE F +   +F TP +ES
Sbjct: 5   RFWKTAFMACAFAGLATGSAE-AREQIRIVGSSTVFPFASYVAEEFGKT-TKFATPVIES 62

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            GS  G K F  G G  T DI NSSR++ ++E +  +++GV  I E  IG+DGI++ + +
Sbjct: 63  TGSGGGHKLFGEGDGLATPDITNSSRRMKKSEFERAQQNGVKTIHEAVIGYDGIVVANAK 122

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
              ++ L+ +D++ ALA  + V  ++V NP K W++I P  P+ +I +Y P    GTR+ 
Sbjct: 123 AAPALKLSRKDIFMALAEEVPVKGQLVKNPYKMWNQINPALPKQKILVYGPPTSSGTRDA 182

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
            ++ V++    +   +      +K            +RQDG+ +    +    + RI  +
Sbjct: 183 FDEMVMEAASKKMTEYGTAAGKYK-----------KIRQDGVYVPSGENDNLIVQRIVKD 231

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL 301
           ++  G  G SF + NAD +K   +DG+ P    I +G YP+SR L FYVK  H   V GL
Sbjct: 232 RNAVGVFGYSFLEENADRIKGATVDGVAPLPANITTGKYPVSRDLFFYVKGSHLAQVKGL 291

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           +EYV   + ++M+     L + GLIP+   +R +VR S    K
Sbjct: 292 KEYVDLFLGEKMIGDYGYLKKIGLIPLPKAKRDAVRASWTAKK 334


>gi|109899623|ref|YP_662878.1| phosphate binding protein, putative [Pseudoalteromonas atlantica
           T6c]
 gi|109701904|gb|ABG41824.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Pseudoalteromonas atlantica T6c]
          Length = 361

 Score =  210 bits (534), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 115/352 (32%), Positives = 183/352 (51%), Gaps = 20/352 (5%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   + ++C  V  +        R+ I + GSST++ +S ++AE F +  P F TP +E
Sbjct: 1   MKPSTLSIICACVWTLISAPANAMRDYIDVVGSSTVYAFSTVVAERFGKTSP-FHTPKIE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  GLK FC+G+G    DI NSSR+I  +E+D C+++GV ++ E+ IG DGI+L   
Sbjct: 60  STGSGGGLKLFCQGVGMKFPDIANSSRRIKPSEIDLCQRNGVHEVIEILIGFDGIVLAQS 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           +   S+ LT  +LY ALA  +   D     + NP   W +I P  P + I ++ P    G
Sbjct: 120 KLAESIPLTRRELYLALAKSVPNPDGSATTIDNPFITWQDINPRLPNIEIEVFGPPSTSG 179

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA-------------CTSVRQDGIA 224
           TR+   + VL  GC     F+ +  M +   Q  + +             C  +R+DG  
Sbjct: 180 TRDAFSELVLDYGC---HTFAWLAQMSEPQSQAQATSKEARIRKSQQRRLCRMLREDGAY 236

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISR 284
           I+   +    + ++  N +  G +G SF   N D +K   IDG +PS  +I +G YPISR
Sbjct: 237 IDAGENDNLVVQKLNANPNALGLLGFSFLDQNRDRIKSAKIDGFLPSFSSIANGDYPISR 296

Query: 285 PLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSV 336
           PL FYVK+ H   + G+  ++   +SD        L + G+IP++  ER+++
Sbjct: 297 PLYFYVKKAHIGMIPGIEAFIREFISDNASGESGYLPRKGMIPLTKSERQAI 348


>gi|118589311|ref|ZP_01546717.1| phosphate ABC transporter, periplasmic binding protein [Stappia
           aggregata IAM 12614]
 gi|118438011|gb|EAV44646.1| phosphate ABC transporter, periplasmic binding protein [Stappia
           aggregata IAM 12614]
          Length = 330

 Score =  210 bits (534), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 120/335 (35%), Positives = 177/335 (52%), Gaps = 30/335 (8%)

Query: 8   LMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVG 67
           L C V L         AR+R+ I GSST+FP+S  +AE       +F  P VES GS  G
Sbjct: 4   LFCLVSLSAE------ARDRLLIVGSSTVFPFSTAVAEAVGNSGMKF--PIVESTGSGAG 55

Query: 68  LKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS 127
              FC G+G+ T DI N+SR++   EL+ C  +GV+ + EV IG+DGI+L + R     +
Sbjct: 56  FALFCSGVGEHTPDITNASRRMKAPELETCHANGVTPV-EVQIGYDGIVLANSRKGPKFT 114

Query: 128 LTVEDLYKALA--------SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           LTVE +++ALA          L  + ++V NP   WS+I    P+ +I +  P    GTR
Sbjct: 115 LTVEQIFEALAEKLPEKQPGKLPANGQLVDNPNLAWSDIDATLPQEKIEVLGPPPTSGTR 174

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  E+ V++EGC   ++  K               CT +R+DG  +E   +    +  +E
Sbjct: 175 DAFEELVMEEGCKAVKDLEKG-------------GCTRIRRDGSFVEAGENDDLIVGALE 221

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            N    G  G SF   N D ++ V ++G+ P+   I SG YP+SRPL FY+K++H   + 
Sbjct: 222 ANPVTVGIFGYSFLMQNRDKIQSVGVNGVEPTFEKIASGEYPVSRPLFFYIKKEHVGLIP 281

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERK 334
           G+  Y+S   SDE    D  L   GLIP+S E+R+
Sbjct: 282 GMEAYISAFTSDEAWGDDGYLAGKGLIPLSAEKRR 316


>gi|34557337|ref|NP_907152.1| periplasmic phosphate binding protein [Wolinella succinogenes DSM
           1740]
 gi|34483053|emb|CAE10052.1| PERIPLASMIC PHOSPHATE BINDING PROTEIN [Wolinella succinogenes]
          Length = 345

 Score =  210 bits (534), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 115/317 (36%), Positives = 174/317 (54%), Gaps = 12/317 (3%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I++AGSST++P+S  +AE F       KTP VES G+  G K FC G G DT DI 
Sbjct: 23  ARDQIKMAGSSTVYPFSSYVAEEFGATTGN-KTPVVESLGTGGGFKVFCAGDGLDTTDIA 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I ++E D C  +GV+DI  V IG+DGI +   +   +++  +E L+ ALA  + V
Sbjct: 82  NASRPIKKSEFDNCVANGVTDITGVMIGYDGISIAQSKANAAINFKIEHLFLALAEEVPV 141

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+V NP K W+++    P   I +Y P    GTR+  E+ V++ G  +   +   +  
Sbjct: 142 DGKLVKNPYKTWNQVDASLPNRPIVVYGPPTTSGTRDAFEELVMEVGSKKFDAYGDAKGK 201

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           +K            +RQDG  I    +    + ++  +K+  G  G SF + N D +   
Sbjct: 202 YK-----------KIRQDGAYIPAGENDNLIVQKLVQDKNALGIFGYSFLEENPDKVSGA 250

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+GI P+  TI  G YP+SR L FYVK  H   V GL ++V   +SD+M+  +  L   
Sbjct: 251 NINGIAPTAKTIGDGSYPVSRSLYFYVKNSHRAGVKGLDQFVDLFISDKMIGGNGVLKNI 310

Query: 324 GLIPISNEERKSVRDSI 340
           GLIP+  +  K V+D++
Sbjct: 311 GLIPMQPDLLKKVQDTV 327


>gi|315635493|ref|ZP_07890759.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Arcobacter butzleri JV22]
 gi|315480251|gb|EFU70918.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Arcobacter butzleri JV22]
          Length = 344

 Score =  209 bits (533), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 119/324 (36%), Positives = 181/324 (55%), Gaps = 14/324 (4%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+I GSST++P+S  +AE F     +F TP VES G+  G+K FC G+  +T DI 
Sbjct: 15  ARDQIKIVGSSTVYPFSSSVAEEFGAT-TKFPTPVVESTGTGGGMKLFCAGVDLNTPDIA 73

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SRK+   E + CK++GV+DI E  IG DGI +     + S ++T E L  A+A  +  
Sbjct: 74  NASRKMKDKEFETCKENGVTDITEALIGFDGIAIAQSTKVKSFNVTKEQLALAVAEEVPS 133

Query: 144 DD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM- 200
            D   ++ NP KKWS+I    P   I +Y P    GTR+  E+ VLQ        F KM 
Sbjct: 134 KDGKTLIKNPYKKWSDIDASLPNREIIVYGPPKSSGTRDSFEELVLQ------HVFEKMP 187

Query: 201 --RDMFKY--NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
              D+FK   N  +   A + +R DG+ +E   +    + ++  N+   G  G SF   N
Sbjct: 188 VYTDLFKKDENANKKYKAYSVIRTDGVYVESGENDNLIVQKLTKNEAAIGIFGYSFLAEN 247

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            D +  + +D I P++ TI SG YP++R + FY+K QH   V  L+EY +  +S++M+  
Sbjct: 248 KDKVLGITVDNISPTVETIASGKYPVARSMYFYIKNQHSKDVPALKEYTNLFMSEKMIGD 307

Query: 317 DSQLFQYGLIPISNEERKSVRDSI 340
           D  L + GLIP++N+ R   R+ +
Sbjct: 308 DGILSELGLIPLTNDVRSKARNKV 331


>gi|119946060|ref|YP_943740.1| ABC phosphate transporter eriplasmic phosphate-binding protein
           [Psychromonas ingrahamii 37]
 gi|119864664|gb|ABM04141.1| ABC phosphate transporter eriplasmic phosphate-binding protein
           [Psychromonas ingrahamii 37]
          Length = 350

 Score =  209 bits (531), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 110/311 (35%), Positives = 173/311 (55%), Gaps = 7/311 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I + GSST++P+S ++AE F +   +F TP +ES G+  G+K FC G G DT D+ N
Sbjct: 28  RDMISVVGSSTVYPFSTVVAERFGKK-TQFNTPKIESTGTGGGMKLFCAGNGIDTPDMSN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR++ ++E + C ++GV+DI EV IG+DGI++ +      + L+ +DL+ ALA  +   
Sbjct: 87  ASRRMKKSEYEMCVENGVTDITEVLIGYDGIVVANSNAAPQMKLSRKDLFLALAKEVPAL 146

Query: 145 D---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
           D    ++ NP K W ++ P  P  +I +  P    GTR+   + V++ GC   + +  ++
Sbjct: 147 DGSETLIKNPYKTWKDVNPSLPATKIEVLGPPPTSGTRDAFAELVMEGGC---KQYPWIK 203

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
            + K +       C SVR+D   IE   +    + +I+ N D  G  G SF   N D ++
Sbjct: 204 AIKKTDKSAYKTICHSVREDHAYIEAGENDNLIIQKIDANPDAMGIFGFSFLDQNTDKIQ 263

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
              IDG  PS   I  G YP+SRPL FYVK  H + V G+ EY++   S+  M     L 
Sbjct: 264 GSFIDGTAPSFDAIADGSYPVSRPLFFYVKNSHVDKVPGIAEYLAEFTSESAMGQMGYLT 323

Query: 322 QYGLIPISNEE 332
             GLIP+ +E+
Sbjct: 324 DKGLIPLGDEK 334


>gi|332305411|ref|YP_004433262.1| phosphate binding protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172740|gb|AEE21994.1| phosphate binding protein, putative [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 345

 Score =  209 bits (531), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 116/334 (34%), Positives = 182/334 (54%), Gaps = 14/334 (4%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           ++    T  R+ I + GSST+F +S ++AE F +    F+TP +ES GS  GLK FC+G+
Sbjct: 1   MFSAPATAMRDYIDVVGSSTVFAFSTVVAERFGKS-SVFRTPKIESTGSGGGLKLFCQGV 59

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
           G    DI NSSR+I  +ELD C+++GV ++ E+ IG DGI+L   +  V+V LT  +LY 
Sbjct: 60  GMKFPDIANSSRRIKASELDLCQQNGVHEVIEILIGFDGIVLAQSKLGVNVELTRRELYL 119

Query: 136 ALASYLIVDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCV 192
           ALA  +   D     + NP K W +I P  P+++I ++ P    GTR+   + VL  GC 
Sbjct: 120 ALAKRVPNPDGSKTTIENPYKTWHDITPSLPKIKINVFGPPPTSGTRDAFSELVLDYGCH 179

Query: 193 RSRNFSKM---RDMFKYNVQQLSVA-------CTSVRQDGIAIEVDGDYTETLARIEVNK 242
                ++M   +   K +V++           C  +R+DG  I+   +    + ++  N 
Sbjct: 180 TFEWLAQMSQPQGAVKRDVKEKKALLNKQKRLCRMIREDGAYIDAGENDNLIVQKLNANP 239

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           D  G +G SF   N D +K   IDG +PS  +I SG YPISRPL  YVK+ H   + G+ 
Sbjct: 240 DALGLLGFSFLDQNRDRIKSAKIDGFLPSFRSISSGDYPISRPLYMYVKKAHIGMIPGVE 299

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSV 336
            ++   VS++       L + G+IP+   +R+++
Sbjct: 300 AFIREFVSNKASGESGYLLRKGMIPLPKSQRQAI 333


>gi|42520255|ref|NP_966170.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42409993|gb|AAS14104.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 338

 Score =  209 bits (531), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 123/332 (37%), Positives = 188/332 (56%), Gaps = 10/332 (3%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F+++  FV+          AR  IRI GSST+FP+   IAE F+  F  FKTP VES GS
Sbjct: 5   FLLIFVFVLFTPLSNAD--ARKYIRIVGSSTVFPFISFIAEEFNRVFS-FKTPVVESIGS 61

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K FC GIG+DT DI  SSR + + E + CK++ ++++ E+ IG+DG+++ +     
Sbjct: 62  GSGFKMFCSGIGEDTPDITTSSRPMKEVERELCKRNKINEVIEIIIGYDGVVIANSNQSH 121

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
               T +DL++ L++Y   +DK+V N  K WS +    P+  I IY P    GT E L  
Sbjct: 122 RFDFTKKDLFETLSAYSQENDKLVKNNKKFWSNVNQALPKTEIEIYGPHQNTGTYETLVN 181

Query: 185 KVL--QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            ++  Q  C+ SR F   ++ +K + ++   AC ++R DG  IEV  +    + +++ NK
Sbjct: 182 SIMLDQYSCMNSRIF---KENYK-DQEERKKACGNIRDDGRYIEVGINENIIIQKLKSNK 237

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           +  G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+KR+H ++V GLR
Sbjct: 238 NALGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPLYLYIKRKHLDTVDGLR 297

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERK 334
           E+V   + D +   D  L + GLIP+S+E+ K
Sbjct: 298 EFVK-EIIDSIGIEDGYLSRLGLIPLSSEDIK 328


>gi|260430659|ref|ZP_05784631.1| phosphate ABC transporter, periplasmic binding protein
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260418100|gb|EEX11358.1| phosphate ABC transporter, periplasmic binding protein
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 345

 Score =  208 bits (530), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 117/318 (36%), Positives = 179/318 (56%), Gaps = 6/318 (1%)

Query: 29  RIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRK 88
           RI GSST+FPY++ +AE F+       +P VES G+  G+K FC GIG++T DI  +SR 
Sbjct: 28  RIVGSSTVFPYTQAVAEQFANNTGA-PSPIVESTGTGGGMKIFCEGIGENTADITGASRA 86

Query: 89  ITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
           +  +E + C+K+GV+DI E  IG DG+ + VS  +     LT+ ++Y AL + + VD + 
Sbjct: 87  MKASEYELCQKNGVTDISEALIGFDGLSVAVSRANDFDWDLTLGEIYMALGAQVPVDGEW 146

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
             NP K W+EIR D P V I  Y P    GTR+   +  +  GC    +F K      ++
Sbjct: 147 KDNPYKMWNEIREDLPAVEILAYGPPPTSGTRDAFVELAMHAGC-EELDFVKDG---GFD 202

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
              +   C+ +R DG  +E   +    + R+E + +  G  G SF   N D LK V I+G
Sbjct: 203 GDWVEENCSRMRTDGPFVEAGENDNLIVQRLEADPNAVGIFGYSFLYENLDKLKPVKIEG 262

Query: 268 IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIP 327
           + P+  TI    YP+SRPL FYVK  H   +  L E++   +SD+ +A D  L + GL+ 
Sbjct: 263 VEPNADTIADKSYPVSRPLYFYVKNAHRGVIPNLDEFLEEYMSDDALAADGYLAERGLVA 322

Query: 328 ISNEERKSVRDSIAVGKS 345
           +S+E R+ ++D+I  G++
Sbjct: 323 LSDERREELQDAILNGQN 340


>gi|218887651|ref|YP_002436972.1| phosphate ABC transporter periplasmic protein [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|218758605|gb|ACL09504.1| periplasmic phosphate binding protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 344

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 114/317 (35%), Positives = 174/317 (54%), Gaps = 7/317 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+++RI GSST++P+S  +AE F     +FK+P VES GS  G K F  G+G DT DI 
Sbjct: 23  ARDQVRIVGSSTVYPFSSAVAEEFGATNKQFKSPVVESTGSGGGHKLFYAGVGPDTPDIT 82

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           NSSR++   EL+   K+GV+DI E  IG DGI++  +     ++LT++DL  A+   + V
Sbjct: 83  NSSRRMKVEELETNIKNGVTDITEAKIGFDGIVIAQNIGNADMNLTLKDLALAVLEEVPV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K+  NP K W ++ P  P+ +I IY P    GTR+   + V+++       F+   + 
Sbjct: 143 DGKLAPNPYKTWKQLNPALPDRKIVIYGPPATSGTRDAFIEMVVEK-------FTGKDET 195

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           FK  + + +     +RQDG  +    +    + ++  + +  G  G SF   N D +K  
Sbjct: 196 FKAVLGKDAAQYKKIRQDGPYVPAGENDNLIVQKLTKDTEAVGIFGYSFLAENKDRIKGC 255

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++G  P+   I S  YPISR L FYVK  H   + GL+EYV   +S++M+     L   
Sbjct: 256 TVEGNPPTFDNISSAKYPISRALFFYVKDAHIGKIAGLKEYVELFMSEKMIGDAGYLKTI 315

Query: 324 GLIPISNEERKSVRDSI 340
           GLIP+   ER+ VR  +
Sbjct: 316 GLIPLPAAEREKVRKDV 332


>gi|328544897|ref|YP_004305006.1| ABC phosphate transporter periplasmic component-like protein
           [polymorphum gilvum SL003B-26A1]
 gi|326414639|gb|ADZ71702.1| ABC-type phosphate transport system periplasmic component-like
           protein [Polymorphum gilvum SL003B-26A1]
          Length = 346

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/325 (35%), Positives = 183/325 (56%), Gaps = 9/325 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++ GSST+FPY++ +AE ++        P +ES G+  G K FC G+G D  D+  
Sbjct: 26  RDQIKVVGSSTVFPYTQGVAEEYANKTGS-AAPVLESTGTGGGFKVFCGGVGPDHPDMTG 84

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I   E + CK +GV+D+ EV IG+DG+ +        +SLT E ++KALA+ L  D
Sbjct: 85  ASRAIKDGEKELCKTNGVTDVTEVLIGYDGLSIAHSVSGPELSLTNEQIFKALAAEL-PD 143

Query: 145 DKVVF--NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
            K  F  NP K WS+I    P V I ++ P    GTR+   +  + +GC   +    M D
Sbjct: 144 GKGGFVANPNKSWSDIDASLPNVAITVFGPPPTSGTRDAFVELAMHDGC---KGLPGMAD 200

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
           + K + ++ +  C+ +RQDG  IE   +    + R++ + +  G  G SF   N D LK 
Sbjct: 201 LQKADAKKWNEVCSRMRQDGAFIEAGENDNLIVQRLQADANALGIFGYSFLYENQDTLKG 260

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
           V I+G++PS+  I SG Y +SRPL  YVK  H   + GL E+++  VS++ +     L +
Sbjct: 261 VAINGVLPSLEAIGSGDYVLSRPLFNYVKNAHRGVIPGLNEFLAEYVSEDAIGDGGYLSE 320

Query: 323 YGLIPISNEERKSVRDSI--AVGKS 345
            GL+P+  + R+  R+++  AVG S
Sbjct: 321 RGLVPLPADLREKTRETVTNAVGIS 345


>gi|317152748|ref|YP_004120796.1| periplasmic phosphate-binding protein [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316942999|gb|ADU62050.1| periplasmic phosphate binding protein [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 346

 Score =  208 bits (529), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 116/342 (33%), Positives = 184/342 (53%), Gaps = 11/342 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR F  +L+   V+    G    AR++I++ GSST++P+S  +AE       +FK+P VE
Sbjct: 1   MRKFVKLLVAVAVITFGAGM-AHARDQIKVVGSSTVYPFSSYVAEELGAT-SKFKSPVVE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G K F +G G DT DI N+SR++  +E +     GV++I E  IG+DGI +  +
Sbjct: 59  STGSGGGFKLFIQGAGMDTPDITNASRRMKSSEFEAATAAGVTEITEALIGYDGIAIAQN 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++    S+T+++L  A    + V+ K+  NP   W +I P  P+ +I  Y P    GTR+
Sbjct: 119 KENGEFSITMDELALATMEMVPVNGKLEKNPYTTWDQINPALPKRKIIFYGPPTSSGTRD 178

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA--CTSVRQDGIAIEVDGDYTETLARI 238
              + VL        +F K        +         ++VRQDGI +    +    + ++
Sbjct: 179 AFAEMVLG-------HFGKANGALYDAIAPKGKGENYSAVRQDGIYVPAGENDNLIVQKL 231

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
             +KD FG  G SF   N+D +    I+G+ P   TI SG YPISR L FY+K+ H + V
Sbjct: 232 TKDKDAFGIFGYSFLGENSDRIVGAKINGVFPEPETIASGKYPISRSLFFYIKKAHLDKV 291

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            G++EYV   +SD+M+ P   L + GL+P++++ R  V+  +
Sbjct: 292 PGMKEYVELFMSDKMIGPKGLLKRIGLVPLADDMRAKVQKDV 333


>gi|157736356|ref|YP_001489039.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Arcobacter butzleri RM4018]
 gi|157698210|gb|ABV66370.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Arcobacter butzleri RM4018]
          Length = 351

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 118/324 (36%), Positives = 181/324 (55%), Gaps = 14/324 (4%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I+I GSST++P+S  +AE F     +F TP VES G+  G+K FC G+  +T DI 
Sbjct: 22  ARDQIKIVGSSTVYPFSSSVAEEFGAT-TKFPTPVVESTGTGGGMKLFCAGVDLNTPDIA 80

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SRK+   E + CK++GV+DI E  IG DGI +     + S ++T E L  A+A  +  
Sbjct: 81  NASRKMKDKEFETCKENGVTDITEALIGFDGIAIAQSTKVKSFNVTKEQLALAVAEEVPS 140

Query: 144 DD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM- 200
            D   ++ NP KKWS+I    P   I +Y P    GTR+  E+ VLQ        F KM 
Sbjct: 141 KDGKTLIKNPYKKWSDIDASLPNREIIVYGPPKSSGTRDSFEELVLQ------HVFEKMA 194

Query: 201 --RDMFKY--NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
              D+FK   N  +   A + +R DG+ +E   +    + ++  N+   G  G SF   N
Sbjct: 195 VYTDLFKKDENANKKYKAYSVIRTDGVYVESGENDNLIVQKLTKNEAAIGIFGYSFLAEN 254

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            D +  + +D I P++ TI SG YP++R + FY+K QH   V  L+EY +  +S++M+  
Sbjct: 255 KDKVLGITVDNISPTVETIASGKYPVARSMYFYIKNQHSKDVPALKEYTNLFMSEKMIGD 314

Query: 317 DSQLFQYGLIPISNEERKSVRDSI 340
           D  L + GLIP++++ R   R+ +
Sbjct: 315 DGILSELGLIPLTSDVRSKARNKV 338


>gi|291287534|ref|YP_003504350.1| periplasmic phosphate binding protein [Denitrovibrio acetiphilus
           DSM 12809]
 gi|290884694|gb|ADD68394.1| periplasmic phosphate binding protein [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 338

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/333 (34%), Positives = 179/333 (53%), Gaps = 14/333 (4%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F+ L               AR++IRI GSST++P++  +AE F        TP +ES GS
Sbjct: 4   FLTLALVAAFMTMSTVAAHARDQIRIVGSSTVYPFASYVAEEFGATTGN-PTPIIESTGS 62

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K F  G+  +T DI NSSR++  +E D+    GV +I E+ IG+DGI +  ++   
Sbjct: 63  GGGHKLFSAGVDMNTPDITNSSRRMKTSEFDKNMAAGVKNITEIVIGYDGIAIAFNKTNP 122

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
            ++ T +DL  A+A+ + V+ K+V NP KKW+EI P  P   I +Y P    GTR+  E+
Sbjct: 123 DINFTRKDLTLAVAAEVPVNGKLVANPYKKWNEINPALPAKPILVYGPPTSSGTRDAFEE 182

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
            V+++           + M +Y  +        +RQDGI +    +    + ++  +KD 
Sbjct: 183 LVMEKVT---------KKMAEYGNK----GYGKIRQDGIYVPAGENDNLIVQKLSKDKDA 229

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
           FG  G SF + NAD +K   +DG+ P    I SG YP+SR L FYVK  H + V GL ++
Sbjct: 230 FGIFGYSFLEENADRIKGASVDGVDPVPANISSGKYPVSRSLFFYVKLAHLDKVPGLEKF 289

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
           V   +S++M+  +  L   GLIP+ + +R +VR
Sbjct: 290 VDMFLSEQMIGTNGLLKTIGLIPLPDADRDAVR 322


>gi|78188479|ref|YP_378817.1| periplasmic phosphate binding protein [Chlorobium chlorochromatii
           CaD3]
 gi|78170678|gb|ABB27774.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chlorobium chlorochromatii CaD3]
          Length = 342

 Score =  206 bits (525), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 117/336 (34%), Positives = 179/336 (53%), Gaps = 13/336 (3%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           +F+    M    + +  G+   AR +IRI GSST+FP++  +AE F +     +TP +ES
Sbjct: 5   QFWKHATMALAFVGLASGS-LEAREQIRIVGSSTVFPFASYVAEEFGKTTGN-QTPVIES 62

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            GS  G K F       T DI NSSR++ + E D  K++G+  I EV IG+DGI++ + +
Sbjct: 63  TGSGGGHKLFGESDAITTPDITNSSRRMKKAEFDRAKQNGIQAIHEVVIGYDGIVIANAK 122

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
              ++ LT  DL+ ALA  + +  ++V NP  KWS+IR   P  +I +Y P    GTR+ 
Sbjct: 123 KATTLQLTRRDLFFALAEEVPMKGQLVKNPYTKWSQIRKGLPNQKILVYGPPTSSGTRDA 182

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
            ++ V++        +  +   +K            +RQDG+ +    +    + RI  +
Sbjct: 183 FDEMVMEASSKSITEYGALAGKYK-----------KIRQDGVFVPSGENDNLIVQRIVKD 231

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL 301
           K   G  G SF + NAD +K   IDG+ P    I SG YP+SR L FYVK  H   V GL
Sbjct: 232 KAAVGVFGYSFLEENADRIKGATIDGVAPVPANITSGKYPVSRDLYFYVKGSHIAQVKGL 291

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
           +EYV   V ++M+     L + GLIP+  +ER+++R
Sbjct: 292 KEYVDLFVGEKMIGDYGYLKKIGLIPLPKKEREAIR 327


>gi|225630208|ref|YP_002726999.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Wolbachia sp. wRi]
 gi|225592189|gb|ACN95208.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Wolbachia sp. wRi]
          Length = 338

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 122/330 (36%), Positives = 188/330 (56%), Gaps = 8/330 (2%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L+ FV +     +   AR  IRI GSST+FP+   IAE F+  F  FKTP VES GS  
Sbjct: 5   LLLIFVFVLFTPLSNADARKYIRIVGSSTVFPFISFIAEEFNRVFS-FKTPVVESIGSGS 63

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC GIG+DT DI  SSR + + E + CK++ ++++ E+ IG+DGI++ +       
Sbjct: 64  GFKMFCSGIGEDTPDITTSSRPMKEVERELCKRNKINEVIEIIIGYDGIVIANSNQSHRF 123

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
             T +DL++ L++Y   +DK+V N  K WS++    P+  I IY P    GT E L   +
Sbjct: 124 DFTKKDLFETLSAYSQENDKLVKNNKKFWSDVNQALPKTEIEIYGPHQNTGTYETLVNSI 183

Query: 187 L--QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
           +  Q  C+ SR F   ++ +K + ++   AC ++R DG  IEV  +    + +++ NK+ 
Sbjct: 184 MLDQYSCMNSRIF---KENYK-DQEERKQACGNIRDDGRYIEVGINENIIIQKLKSNKNA 239

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H ++V GLRE+
Sbjct: 240 LGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPLYLYIKKEHLDTVDGLREF 299

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERK 334
           V   + D +      L + GLIP+S+E+ K
Sbjct: 300 VK-EIIDSIGIEGGYLSRLGLIPLSSEDIK 328


>gi|189500173|ref|YP_001959643.1| ABC-type phosphate transport system periplasmic component-like
           protein [Chlorobium phaeobacteroides BS1]
 gi|189495614|gb|ACE04162.1| ABC-type phosphate transport system periplasmic component-like
           protein [Chlorobium phaeobacteroides BS1]
          Length = 408

 Score =  206 bits (524), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 104/315 (33%), Positives = 182/315 (57%), Gaps = 8/315 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ I + GSST++P++ ++AE F +   +FKTP +ES GS  G K F  G+G +  DI 
Sbjct: 81  ARDYISVVGSSTVYPFATVVAEQFGKT-SDFKTPKIESTGSGGGFKLFAAGVGVEHPDIT 139

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI- 142
           N+SR+I ++E + C ++GVS++ E+ IG+DGI++ + +      ++ +D++ ALA  +  
Sbjct: 140 NASRRIKKSECEMCAENGVSEVVELKIGYDGIVMANSKKAEPFKVSRKDIFLALAKEVPD 199

Query: 143 ---VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
               D  +V NP   W E+ P+ PEV+I +  P    GTR+   +  ++ G   ++ F+ 
Sbjct: 200 PNGEDGTLVANPYTTWKEVNPELPEVKIEVLGPPPTSGTRDAFVELAMEAG---AKEFAW 256

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           ++ + K +  +      +VR+DG  +E   +    + +++ N D  G  G SF   N D 
Sbjct: 257 IKALKKEDKDKFKQISHTVREDGAYVEAGENDNLIVQKLDANPDALGVFGFSFLDQNKDK 316

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           ++   +DG+ P+   I  G YP+SRPL FYVK+ H  ++ G++EY++   S++    +  
Sbjct: 317 VQGSFVDGVEPAFSAIADGSYPLSRPLYFYVKKAHVGTIPGMQEYLTEFTSEKAWGDEGY 376

Query: 320 LFQYGLIPISNEERK 334
           L + GLIP+  EER+
Sbjct: 377 LTEKGLIPMPKEERE 391


>gi|190571623|ref|YP_001975981.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|190357895|emb|CAQ55355.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
          Length = 338

 Score =  206 bits (523), Expect = 6e-51,   Method: Compositional matrix adjust.
 Identities = 122/322 (37%), Positives = 180/322 (55%), Gaps = 14/322 (4%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR  IRI GSST+FP+   I+E FS  F  FKTP VES GS  G K FC GIG+ T DI 
Sbjct: 22  ARRYIRIVGSSTVFPFISFISEEFSRIFS-FKTPVVESIGSGSGFKMFCSGIGEGTPDIT 80

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
            SSR + + E + CK++ V+++ E+ IG+DGI++ +         T  DL++ L+SY   
Sbjct: 81  TSSRPMKEVERELCKRNKVNEVIEIIIGYDGIVIANSNQSHRFDFTKNDLFETLSSYSED 140

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL--QEGCVRSRNFSKMR 201
           +D++V N  K WS++    P+  I IY P    GT E L   ++  Q  C+ SR      
Sbjct: 141 NDRLVKNNKKFWSDVNQALPKTEIKIYGPHQNTGTHETLINFIMLDQYSCMNSR------ 194

Query: 202 DMFKYNVQ---QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
            +FK N Q   +   AC+++R DG  IEV  +    + +++ NK+  G    SF   N D
Sbjct: 195 -IFKENYQDQEKRKKACSNIRDDGRYIEVGINENIIIQKLKSNKNALGIFSFSFLAKNQD 253

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
            ++   I GI P+   I SG Y ++RPL  Y+K++H ++V GLRE++   V D +     
Sbjct: 254 EIQGSTIAGIEPTYKNISSGEYMLARPLYLYIKKEHLDTVDGLREFIR-EVVDSISTEGG 312

Query: 319 QLFQYGLIPISNEERKSVRDSI 340
            L + GLIP+S+E  K V + +
Sbjct: 313 YLSRLGLIPLSSENIKKVLEKV 334


>gi|149376558|ref|ZP_01894319.1| phosphate ABC transporter periplasmic binding protein [Marinobacter
           algicola DG893]
 gi|149359225|gb|EDM47688.1| phosphate ABC transporter periplasmic binding protein [Marinobacter
           algicola DG893]
          Length = 350

 Score =  205 bits (521), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 115/310 (37%), Positives = 174/310 (56%), Gaps = 10/310 (3%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T   AR+ I I GSST++P++ ++AE F     +F TP +ES GS  GLK FC GIG   
Sbjct: 22  TPAMARDTISIVGSSTVYPFATVVAERFGSST-DFPTPKLESTGSGGGLKLFCAGIGTQH 80

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI N+SR++  +E D C+K+GV DI E  IG DGI++ S +   ++ +T+E L+ AL  
Sbjct: 81  PDITNASRRMKTSEYDLCQKNGVKDITEFRIGSDGIVIASSQKADNLDITLEQLFLALGK 140

Query: 140 YLIVDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
            +   D   K+V NP +KWS+I    P V I +  P    GTR+   +  LQ GC    +
Sbjct: 141 QVPSPDDETKLVANPYEKWSDIDSSLPNVAIRVMGPPPTSGTRDSFNELALQGGC---ED 197

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
              + DM + +++ +   C SVR+DG  IE   +    + ++  +K ++G  G SF + N
Sbjct: 198 LPAVADMSEDDMEGV---CQSVREDGAFIEAGENDNLIVQKLIDDKGLYGVFGYSFLEEN 254

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
           +D L+   ++G+VP+   I +  YP++R L FYVK+ H   V G+ +Y  F VS   M  
Sbjct: 255 SDRLQAATLNGMVPTAEAIAADEYPVARSLFFYVKKAHVGVVPGIADYAEFFVSPSAMGQ 314

Query: 317 DSQLFQYGLI 326
           +  L   GLI
Sbjct: 315 NGYLKDVGLI 324


>gi|88799187|ref|ZP_01114767.1| phosphate binding protein, putative [Reinekea sp. MED297]
 gi|88778170|gb|EAR09365.1| phosphate binding protein, putative [Reinekea sp. MED297]
          Length = 336

 Score =  204 bits (520), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 111/322 (34%), Positives = 179/322 (55%), Gaps = 7/322 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I I GSST++P++ ++AE F        TP +ES GS  GLK FC GIG++T DI N
Sbjct: 16  RDQINIVGSSTVYPFATVVAERFGRATGN-PTPTIESTGSGGGLKLFCDGIGENTPDITN 74

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS  I Q++ D C + G+ DI EV IG+DGI   + R    + ++ +DL+ ALA+++  D
Sbjct: 75  SSSYIKQSQFDACAEKGI-DIIEVKIGYDGIAFANSRQSDKIDVSRKDLFLALAAHVPGD 133

Query: 145 DK--VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
            +  ++ NP + W ++    P  +I +  P    GTR    + V+++GC      S ++D
Sbjct: 134 KEGELIENPYQTWKDVNSSLPATKIRVLGPPPTSGTRAAFVELVMEKGC---SEISWIKD 190

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
           +   +  +    C S+R+DG  +E   +    + +++ +   FG  G SF   N+D L+ 
Sbjct: 191 LKSSDKSKWEEVCGSMREDGAFVEAGENDNLIVQKLDADPSSFGIFGYSFLDQNSDKLQG 250

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
              DG+  S   I  G YP+SRPL F+VK+QH   + G+ EYV+  +S+   + D  L +
Sbjct: 251 ASFDGVDISFDNIADGSYPVSRPLHFFVKKQHIGVIPGIMEYVNTFLSNAAQSEDGYLAE 310

Query: 323 YGLIPISNEERKSVRDSIAVGK 344
            GLIP+S  E + +R  +   K
Sbjct: 311 KGLIPLSGVELQKMRADVNAQK 332


>gi|149184837|ref|ZP_01863155.1| phosphate binding protein, putative [Erythrobacter sp. SD-21]
 gi|148832157|gb|EDL50590.1| phosphate binding protein, putative [Erythrobacter sp. SD-21]
          Length = 349

 Score =  204 bits (519), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 101/306 (33%), Positives = 184/306 (60%), Gaps = 9/306 (2%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
           G  +R++I+  GSST++P++K ++E F+   P+FK+P +ES G+  G+K FC G+G +T 
Sbjct: 27  GGASRDQIKAVGSSTVYPFAKAVSETFTRSNPDFKSPIIESTGTGGGMKLFCAGVGAETP 86

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           DI N+SR++  +E + C+++GV+D+ E+ +G DGI L S +  ++++LT + +Y+A+A+ 
Sbjct: 87  DIANASRRMKASEFETCQQNGVTDVIEIQVGLDGIALASAKGGITMNLTPKMVYEAIAAR 146

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
              +++      +KWS++    P+V I +Y P    GTR+ L++ +L+ GC  +     +
Sbjct: 147 PYGEEQTN----QKWSDVDSSLPDVDILVYGPPSTSGTRDALKELILEVGCDTNAEMKAL 202

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
           +D  +    QL   CT VR DG  ++        + +IE N +  G  G S+ + NAD +
Sbjct: 203 KDSDEDQHAQL---CTEVRSDGAYVDQGEQDNLIVQKIEGNPNAVGIFGYSYLEENADKV 259

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           + + ++G+ P+   I S  YP +RPL  YVK+ H +++ GL+E++    +  M   D +L
Sbjct: 260 QGLNMNGVAPTYENIASFEYPGARPLYVYVKKAHLDAIPGLKEFLGQWTT--MWNRDGEL 317

Query: 321 FQYGLI 326
            + GL+
Sbjct: 318 AKIGLV 323


>gi|194595544|gb|ACF77055.1| putative ABC-type phosphate transporter periplasmic phosphate
           binding protein [Halomonas sp. HAL1]
          Length = 323

 Score =  204 bits (519), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 115/318 (36%), Positives = 172/318 (54%), Gaps = 14/318 (4%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++IRI GSST++P++  + E F        TP +ES GS  GL+ FC G+G+ T DI 
Sbjct: 9   ARDQIRIVGSSTVYPFASYVTEEFGATTGN-PTPVIESTGSGGGLRLFCNGVGEGTPDIT 67

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR++   E + C+++GV+DI E  IG DGI+L        V LT+E ++ A+A+ + V
Sbjct: 68  NASRRMKVAEFERCEENGVTDITEAKIGSDGIVLGQSNTNDVVDLTLEQIFMAVAAQVPV 127

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D ++V NP   WSEI    P+  I+IY P    GTR+  E+ VL+   +         +M
Sbjct: 128 DGELVDNPYTNWSEIDSSLPDREISIYGPPTTSGTRDAFEELVLETASL---------EM 178

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
             Y  +      T +R DG+ I+   +    + R+  +    G  G SF + N D L   
Sbjct: 179 DVYGEE----GYTDIRSDGVYIDAGENDNLIVQRLSEDTGAMGIFGYSFLEENTDSLNGA 234

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+G+ P    I SG YP++R L FYVK QH   V  + +YV   +S+ M+  D  L   
Sbjct: 235 TINGVAPEPEAISSGDYPVARSLWFYVKNQHAEEVPPMADYVDMFMSEMMIGADGYLKDI 294

Query: 324 GLIPISNEERKSVRDSIA 341
           GLI +  EER+  R ++A
Sbjct: 295 GLIVLPEEEREEWRQAVA 312


>gi|254427058|ref|ZP_05040765.1| hypothetical protein ADG881_288 [Alcanivorax sp. DG881]
 gi|196193227|gb|EDX88186.1| hypothetical protein ADG881_288 [Alcanivorax sp. DG881]
          Length = 348

 Score =  204 bits (518), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 108/318 (33%), Positives = 175/318 (55%), Gaps = 8/318 (2%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
             AR+ I I GSST++P++ ++AE F        TP +ES GS  G+K FC+G+G    D
Sbjct: 21  AMARDTISIVGSSTVYPFATVVAERFGRT--GNATPKIESTGSGGGMKLFCQGVGTQHPD 78

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR++ ++E + C+ +GV DI EV +G+DGI++ +      + L++ D++ ALA  +
Sbjct: 79  ITNASRRMKKSEFELCQSNGVKDITEVKVGYDGIVIANSVKGKHIDLSLRDVFLALAKDV 138

Query: 142 IVDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
              D   ++V NP K W E+ P  P  +I +  P    GTR+   +  ++ GC   ++F 
Sbjct: 139 PNPDGSEELVANPYKTWKEVNPALPNTKIEVLGPPPTSGTRDAFNELAIEGGC---KSFP 195

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
            ++ +   +  +    C SVR+DG  +E   +    + ++E N D FG  G SF   N  
Sbjct: 196 WLKAIKGEDKSKYKAICRSVREDGAYVEAGENDNLIVQKLEKNPDAFGVFGYSFLDQNRG 255

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
           V++   + G+ P+   I SG YP+SR L FYVK+ H   V G+  YV    S++      
Sbjct: 256 VVQAANVGGVEPTFEAIGSGDYPVSRSLYFYVKKAHVGVVPGIEGYVKEFTSEKAWGDQG 315

Query: 319 QLFQYGLIPISNEERKSV 336
            L + GLIP+ ++ RKS+
Sbjct: 316 YLGEKGLIPLGDDLRKSM 333


>gi|57238885|ref|YP_180021.1| putative protein sphX precursor [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578814|ref|YP_197026.1| putative protein sphX precursor [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58616873|ref|YP_196072.1| putative protein sphX precursor [Ehrlichia ruminantium str. Gardel]
 gi|57160964|emb|CAH57870.1| putative exported protein [Ehrlichia ruminantium str. Welgevonden]
 gi|58416485|emb|CAI27598.1| Putative protein sphX precursor [Ehrlichia ruminantium str. Gardel]
 gi|58417440|emb|CAI26644.1| Putative protein sphX precursor [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 342

 Score =  203 bits (517), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 109/318 (34%), Positives = 176/318 (55%), Gaps = 8/318 (2%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            I + GSST FP+   IAE F   F ++ TP +ES GS +G   FC+G+ + T DI  SS
Sbjct: 23  HIHVVGSSTAFPFIAAIAEEFGR-FSDYGTPIIESVGSGMGFSMFCQGVENSTPDIAMSS 81

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD- 145
           RKI   E++ CK + V DI E+ IG+DGI++ +  +   +  T +DL+KAL+ Y   ++ 
Sbjct: 82  RKIKDAEVELCKSNDVHDIIEIIIGYDGIVIANSNNSNKLDFTKKDLFKALSKYATSEEY 141

Query: 146 --KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
              +  N  K WSEI   FP + I +Y P    GT  +L ++++Q+ C+  +NF ++   
Sbjct: 142 THSIPANDFKYWSEINNRFPNIDIEVYGPYKNTGTYNILIEEIMQDSCMNHKNFIEVYP- 200

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              ++++   AC+ +R DG  IEV  +    + +I  N   FG    SF   N D +   
Sbjct: 201 ---DLKKRQHACSMIRNDGKYIEVAANENIIIQKIAKNNAAFGIFSFSFLIQNQDKIHGN 257

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I G+ P+  TI SG Y +SRP+  Y+K++H N+  GL+E++   +  E +  +  L   
Sbjct: 258 KIAGVEPTYETISSGKYILSRPIYVYIKQKHLNNSPGLKEFIKVILKQESIGKNGYLISL 317

Query: 324 GLIPISNEERKSVRDSIA 341
           G IP+S+++ ++ R  I 
Sbjct: 318 GFIPLSDKDLENTRTRIT 335


>gi|110835546|ref|YP_694405.1| phosphate ABC transporter periplasmic binding protein [Alcanivorax
           borkumensis SK2]
 gi|110648657|emb|CAL18133.1| phosphate ABC transporter periplasmic binding protein [Alcanivorax
           borkumensis SK2]
          Length = 348

 Score =  202 bits (515), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 107/318 (33%), Positives = 177/318 (55%), Gaps = 8/318 (2%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
             AR+ I I GSST++P++ ++AE F        TP +ES GS  G+K FC+G+G    D
Sbjct: 21  AMARDTISIVGSSTVYPFATVVAERFGRT--GNATPKIESTGSGGGMKLFCQGVGTQHPD 78

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR++ ++E + C+ +GV DI EV +G+DGI++ +      + L++ +++ ALA  +
Sbjct: 79  ITNASRRMKKSEFELCQSNGVKDITEVKVGYDGIVIANSVKGKHIDLSLREVFLALAKDV 138

Query: 142 I---VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                 +++V NP K W EI P  P V+I +  P    GTR+   +  ++ GC   + F 
Sbjct: 139 PNPKGGEELVANPYKTWKEINPALPNVKIEVLGPPPTSGTRDAFNELAIEGGC---KTFP 195

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
            ++ +   +  +    C SVR+DG+ +E   +    + ++E N + FG  G SF   N  
Sbjct: 196 WLKAIKGEDKSKYKAICRSVREDGVYVEAGENDNLIVQKLEKNPNAFGVFGYSFLDQNRG 255

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
           V++   + G+ P+   I SG YP+SR L FYVK+ H   V G+  YV    S++      
Sbjct: 256 VVQAANVGGVEPTFEAIGSGEYPVSRSLYFYVKKAHVGVVPGIEGYVKEFTSEKAWGDQG 315

Query: 319 QLFQYGLIPISNEERKSV 336
            L + GLIP++++ RKS+
Sbjct: 316 YLSEKGLIPLADDLRKSM 333


>gi|117924842|ref|YP_865459.1| phosphate binding protein [Magnetococcus sp. MC-1]
 gi|117608598|gb|ABK44053.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Magnetococcus sp. MC-1]
          Length = 344

 Score =  202 bits (515), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 112/312 (35%), Positives = 177/312 (56%), Gaps = 5/312 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++IRI GSST+FP++  +AE F      FKTP +ES GS  GLK FC G+G D  DI 
Sbjct: 22  ARDQIRIVGSSTVFPFATTVAEQFGRST-SFKTPVIESTGSGGGLKLFCAGLGFDHPDIT 80

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI- 142
           N+SR+I ++E++ C K+ + +I EV +G+DGI+L + +    +SL++ D++ A A  +  
Sbjct: 81  NASRRIKKSEVELCAKNDIKEIVEVKVGYDGIVLANSKSAPLMSLSLRDIFMATAKMVPD 140

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
            +  ++ NP   W ++ P  P+  I I+ P    GTR+   +  ++ GC   + F  ++D
Sbjct: 141 ANGNLIANPNMTWDQVNPKLPKTPIIIFGPPPTSGTRDAFAELAMEGGC---KTFPAIKD 197

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
           M K + ++    C  VR+DG  +E   +    + ++  N    G  G SF + NAD ++ 
Sbjct: 198 MKKTDKKKYKALCHGVREDGAYVEAGENDNLIVQKLVANPISMGIFGYSFLEQNADKVQG 257

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
             +    P+   I SG YP+SR L FYVK++H   V G++EY++   SD+    D  L  
Sbjct: 258 SLVMETTPTFENIASGKYPVSRSLYFYVKKKHVGLVPGIKEYLAEFSSDKAWGDDGYLAD 317

Query: 323 YGLIPISNEERK 334
            GLIP+   ERK
Sbjct: 318 KGLIPMPAAERK 329


>gi|222474892|ref|YP_002563307.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. Florida]
 gi|255002864|ref|ZP_05277828.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. Puerto Rico]
 gi|255003995|ref|ZP_05278796.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. Virginia]
 gi|222419028|gb|ACM49051.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. Florida]
          Length = 338

 Score =  202 bits (513), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 114/334 (34%), Positives = 178/334 (53%), Gaps = 12/334 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M  + +  + FV L +  G      ++IR+ GSST+FP+   +AE F   F  ++TP +E
Sbjct: 1   MGLWGLSFVAFVALALGAGA-----DQIRVVGSSTVFPFISSVAEEFGR-FSAYRTPVIE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS +G   FC G   DT DI  SSR+I   E++ C  +GV D+ E+ +G+DGI++ S 
Sbjct: 55  SVGSGMGFNMFCAGSSSDTPDIAMSSRRIKDAEVELCGMNGVKDMIEIGLGYDGIVVAST 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           +    V  ++ DL+ AL+ Y + D+  KV  N    WSE+RP  PE  I IY P    GT
Sbjct: 115 KQKEEVDFSLVDLFGALSKYSLSDEYGKVPLNKHSMWSEVRPGLPEHEIEIYGPHKNTGT 174

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
            ++L    +   C+ ++NF    D +  + ++    C+S+R DG  IEV       + +I
Sbjct: 175 YDILVDTAISGVCMSAKNFV---DSYP-DWEERKRVCSSIRNDGKYIEVATSENVVIHKI 230

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
             N + FG +  SF   N   ++   + G+ PS  TI SG Y +SRP+  YVK++H ++ 
Sbjct: 231 SKNSNAFGILSFSFLVKNQGEIQGNKVAGVAPSYDTISSGKYVLSRPIYIYVKKEHLDTT 290

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEE 332
            GLRE+V   +  E +     L   G +P+  E+
Sbjct: 291 PGLREFVKEVMRPESIGSSGYLVNLGFVPLQKEQ 324


>gi|311696280|gb|ADP99153.1| phosphate ABC transporter periplasmic binding protein [marine
           bacterium HP15]
          Length = 347

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/305 (34%), Positives = 171/305 (56%), Gaps = 7/305 (2%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
             AR+ I I GSST++P++ ++AE F     +F TP +ES GS  GLK FC+GIG    D
Sbjct: 24  AMARDTISIVGSSTVYPFATVVAERFGTKT-DFSTPKLESTGSGGGLKLFCQGIGTQHPD 82

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR++  +EL+ C+ +GV+DI E  IG DGI++ S ++  ++ +T+E L+ AL S +
Sbjct: 83  ITNASRRMKTSELELCQSNGVTDITEFRIGSDGIVIASSKEAENLDITLEQLFLALGSKV 142

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
            V+ + V NP K WS++    P   I +  P    GTR+   +  L  GC       ++ 
Sbjct: 143 PVNGEWVANPNKNWSDVDSSLPNKPIRVMGPPPTSGTRDSFNELALAAGC------DQLP 196

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
           +       + +  C SVR+DG  IE   +    + ++  +  ++G  G SF + NAD L+
Sbjct: 197 EAANLGKDEHASICESVREDGAFIEAGENDNLIVQKLIGDTGMYGVFGYSFLEENADRLQ 256

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
              ++G++P+   I +  YP++R L FYVK+ H   V G++EY+   +S+  M  +  L 
Sbjct: 257 AATLNGMIPTAEAIAADEYPVARSLFFYVKKAHVGVVPGIQEYIGEFISNAAMGQNGYLK 316

Query: 322 QYGLI 326
             GLI
Sbjct: 317 DVGLI 321


>gi|94495743|ref|ZP_01302323.1| phosphate binding protein, putative [Sphingomonas sp. SKA58]
 gi|94425131|gb|EAT10152.1| phosphate binding protein, putative [Sphingomonas sp. SKA58]
          Length = 354

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 102/316 (32%), Positives = 179/316 (56%), Gaps = 8/316 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++IR  GSST++P++   AE F +  P  K+P +ES G+  G+K FC G+G    DI +
Sbjct: 35  RDQIRAVGSSTVYPFATAAAELFVQSNPGVKSPIIESTGTGGGMKLFCAGVGAQHPDIED 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR++ ++E D+C+ +GV DI EV IG DG+     ++   +SLT + +Y+ALA+     
Sbjct: 95  ASRRMKKSEFDQCQANGVKDIIEVQIGVDGLAFAESKEGPGLSLTPKIVYEALAANPYGK 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
           D    N  + W ++    P + I+++ P    GTR+ L + +L++GC      + +++  
Sbjct: 155 DA---NKAQTWKDVDASLPAIPISVFGPPSTSGTRDSLAELILEKGCQSDPAMAALKEK- 210

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             N  +    CT +R+DG  ++   +    + ++  N +  G  G SF + N + LK VP
Sbjct: 211 --NEDEYKATCTRIREDGKYVDSGENDNLIVQKLGANPNAVGVFGFSFLEENKNTLKDVP 268

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           I+GI  +  T+ +G YP +RPL  YVK+ H  +V GL+ Y++   S+    P   L + G
Sbjct: 269 INGIPATYDTVSTGQYPGARPLYIYVKKAHMQAVPGLQAYLNIFASN--WGPGGVLAKRG 326

Query: 325 LIPISNEERKSVRDSI 340
           ++P S++ RK+  +++
Sbjct: 327 MVPASDDVRKANAETV 342


>gi|90415567|ref|ZP_01223501.1| phosphate ABC transporter, periplasmic binding protein-like [marine
           gamma proteobacterium HTCC2207]
 gi|90332890|gb|EAS48060.1| phosphate ABC transporter, periplasmic binding protein-like [marine
           gamma proteobacterium HTCC2207]
          Length = 352

 Score =  200 bits (509), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 103/317 (32%), Positives = 182/317 (57%), Gaps = 6/317 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I + GSST++P+S ++AE +     +  TP +ES GS  G+K FC G+G +  DI N
Sbjct: 26  RDSIEVVGSSTVYPFSTVVAERYGRSSGK-PTPKIESTGSGGGMKLFCSGVGTNYPDITN 84

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL--I 142
           SSR++  +E  +C+ +GV D+ EV IG+DGI++ +   +  + LT +D++ ALA+ +   
Sbjct: 85  SSRRMKASEFKKCQTNGVKDVIEVHIGYDGIVIANSIKVAPMKLTRKDIFLALAAKVPGA 144

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           VD +++ NP K W ++ P  P   I +  P    GTR+   +  L+ GC +    + ++ 
Sbjct: 145 VDGELIENPYKTWKDVNPALPATAIEVMGPPPTSGTRDAFAELGLEGGCKKIDWINALKK 204

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
             K+  +++   C ++R+DG+ IE   +    + ++E N    G  G SF   NAD ++ 
Sbjct: 205 TDKHAFKEV---CHTIREDGVYIEAGENDNLIVQKLEANPAALGVFGFSFLDQNADKVQG 261

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
             I+ + P+  +I    YPISRPL FYVK+ H   V G++ Y++   S++    +  L +
Sbjct: 262 SLIESVEPTFESIADKSYPISRPLYFYVKKAHVGVVPGIQGYLNEFTSEKAWGEEGYLAE 321

Query: 323 YGLIPISNEERKSVRDS 339
            G+IP+  +ER+++ ++
Sbjct: 322 KGMIPLPIKERRAMAEN 338


>gi|269959061|ref|YP_003328850.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma centrale str. Israel]
 gi|269848892|gb|ACZ49536.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma centrale str. Israel]
          Length = 341

 Score =  200 bits (508), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 111/309 (35%), Positives = 170/309 (55%), Gaps = 7/309 (2%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
           ++IR+ GSST+FP+   +AE F   F  ++TP +ES GS +G   FC G G  T DI  S
Sbjct: 24  DQIRVVGSSTVFPFISSVAEEFGR-FSAYRTPVIESVGSGMGFNMFCAGSGRGTPDIAMS 82

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR+I   E++ C  +GV D+ EV +G+DGI++ S +    V  ++ DL+ AL+ Y + D+
Sbjct: 83  SRRIKDAEVELCGNNGVRDMIEVGLGYDGIVVASAKQKERVDFSLVDLFGALSKYSLSDE 142

Query: 146 --KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
             KV  N    WSE+RP  PE  I IY P    GT ++L    +   C+ ++NF    D 
Sbjct: 143 YGKVPMNKYSMWSEVRPSLPEHEIEIYGPHKNTGTYDILVDTAISGVCMSAKNFV---DS 199

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           +  N+++    C+S+R DG  IEV       + +I  N + FG +  SF   N   ++  
Sbjct: 200 YP-NLEERKKVCSSIRNDGKYIEVATSENVVIHKISKNSNAFGILSFSFLVKNQGEIQGN 258

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I G+ PS  TI SG Y +SRP+  YVK++H ++  GL+E+V   +  E +     L   
Sbjct: 259 RIAGVEPSYDTISSGKYVLSRPIYIYVKKEHLDTTPGLKEFVKEVMRPESIGSSGYLVNL 318

Query: 324 GLIPISNEE 332
           G +P+  E+
Sbjct: 319 GFVPLQKEQ 327


>gi|85375200|ref|YP_459262.1| phosphate binding protein, putative [Erythrobacter litoralis
           HTCC2594]
 gi|84788283|gb|ABC64465.1| phosphate binding protein, putative [Erythrobacter litoralis
           HTCC2594]
          Length = 350

 Score =  198 bits (504), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 178/321 (55%), Gaps = 21/321 (6%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
           G+ +  R+ IR  GSST++P++K++AENF+   PEF +P +ES G+  G+  FC G+G  
Sbjct: 24  GSSSGTRDSIRAVGSSTVYPFAKLVAENFARNHPEFGSPLIESTGTGGGVALFCSGVGPS 83

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
           T D+ N+SR++  +E D C+++GV+DI E+ +G DGI   S +  + ++LT + +Y+A+A
Sbjct: 84  TPDMANASRRMKDSEFDTCQENGVTDIIELQVGLDGIAFASAQGGIDMNLTPDIVYRAIA 143

Query: 139 SYLIVDDKVVFNPLKK------WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCV 192
           +          NP  K      WS++ P  P++ I +Y P    GTR+ L++ VL+  C 
Sbjct: 144 A----------NPYGKEQTNETWSDVDPSLPDLPILVYGPPSTSGTRDALKELVLEAAC- 192

Query: 193 RSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSF 252
             +  ++M  + + +       CT VR DG  ++        + +I+ N +  G  G S+
Sbjct: 193 --KENAEMEALKESDEDAYDRTCTEVRSDGKYVDQGEQDNLIVQKIQGNPNAVGIFGYSY 250

Query: 253 YKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
            + NAD ++ + ++G+ P+   I S  YP +RPL  YVK+ H +++ GL EY+    +  
Sbjct: 251 LEENADKVQGLSMNGVEPTYENIASFAYPGARPLYVYVKKAHVDAIPGLAEYLEQWTT-- 308

Query: 313 MMAPDSQLFQYGLIPISNEER 333
           M      L   GL+    +ER
Sbjct: 309 MWDKGGPLASIGLVATPEDER 329


>gi|56416524|ref|YP_153598.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. St. Maries]
 gi|56387756|gb|AAV86343.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. St. Maries]
          Length = 338

 Score =  197 bits (500), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/334 (33%), Positives = 177/334 (52%), Gaps = 12/334 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M  + +  + FV L +  G      ++IR+ GSST+FP+   +AE F   F  ++TP +E
Sbjct: 1   MGLWGLSFVAFVALALGAGA-----DQIRVVGSSTVFPFISSVAEEFGR-FSAYRTPVIE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS +G   FC G   DT DI  SSR+I   E++ C  +GV D+ E+ +G+DGI++ S 
Sbjct: 55  SVGSGMGFNMFCAGSSSDTPDIAMSSRRIKDAEVELCGMNGVKDMIEIGLGYDGIVVAST 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           +    V  ++ DL+ AL+ Y + D+  KV  N    WSE+RP  PE  I IY P    GT
Sbjct: 115 KQKEEVDFSLVDLFGALSKYSLSDEYGKVPLNKHSMWSEVRPGLPEHEIEIYGPHKNTGT 174

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
            ++L    +   C+ ++NF    D +  + ++    C+S+R DG  IEV       + +I
Sbjct: 175 YDILVDTAISGVCMSAKNFV---DSYP-DWEERKRVCSSIRNDGKYIEVATSENVVIHKI 230

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
             N + FG +  SF   N   ++   + G+ PS  TI SG + +SRP+  YVK++  ++ 
Sbjct: 231 SKNSNAFGILSFSFLVKNQGEIQGNKVAGVAPSYDTISSGKHVLSRPIYIYVKKERLDTT 290

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEE 332
            GLRE+V   +  E +     L   G +P+  E+
Sbjct: 291 PGLREFVKEVMRPESIGSSGYLVNLGFVPLQKEQ 324


>gi|51245733|ref|YP_065617.1| phosphate ABC transporter periplasmic-binding protein [Desulfotalea
           psychrophila LSv54]
 gi|50876770|emb|CAG36610.1| related to phosphate ABC transporter, periplasmic binding protein
           [Desulfotalea psychrophila LSv54]
          Length = 346

 Score =  197 bits (500), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 102/321 (31%), Positives = 180/321 (56%), Gaps = 11/321 (3%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I + GSST++P++ ++AE F +    F TP +ES GS  G K FC G+G +  DI N
Sbjct: 24  RDYISVVGSSTVYPFATVVAEQFGKTT-NFATPKIESTGSGGGFKLFCSGLGVNYPDITN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I  +E ++C+ +GV DI EV IG+DGI+L + ++   + L+ ++++ ALA  + V 
Sbjct: 83  ASRAIKSSEFNQCQANGVGDIVEVKIGYDGIVLANSKERAPLKLSRKEIFMALA--MQVP 140

Query: 145 D-----KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
           D     K++ NP K W ++ P  P  +I +  P    GTR+   +  ++ G   ++ F  
Sbjct: 141 DPQDPTKMIANPYKTWRDVNPQLPATQIEVLGPPPTSGTRDAFVELAMESG---AKQFDS 197

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           ++ + K + +     C ++R+DG  IE   +    + +++ N    G  G SF + NAD+
Sbjct: 198 IKALKKADKKAYKKICHTIREDGAYIEAGENDNLIVQKLQANPAAVGIFGFSFLEQNADL 257

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           ++   I+G+ P+   I  G YP+SRPL FYVK+ H + + G++ +++   S++    +  
Sbjct: 258 VQGSFIEGMEPTFEAIADGSYPVSRPLFFYVKKAHVDVIPGMKGFLAEFTSEKAWGDEGY 317

Query: 320 LFQYGLIPISNEERKSVRDSI 340
           L   G+IP+   ER     ++
Sbjct: 318 LADKGMIPMPEAERAEYAQAV 338


>gi|126664593|ref|ZP_01735577.1| phosphate binding protein, putative [Marinobacter sp. ELB17]
 gi|126630919|gb|EBA01533.1| phosphate binding protein, putative [Marinobacter sp. ELB17]
          Length = 352

 Score =  196 bits (498), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 104/321 (32%), Positives = 172/321 (53%), Gaps = 7/321 (2%)

Query: 23  FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
            AR+ I I GSST++P++ ++AE F     +F TP +ES GS  GLK FC+G+G    DI
Sbjct: 25  MARDTISIVGSSTVYPFATVVAERFGRNT-DFATPKIESTGSGGGLKLFCQGVGTQHPDI 83

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI 142
            N+SR++ ++E D C+ +GV +I EV IG DGI++ + ++   + L+++ ++ ALA  + 
Sbjct: 84  TNASRRMKKSEFDMCQANGVKEITEVRIGADGIVMANSKEAEKLDLSLKQIFLALAKDVP 143

Query: 143 VDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
             D   ++V NP   WSEI    P + I++  P    GTR+   +  ++ GC   + F  
Sbjct: 144 NPDGSNELVANPYMNWSEIDASLPNIAISVMGPPPTSGTRDAFVELAMESGC---KQFPM 200

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           +  M   +  +    C S+R DG  +E   +    + R+  + +  G  G SF   N   
Sbjct: 201 IAQMEDEDEDKFKTVCHSMRDDGPFVEAGENDNLIVQRLAQDPETLGIFGYSFLMENTGQ 260

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           ++   ++G+ P+   I S  YP++R L FYVK+ H   V G++EY+S   S+     +  
Sbjct: 261 IQAATVNGVEPTPEAISSDQYPVARSLWFYVKKAHVGVVPGIQEYISEFTSEGTWGDNGY 320

Query: 320 LFQYGLIPISNEERKSVRDSI 340
           L   GLIP    ER  +  ++
Sbjct: 321 LVDVGLIPSPRNERMRIAKAV 341


>gi|295688995|ref|YP_003592688.1| phosphate-binding protein [Caulobacter segnis ATCC 21756]
 gi|295430898|gb|ADG10070.1| phosphate-binding protein [Caulobacter segnis ATCC 21756]
          Length = 346

 Score =  195 bits (495), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/323 (33%), Positives = 173/323 (53%), Gaps = 9/323 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ +  AGSST+FP+S  +AEN+S+   + K+P +ES G+  G+K FC G G+   DI 
Sbjct: 23  ARDYVWAAGSSTVFPFSTRVAENYSKKTGK-KSPKIESLGTGGGIKMFCGGTGEKFPDIA 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR + ++E   C+K GV DI E+ IG DGI++ +D+     +  +E LY  LA   + 
Sbjct: 82  NASRPMKKSEFQACQKAGVKDIVEIKIGFDGIVVATDKQGPDFNFKLEQLYLGLADQTLR 141

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
             ++V  P K W+E+ P+ P+ RI  Y P    GTR+   +  ++ G  +    +KM+  
Sbjct: 142 GGQLVKQPYKNWNEVGPNLPKARILAYGPPPTSGTRDAWIELGIEGGAAKLPTLAKMKAA 201

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + ++     + +R DG  ++   +    +  IE   +  G  G SF + NA  +K  
Sbjct: 202 ---DEKKFKATVSPMRTDGGWVDAGENDNAIVGTIEKTPNALGVFGYSFLEENASRIKGA 258

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+G+ P+   I SG YP+SR L  YVK+       GL+E+V+  VSD        L   
Sbjct: 259 SINGVKPTAQAIASGQYPLSRSLYIYVKKSQVGVTPGLKEFVTEFVSDAATGRGGYLQGR 318

Query: 324 GLIPISNEERKSVRDSIAVGKSG 346
           GLIP+   + ++++     GK+G
Sbjct: 319 GLIPLPPAQHQAMK-----GKAG 336


>gi|88658150|ref|YP_507764.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Ehrlichia chaffeensis str. Arkansas]
 gi|88599607|gb|ABD45076.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 339

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 113/344 (32%), Positives = 191/344 (55%), Gaps = 13/344 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M  F +V +  + L         +  +IR+ GSST FP+   IAE F   F ++ TP +E
Sbjct: 1   MGRFLLVFLSLITLAFNS-----SAQQIRVVGSSTAFPFISAIAEEFGR-FSDYGTPIIE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS +G   FC+G+G +T DIV SSRKI   E+  C+ + +++I E+ IG+DGI++ + 
Sbjct: 55  SVGSGMGFSMFCQGVGKNTPDIVMSSRKIKDAEVKLCQSNNINNIIEIIIGYDGIVIANS 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVF---NPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           +D   +  T +DL+KAL+ Y   ++ V     N  + WSEI   FP + I IY P    G
Sbjct: 115 KDSAKLDFTKKDLFKALSKYSTSNEYVETIPSNNFRYWSEINNRFPNIDIEIYGPYKNTG 174

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T  +L ++++Q+ C+ ++NF    D++    ++  + C+ +R DG  IEV  +    + +
Sbjct: 175 TYNILVEEIMQDACMNNQNFI---DVYSDPTKRRRI-CSIMRNDGKYIEVAANENIIIQK 230

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           I  N+D FG +  SF   N D +    I GI P+  TI SG Y +SRP+  Y+K++H + 
Sbjct: 231 IAKNQDAFGILSFSFLVKNQDKIHANKIAGIEPNYETISSGKYILSRPIYLYIKQEHISF 290

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
              L+E++   + ++ +  +  L   G IP+S+++ +  ++ I 
Sbjct: 291 SPSLKEFIKVILREDSIGKNGYLIGLGFIPLSDKDLQDTKNRIT 334


>gi|331005885|ref|ZP_08329237.1| Phosphate ABC transporter [gamma proteobacterium IMCC1989]
 gi|330420329|gb|EGG94643.1| Phosphate ABC transporter [gamma proteobacterium IMCC1989]
          Length = 365

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 114/328 (34%), Positives = 179/328 (54%), Gaps = 23/328 (7%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ I I GSST++P++ ++AE F +   +FKTP +ES GS  G K FC G G    DI 
Sbjct: 24  ARDNISIVGSSTVYPFATVVAEKFGKTT-QFKTPTIESTGSGGGAKLFCSGNGVSHPDIT 82

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR++  +EL +C+ +G +D+ EV IG DGI++ +      + LT +DL+ ALA  +  
Sbjct: 83  NASRRMKLSELKKCQANG-TDVVEVLIGFDGIVVANSNKSKQLELTRKDLFLALAKEVPN 141

Query: 144 DD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
            D    ++ NP + W ++ P  P  +IA++ P    GTR+   +  ++ GC   +  S +
Sbjct: 142 TDGSETLIPNPYQTWKDVNPTLPASKIAVFGPPPTSGTRDAFVELGMEGGC---KKVSWI 198

Query: 201 RDMFKYNV-------QQLSVA--------CTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           +D+   +        + LS +        C ++R+DG  IE   +    + ++  N D  
Sbjct: 199 KDISSASKKAKKAGDKALSKSLKNKYKGICHTIREDGAYIESGENDNLIVQKLTKNPDSL 258

Query: 246 GFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           G  G SF + NA  ++   I+G  P+  TI S  YPISRPL FYVK+ H   V G+ EYV
Sbjct: 259 GIFGFSFLEENASKVQGSLIEGNEPTFETISSKSYPISRPLYFYVKKNHIGVVPGIEEYV 318

Query: 306 SFSVSDEMMAPDSQLFQYGLIPISNEER 333
           +    D    P+  L + G+IP+S+E R
Sbjct: 319 TEFTKDSTWGPEGYLAERGMIPLSDELR 346


>gi|307294608|ref|ZP_07574450.1| phosphate transport system substrate-binding protein [Sphingobium
           chlorophenolicum L-1]
 gi|306879082|gb|EFN10300.1| phosphate transport system substrate-binding protein [Sphingobium
           chlorophenolicum L-1]
          Length = 351

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/316 (31%), Positives = 175/316 (55%), Gaps = 8/316 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++IR  GSST++P++  IAE F    P  K+P +ES G+  G+K FC+G+G    DI N
Sbjct: 32  RDQIRAVGSSTVYPFATAIAEMFVASNPGMKSPIIESTGTGGGMKLFCQGVGAQFPDIAN 91

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I ++E ++C+K+GV DI E+ +G DG+     +    + LT + +Y+ALA+     
Sbjct: 92  ASRRIKKSEFEDCQKNGVKDIIEIQVGVDGLAFAESKSGPGLKLTPKIVYEALAANPYGK 151

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                N  + W ++ P  P   I+++ P    GTR+ L + +L +GC        M+ + 
Sbjct: 152 GP---NKAQSWKDVDPSLPATPISVFGPPSTSGTRDSLAELILTKGC---ETDPAMKALK 205

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           + +  +    CT VR+DG  ++   +    + ++  N +  G  G SF + N D+LK V 
Sbjct: 206 EKSEDEFKATCTRVREDGKYVDSGENDNLIVQKLGANPNALGVFGYSFLEENKDMLKDVS 265

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           I+G+  +  T+ +G YP +RPL  YVK+ H  ++ GL+ Y++   ++    P+  L + G
Sbjct: 266 INGVEATYETVSTGQYPGARPLYIYVKKAHMQAIPGLQAYLAAFAAN--WNPNGALTKRG 323

Query: 325 LIPISNEERKSVRDSI 340
           ++    + RK+  +++
Sbjct: 324 MVAAPEDVRKASTETV 339


>gi|87200290|ref|YP_497547.1| phosphate binding protein, putative [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135971|gb|ABD26713.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 353

 Score =  192 bits (489), Expect = 5e-47,   Method: Compositional matrix adjust.
 Identities = 98/310 (31%), Positives = 171/310 (55%), Gaps = 10/310 (3%)

Query: 18  CGTGTFA-RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIG 76
           CG+   A R+++R  GSST++P++K +AE+ ++     K+P +ES G+  G+K FC G+G
Sbjct: 27  CGSQEGATRDQVRAVGSSTVYPFAKAVAESLAKSDASLKSPIIESTGTGAGMKLFCAGVG 86

Query: 77  DDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKA 136
               DI N+SR++ ++E ++C+K+GV DI E+ +G DG+     +    ++LT ED+YKA
Sbjct: 87  AQHPDIANASRRMKKSEFEDCQKNGVKDIVEIQVGLDGVAFAEAQKGPGIALTPEDVYKA 146

Query: 137 LASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
           LA     +     N  K W ++ P  P   I +Y P    GTR+ L++ +L +GC  +  
Sbjct: 147 LAK----NPYGKPNAFKTWKDVNPSLPAEPILVYGPPSTSGTRDALKELILMKGCDEN-- 200

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
            ++M+ +   +  +    C  VR DG  ++   +    + +IE N    G  G S+ + N
Sbjct: 201 -AEMKALKDSDKDKHDKICGEVRDDGAYVDAGENDNLIVQKIEANPKAIGIFGFSYLEEN 259

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
           +  +K + + GI P+  TI    YP +RPL  YVK+ H  ++ GL+ +V  +   ++   
Sbjct: 260 SSRIKGLTMKGIAPTYATISDFTYPGARPLYIYVKKAHLKAIPGLQAFV--TEWSKLWGK 317

Query: 317 DSQLFQYGLI 326
           D  L + G++
Sbjct: 318 DGSLAKLGMV 327


>gi|296282171|ref|ZP_06860169.1| phosphate binding protein, putative [Citromicrobium bathyomarinum
           JL354]
          Length = 369

 Score =  192 bits (488), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 103/317 (32%), Positives = 170/317 (53%), Gaps = 21/317 (6%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
           C +    R  IR  GSST++P++K+++E+FS   P  ++P +ES GS  G+  FC+G+G 
Sbjct: 20  CDSSGGTRESIRAVGSSTVYPFAKLVSESFSRSNPGMRSPLIESTGSGGGIALFCKGVGA 79

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKAL 137
           DT D+ N+SR++  +E + C+ +GV+DI E+ +G DGI   S +  + ++LT E +YKAL
Sbjct: 80  DTPDMANASRRMKVSEFETCQSNGVNDITEIQVGLDGIAFASAQGGIMMNLTPEIVYKAL 139

Query: 138 ASYLIVDDKVVFNPLKK------WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGC 191
           A+          NP  K      W+++ P  P   I +Y P    GTR+ L++ VL  GC
Sbjct: 140 AA----------NPYGKEQTNETWADVDPSLPATPILVYGPPSTSGTRDALKELVLTAGC 189

Query: 192 VRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLS 251
                   ++D    +       CT VR DG  ++        + +I+ NK+  G  G S
Sbjct: 190 ETDPAMEALKD---SDEDAFERTCTEVRSDGKYVDQGEQDNLIVQKIQGNKNAVGIFGYS 246

Query: 252 FYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           + + N   ++ +P++G+ P+   I S  YP +RPL  YVK  H  ++ GL+ Y+   +  
Sbjct: 247 YLEENEGKVQGLPMNGVEPTYDNIASFKYPGARPLYIYVKLAHLQAIPGLQAYLDQWM-- 304

Query: 312 EMMAPDSQLFQYGLIPI 328
           +M   D  L + GL+ +
Sbjct: 305 DMWDRDGPLAKIGLVAL 321


>gi|16125762|ref|NP_420326.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Caulobacter crescentus CB15]
 gi|221234520|ref|YP_002516956.1| phosphate-binding protein [Caulobacter crescentus NA1000]
 gi|13422894|gb|AAK23494.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Caulobacter crescentus CB15]
 gi|220963692|gb|ACL95048.1| phosphate-binding protein [Caulobacter crescentus NA1000]
          Length = 346

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 105/305 (34%), Positives = 163/305 (53%), Gaps = 4/305 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++I   GSST+FP+S  +AENF++   + K+P +E+ G+  G+K FC G G+   DI 
Sbjct: 23  ARDQIWAVGSSTVFPFSTRVAENFAKKTGK-KSPRIEALGTGGGIKMFCGGAGEKFPDIA 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR++ ++E   C+K GV DI E+ IG DGI++ S++     +  +E LY  LA   + 
Sbjct: 82  NASRQMKKSEFLACQKAGVKDIVEIKIGFDGIVVASNKKGPDFNFKLEQLYLGLADQTLR 141

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
             +VV  P K WSE+ P  P  RI  Y P    GTR+   +  ++ G  +    +KM+  
Sbjct: 142 GGQVVKQPYKSWSEVGPGLPNARILAYGPPPTSGTRDAWIELAIEGGAGKLPTLAKMKAA 201

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + ++     + +R DG  ++   +    +  IE   +  G  G SF + N   +K  
Sbjct: 202 ---DEKKFKATVSPMRTDGGWVDAGENDNAIVGTIEKTPNALGVFGYSFLEENGSRIKGA 258

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+G+ P+  TI SG YP+SR L  YVK+       GL+E+VS  VSD        L   
Sbjct: 259 SINGVKPTAQTIASGQYPLSRSLYIYVKKSQVGVTPGLKEFVSEFVSDAATGRGGYLQNR 318

Query: 324 GLIPI 328
           G+IP+
Sbjct: 319 GMIPL 323


>gi|326387437|ref|ZP_08209046.1| phosphate binding protein, putative [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208093|gb|EGD58901.1| phosphate binding protein, putative [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 360

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 99/306 (32%), Positives = 162/306 (52%), Gaps = 8/306 (2%)

Query: 2   RFFFVVLMCFVVLEVY-CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           R  F VL   + L +  C +G   R+++R  GSST++P++K +AE  +      K+P +E
Sbjct: 18  RALFPVLASALTLALSGCDSGDVVRDQVRAVGSSTVYPFAKAVAEELARSDSTLKSPIIE 77

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G+K FC G+G    DI ++SR++ ++E DEC ++GV DI E+ +G DG+     
Sbjct: 78  STGTGAGMKLFCAGVGPQFPDIEDASRRMKKSEFDECARNGVRDIVEIEVGLDGVAFARS 137

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    + LT E +Y+ALA     +     N  + W ++ P  P + I +Y P    GTR+
Sbjct: 138 QAGGDLPLTPERVYRALAK----NPYGHPNTARTWHDVDPAMPSIPILVYGPPSTSGTRD 193

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            L++ +L  GC    +   M+ +   +  +    C  VR+DG  ++   +    + +IE 
Sbjct: 194 ALKELILTRGC---DSDPAMKALATSDPARHGTICGEVREDGAYVDAGENDNLIVQKIEA 250

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N D  G  G S+ + NAD L  + +  + PS  TI    YP +RPL  YVK+ H  ++ G
Sbjct: 251 NSDAIGIFGYSYLEQNADRLTGLTMSSVRPSYATIADFSYPGARPLYIYVKKAHLRAIPG 310

Query: 301 LREYVS 306
           L  YV+
Sbjct: 311 LSAYVT 316


>gi|329888515|ref|ZP_08267113.1| protein sphX [Brevundimonas diminuta ATCC 11568]
 gi|328847071|gb|EGF96633.1| protein sphX [Brevundimonas diminuta ATCC 11568]
          Length = 358

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/318 (35%), Positives = 168/318 (52%), Gaps = 10/318 (3%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR  I  AGSST+FP++  +AE F+        P VES G+  G++ FC G+G  T DI 
Sbjct: 34  ARTGIWAAGSSTVFPFATRVAETFARNGGGGSAPRVESLGTGGGIQAFCSGVGPSTPDIA 93

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI- 142
           N+SR + Q+E D C ++GV+DI E+ IG+DGI++ + R   S +L + DLY+ALA     
Sbjct: 94  NASRPMKQSEFDRCVENGVTDIVEIKIGYDGIVVATARTGQSFNLELNDLYEALAKETPG 153

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
            D ++  N  K W+E+    P  RI +Y P    GTR+   +  +  G   ++    +  
Sbjct: 154 ADGQLGPNAAKTWNEVNKALPATRIQVYGPPPTSGTRDAFLELGMAPG---AKLIPAVAA 210

Query: 203 MFKYNVQQLSVACTSVRQDGIAI---EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           + K +  +      ++R+DG  I   E D    +TL R   +  VFGF   SF + N D 
Sbjct: 211 IEKQDKTRFETVAHTLREDGAWIDSGENDNAIVQTLNRTPGSLGVFGF---SFLEQNMDT 267

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           +K   IDG+ PS+ TI  G YP++R L  YVK+ H     GL ++V   +SD        
Sbjct: 268 VKAETIDGVAPSVATIADGSYPLARSLYIYVKKAHIGVTPGLEQFVQEFMSDGSAGRGGY 327

Query: 320 LFQYGLIPISNEERKSVR 337
           L   GL+P+  +E  + R
Sbjct: 328 LQDRGLVPLVADELAAER 345


>gi|120556534|ref|YP_960885.1| phosphate ABC transporter periplasmic binding protein [Marinobacter
           aquaeolei VT8]
 gi|120326383|gb|ABM20698.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Marinobacter aquaeolei VT8]
          Length = 349

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 105/308 (34%), Positives = 170/308 (55%), Gaps = 10/308 (3%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
             AR+ I I GSST++P++ ++AE F     +F TP +ES GS  GLK FC+G+G    D
Sbjct: 23  AMARDTISIVGSSTVYPFATVVAERFGANT-DFPTPKLESTGSGGGLKLFCQGVGTQHPD 81

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR++  +E D C+ +GV DI E  IG DGI++ S ++  ++ +T+E L+ AL   +
Sbjct: 82  ITNASRRMKPSEFDLCQSNGVKDITEFRIGSDGIVIASSKEAENLEVTLEQLFLALGKEV 141

Query: 142 I---VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                +++++ NP K WS+I    P   I +  P    GTR+   +  LQ GC    +  
Sbjct: 142 PNPKNENELIANPYKNWSDIDSSLPNKPIRVMGPPPTSGTRDSFNELALQGGC---EDLP 198

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
            + +M + +++ +   C S+R+DG  IE   +    + ++  +  ++G  G SF + NAD
Sbjct: 199 AVANMSEDDMEGV---CQSIREDGAFIEAGENDNLIVQKLIGDTGMYGVFGYSFLEENAD 255

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
            L+   ++G VP+   I +  YP++R L FYVK+ H   V G++EY         M P+ 
Sbjct: 256 RLQAATLNGKVPTAEGIAADEYPVARSLFFYVKKAHVGVVPGIQEYAQEFTGMGAMGPNG 315

Query: 319 QLFQYGLI 326
            L   GLI
Sbjct: 316 YLKSVGLI 323


>gi|85710043|ref|ZP_01041108.1| phosphate ABC transporter, periplasmic binding protein-like
           [Erythrobacter sp. NAP1]
 gi|85688753|gb|EAQ28757.1| phosphate ABC transporter, periplasmic binding protein-like
           [Erythrobacter sp. NAP1]
          Length = 360

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 105/318 (33%), Positives = 172/318 (54%), Gaps = 9/318 (2%)

Query: 9   MCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGL 68
           +  + L      G  AR+ IR  GSST++P++K +AENF+   PE K+P +ES GS  G+
Sbjct: 13  IAAITLSACDAGGGGARDSIRAVGSSTVYPFAKQVAENFARSNPELKSPLIESTGSGNGI 72

Query: 69  KEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSL 128
           + FC G+G DT D+VN+SR++  +E D C+ + V DI E+ +G DGI   S    + ++L
Sbjct: 73  QLFCSGLGADTPDMVNASRRMKSSEFDRCQANNVQDIIELQVGLDGIAFASKNGGIELNL 132

Query: 129 TVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQ 188
           + + +Y+ALA+     ++      + WS++ P  P+  I +Y P    GTR+ L++ VL+
Sbjct: 133 SPKIVYEALAARPYGGEQTT----QLWSDVDPSLPDDPILVYGPPSTSGTRDALKELVLE 188

Query: 189 EGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFV 248
            GC  +     +++  K    QL   CT VR DG  ++        + +IE N    G  
Sbjct: 189 VGCDTNPEMKALKEEDKDLHLQL---CTEVRSDGAYVDQGEQDNLIVQKIESNPRAVGIF 245

Query: 249 GLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFS 308
           G S+   N D +  +P++G+ P+   I +  YP +RPL  YVK+ H  ++ GL  ++   
Sbjct: 246 GFSYLDENTDKVTGLPMNGVDPTYENISNFAYPGARPLYVYVKKAHMRAIPGLDLFLQEW 305

Query: 309 VSDEMMAPDSQLFQYGLI 326
           V +  +  D  L   GL+
Sbjct: 306 VKNWKV--DGPLAAIGLV 321


>gi|73666783|ref|YP_302799.1| phosphate ABC transporter, periplasmicphosphate-binding protein,
           putative [Ehrlichia canis str. Jake]
 gi|72393924|gb|AAZ68201.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Ehrlichia canis str. Jake]
          Length = 340

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 113/344 (32%), Positives = 184/344 (53%), Gaps = 13/344 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M  FF+V +  + L            +IR+ GSST  P+   IAE F   F ++ TP +E
Sbjct: 1   MSRFFLVFLVLITLAFNVNA-----QQIRVVGSSTASPFISAIAEEFGR-FSDYGTPIIE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS +G   FC G+G +T DIV SSRKI   E+  CK + + +I E+ IG+DGI++ + 
Sbjct: 55  SVGSGMGFSMFCEGVGKNTPDIVMSSRKIKDAEVKLCKSNNIENIIEIIIGYDGIVIANS 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKV---VFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           +D   +  T +DL+KAL+ Y   ++ V     N  + WSEI    P   I +Y P    G
Sbjct: 115 KDSNKLDFTKQDLFKALSKYSTSNEYVETMSTNYFRYWSEINNRLPNTDIEVYGPYKNTG 174

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T  +L ++++Q  C+ ++NF    D++  ++++   AC  +R DG  IEV  +    + +
Sbjct: 175 TYNILVEEIMQASCIHNQNFI---DVYP-DLKRRQRACGIMRNDGKYIEVAANENIIIQK 230

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           I  N D FG +  SF   N D +    I G+ P+  TI SG Y +SRP+  Y+K++H N 
Sbjct: 231 IAKNHDAFGILSFSFLIKNQDKIHANKIAGVEPNYETISSGKYILSRPIYLYIKQEHINL 290

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
              ++E++   + +E +  +  L   G IP+S+++    ++ I 
Sbjct: 291 SSSIKEFIKVILREESIGKNGYLIGLGFIPLSDKDLLDTKNRIT 334


>gi|88608594|ref|YP_505964.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Neorickettsia sennetsu str. Miyayama]
 gi|88600763|gb|ABD46231.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Neorickettsia sennetsu str. Miyayama]
          Length = 338

 Score =  189 bits (480), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 106/321 (33%), Positives = 179/321 (55%), Gaps = 10/321 (3%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R  +R+ GSST+FP+   I+E F++ +   KTP VES G+S G K FC G+GD   DIV 
Sbjct: 20  REYVRVVGSSTVFPFMSAISEEFAKTY-RVKTPIVESTGTSAGFKLFCMGVGDAHPDIVV 78

Query: 85  SSRKITQNELDECKKHGV--SDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKALASYL 141
           SSR+I + EL  CK + +   DI E+ +G D +++ S     +    ++ D+++A++ Y+
Sbjct: 79  SSRRINEVELALCKVYSIDSGDIMEIELGRDALVVASSSGSGLDYEFSIRDIFEAISFYV 138

Query: 142 IVDDKVVFNPLKKWSEIRP-DFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
               ++V NP K+W  I    F +  I IY P+   GT E +++ VL   C+    F+  
Sbjct: 139 ADGVRLVKNPNKRWGSIDDGKFYDSEIKIYGPTRNTGTFESVKRMVLLSQCLNEPAFN-- 196

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                Y +++L   C+ VR DG+ +EV  +    + ++  N + FG +  SF+  N+D L
Sbjct: 197 ---LAYGLEKLRKICSVVRDDGVYVEVSNNENLMVQKLARNHNAFGLLSYSFFIRNSDAL 253

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           K   ++G+ P+  +I+SG Y   RP+  YVK  H + V GLR+ ++  +S+  +     L
Sbjct: 254 KAHSVNGVRPTYESIMSGQYDFVRPVYLYVKLTHLDFVRGLRDLLNEVLSENALGTYGYL 313

Query: 321 FQYGLIPISNEERKSVRDSIA 341
              G++P+ N+E   +R+ +A
Sbjct: 314 RAVGMVPMPNQELGVIREKVA 334


>gi|103486316|ref|YP_615877.1| phosphate binding protein, putative [Sphingopyxis alaskensis
           RB2256]
 gi|98976393|gb|ABF52544.1| phosphate binding protein, putative [Sphingopyxis alaskensis
           RB2256]
          Length = 353

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 102/287 (35%), Positives = 151/287 (52%), Gaps = 8/287 (2%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           +G  AR+ I   GSST++P++  + E F+E     KTP ++S G+  G + FC G+G DT
Sbjct: 31  SGGGARDYISAVGSSTVYPFATAVGEKFAEATGN-KTPKIDSTGTGGGFERFCAGVGGDT 89

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI N+SR+I + E D C  +GV DI E+ IG DGI L          LT ED+YKALA+
Sbjct: 90  PDIANASRRIKKKEFDTCVANGVKDIVEIQIGIDGIALGEATRGPGFKLTEEDVYKALAA 149

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
                     N  K W ++ P  P V I+++ P    GT +  ++ +L  GC  +    +
Sbjct: 150 NPYGKP----NTAKTWKDVNPALPAVAISVFGPPSTSGTYDAFKELILGRGCDAN---PE 202

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           M+ +   N  +    CT++R     +E   +    +++++ N    G  G S+   N D 
Sbjct: 203 MKALKASNADEHEATCTTLRGSPYYVEQGENDNLIISKLDKNPTSLGIFGFSYLDANKDK 262

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
           +K VPI G+ P+   I  G YP SRPL  YVK+ H   V GL EYV+
Sbjct: 263 IKAVPIQGVAPTYAAIADGSYPGSRPLFIYVKKAHVGVVPGLAEYVA 309


>gi|268680478|ref|YP_003304909.1| periplasmic phosphate binding protein [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268618509|gb|ACZ12874.1| periplasmic phosphate binding protein [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 346

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 106/342 (30%), Positives = 174/342 (50%), Gaps = 18/342 (5%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           ++   + L+    L V    G  AR++I+I GSST++P++  +AE F        TP VE
Sbjct: 3   IKMSAIALLSVAALSV----GANARDQIKIVGSSTVYPFTSYVAEEFKATTGN-PTPVVE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G+K FC G G DT D  N+SR +  +E   C ++GV+DI  + +G DGI +   
Sbjct: 58  STGTGGGMKIFCSGNGLDTPDFTNASRPMKASEFKICAENGVTDITGMMVGFDGIAVAQS 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           +   ++SLT E L+ ALA  +   D   ++ NP K W+EI    P  +I +Y P    GT
Sbjct: 118 KTNGAISLTKEHLFLALAEEVPSKDGKSLIKNPYKTWNEIDAKLPNRKITVYGPPATSGT 177

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
           R+  ++ V++    +   +   +  +K           ++RQDG+ +    +    + ++
Sbjct: 178 RDSFDEMVMEAASKKLDAYGDKKGKYK-----------AIRQDGVFVPAGENDNLIVQKL 226

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
             +   FG  G SF + N D +    +DG+ P+   I SG YPISR L  Y K  H   V
Sbjct: 227 TKDTSAFGIFGYSFLEENGDKINGADVDGVAPTSENISSGKYPISRSLYIYAKNSHRGQV 286

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            G+ E++   V  +M+     L   GL+P++ +E K V+ ++
Sbjct: 287 KGMDEFLKLYVDAKMIGQKGVLKTIGLVPMTEDELKKVQAAV 328


>gi|294012872|ref|YP_003546332.1| phosphate transport system substrate-binding protein [Sphingobium
           japonicum UT26S]
 gi|292676202|dbj|BAI97720.1| phosphate transport system substrate-binding protein [Sphingobium
           japonicum UT26S]
          Length = 350

 Score =  189 bits (479), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 98/312 (31%), Positives = 175/312 (56%), Gaps = 10/312 (3%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++IR  GSST++P++  IAE F +  P  K+P VES G+  G+K FC+G+G    DI N
Sbjct: 31  RDQIRAVGSSTVYPFATAIAEMFVQGNPGMKSPIVESTGTGGGMKLFCQGVGAQHPDIAN 90

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR++ ++E ++C+K+GV+DI E+ IG DG+     ++   + LT   +Y+ALA+     
Sbjct: 91  ASRRMKKSEFEDCRKNGVTDIVEIQIGVDGLAFAESKNGPGLKLTPRIVYEALAANPYGK 150

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                N  + W ++ P  P   I+++ P    GTR+ L + +L +GC    +   M+ + 
Sbjct: 151 GP---NKAQSWKDVDPSLPATPISVFGPPSTSGTRDSLAELILTKGC---ESDPAMKALK 204

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           + +  +    CT +R+DG  ++   +    + ++  N +  G  G SF + N D LK V 
Sbjct: 205 EKSEDEFKATCTRIREDGKYVDSGENDNLIVQKLGANPNALGVFGYSFLEENKDRLKDVS 264

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV-SFSVSDEMMAPDSQLFQY 323
           I+G+  +  T+ +  YP +RPL  YVK+ H  ++ GL+ Y+ +F+ + +   P+  L + 
Sbjct: 265 INGVEATYETVSTSQYPGARPLYIYVKKAHMQAIPGLQAYLDTFAANWD---PNGALTRR 321

Query: 324 GLIPISNEERKS 335
           G++    + RK+
Sbjct: 322 GMVAAPEDVRKA 333


>gi|254420275|ref|ZP_05033999.1| hypothetical protein BBAL3_2585 [Brevundimonas sp. BAL3]
 gi|196186452|gb|EDX81428.1| hypothetical protein BBAL3_2585 [Brevundimonas sp. BAL3]
          Length = 355

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/319 (34%), Positives = 171/319 (53%), Gaps = 11/319 (3%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I  AGSST+FP++  +AENF+        P VES G+  G++ FC+G+G +T DI N+SR
Sbjct: 35  IWSAGSSTVFPFATRVAENFARTA-GGAAPRVESLGTGGGIQAFCQGVGPNTPDIANASR 93

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI-VDDK 146
            +  +E D C+K+GV+DI E+ IG DGI++ + R+    +  + DLY+ LA  +   D +
Sbjct: 94  PMKASEFDLCQKNGVTDIVEIKIGFDGIVVATARNGNGFNFELNDLYEGLAKEVPGPDGQ 153

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
            V NP K W+E+    P  RI +Y P    GTR+   +  +  G   ++       + K 
Sbjct: 154 FVANPAKTWNEVNKGLPNQRIQVYGPPPTSGTRDAFLELGMTPG---AKLVPAAAAVEKA 210

Query: 207 NVQQLSVACTSVRQDGIAI---EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           +  +      ++R+DG  I   E D    +TL R   +  VFG+   SF + N D +K  
Sbjct: 211 DKDRFEALAHTLREDGAWIDSGENDNAIVQTLTRTPGSLGVFGY---SFLEQNLDTVKAE 267

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            IDG+ P+  TI SG YP+SR L  YVK+ H   + GL++Y+   +S+        L   
Sbjct: 268 TIDGVTPNADTIASGEYPLSRSLFIYVKKAHIGVIPGLQQYIQEFLSEGAAGKGGYLADR 327

Query: 324 GLIPISNEERKSVRDSIAV 342
           GLIP+  ++  + R + + 
Sbjct: 328 GLIPLPEDQLVAQRATASA 346


>gi|332184993|ref|ZP_08386742.1| putative lipoprotein [Sphingomonas sp. S17]
 gi|332014717|gb|EGI56773.1| putative lipoprotein [Sphingomonas sp. S17]
          Length = 348

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/287 (33%), Positives = 154/287 (53%), Gaps = 6/287 (2%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
           G G   R++I   GSST++P++ IIAE F    PE K P +ES G+  G+K FC GIG  
Sbjct: 22  GGGAGVRDQITAVGSSTVYPFTTIIAERFVAADPEAKAPVIESTGTGAGMKLFCAGIGAG 81

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
             DI N+SR++  +E  +C  HGV  + EV IG DGI     +    ++LT  D+Y+ALA
Sbjct: 82  HPDIENASRRMKASEYRDCASHGVKALLEVQIGIDGIAFAVSKRGPRMALTTADIYRALA 141

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
           +          N  + W ++ P  P + I +Y P    GTR+ L + ++  GC       
Sbjct: 142 AR----PGGQPNNARTWRDVNPALPAIPIQVYGPPATSGTRDALAELIMAHGCDAVE--P 195

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
           +  ++ K + +   + CT VR++G  I+   +    + +++ N +  G  G S+ + N  
Sbjct: 196 EAAELAKRDPEAHHLMCTRVRENGAYIDAGENDNLIVQKLQSNPNAIGIFGYSYLEENRH 255

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           ++  V I+G+ PS   I    YP SRPL  YVK+ H +++ GLR+++
Sbjct: 256 IVDGVAINGVAPSYQAIAEDRYPGSRPLYVYVKKAHLDAIPGLRQFL 302


>gi|254420525|ref|ZP_05034249.1| hypothetical protein BBAL3_2835 [Brevundimonas sp. BAL3]
 gi|196186702|gb|EDX81678.1| hypothetical protein BBAL3_2835 [Brevundimonas sp. BAL3]
          Length = 355

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 109/319 (34%), Positives = 172/319 (53%), Gaps = 11/319 (3%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I  AGSST+FP++  +AENF+        P VES G+  G++ FC+G+G +T DI N+SR
Sbjct: 35  IWSAGSSTVFPFATRVAENFARTA-GGAAPRVESLGTGGGIQAFCQGVGPNTPDIANASR 93

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI-VDDK 146
            +  +E D C+K+GV+DI E+ IG DGI++ + R+    +  + DLY+ LA  +   D +
Sbjct: 94  PMKASEFDLCQKNGVTDIVEIKIGFDGIVVATARNGNGFNFELNDLYEGLAKEVPGPDGQ 153

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
            + NP K W+E+    P  RI +Y P    GTR+   +  +  G   +   + +    K 
Sbjct: 154 FIANPAKTWNEVNKGLPNQRIQVYGPPPTSGTRDAFLELGMTPGAKLAPAAAAVEKADKD 213

Query: 207 NVQQLSVACTSVRQDGIAI---EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
             + L+    ++R+DG  I   E D    +TL R   +  VFG+   SF + N D +K  
Sbjct: 214 RFEALA---HTLREDGAWIDSGENDNAIVQTLTRTPGSLGVFGY---SFLEQNLDTVKAE 267

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            IDG+ P+  TI SG YP+SR L  YVK+ H   + GL++Y+   +S+        L   
Sbjct: 268 TIDGVTPNADTIASGEYPLSRSLFIYVKKAHIGVIPGLQQYIQEFLSEGAAGKGGYLADR 327

Query: 324 GLIPISNEERKSVRDSIAV 342
           GLIP+  ++  + R + + 
Sbjct: 328 GLIPLPEDQLVAQRATASA 346


>gi|302384352|ref|YP_003820175.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Brevundimonas subvibrioides ATCC 15264]
 gi|302194980|gb|ADL02552.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Brevundimonas subvibrioides ATCC 15264]
          Length = 357

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 111/323 (34%), Positives = 174/323 (53%), Gaps = 16/323 (4%)

Query: 18  CGTGT--FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           CG G    AR+ I  AGSST+FP++  +AENF+   P+   P VES G+  G++ FC+G+
Sbjct: 24  CGQGGPRTARDGIWAAGSSTVFPFATRVAENFARNNPDASPPRVESLGTGGGIQAFCQGV 83

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
           G  T DI N+SR + ++E ++C ++GV++I E+ IG+DGI++ + R   S +  + DLY+
Sbjct: 84  GPSTPDIANASRPMKKSEFEKCAENGVTEIVELKIGYDGIVVATSRTGNSFNFELNDLYE 143

Query: 136 ALASYLIVDDKV-VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGC--V 192
            LA  +   +   V NP + W+++    P  RI +Y P    GTR+   +  +  G   V
Sbjct: 144 GLAKEVPGPNGTFVLNPARTWNQVNSGLPNQRIQVYGPPPTSGTRDAFLELGMTPGAKLV 203

Query: 193 RSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI---EVDGDYTETLARIEVNKDVFGFVG 249
            +      +D  ++      +A T VR+DG  I   E D    +TL R   +  VFGF  
Sbjct: 204 PAAAVVAAQDPDRFE----GLAHT-VREDGSWIDSGENDNAILQTLTRTPGSLGVFGF-- 256

Query: 250 LSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSV 309
            SF + N D +K   IDG+ P+   I +G YP++R L  YVK+ H     GL+E++    
Sbjct: 257 -SFLEQNLDTVKAETIDGVYPTAEAIANGTYPLARSLFIYVKKAHVGVTPGLQEFLIEFT 315

Query: 310 SDEMMAPDSQLFQYGLIPISNEE 332
           S+  +     L   GL+P+   E
Sbjct: 316 SEAAVGQGGYLQDRGLVPLPEPE 338


>gi|254796463|ref|YP_003081299.1| ABC-type phosphate transport system, periplasmic component
           [Neorickettsia risticii str. Illinois]
 gi|254589691|gb|ACT69053.1| ABC-type phosphate transport system, periplasmic component
           [Neorickettsia risticii str. Illinois]
          Length = 339

 Score =  185 bits (469), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 104/322 (32%), Positives = 178/322 (55%), Gaps = 10/322 (3%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR  +R+ GSST+FP+   I+E F++ +   KTP VES G+S G K FC G+GD   DIV
Sbjct: 20  AREYVRVVGSSTVFPFMSAISEEFAKTY-RVKTPIVESTGTSAGFKLFCTGVGDAHPDIV 78

Query: 84  NSSRKITQNELDECKKHGV--SDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKALASY 140
            SSR++ + EL  CK + +   DI E+ +G D +++ S     +    ++ D+++A++ Y
Sbjct: 79  VSSRRMNEVELALCKVYSIDSGDIMEIELGRDALVVASSSGSGLDYEFSIRDIFEAISFY 138

Query: 141 LIVDDKVVFNPLKKWSEIRP-DFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
           +    ++V NP K+W  I    F +  I IY P+   GT E ++K +L   C+    F+ 
Sbjct: 139 VADGVRLVKNPNKRWGNIDDGKFYDSEIKIYGPTRNTGTFESVKKMILLSQCLNEPAFN- 197

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
                 Y  ++L   C+ VR DG+ +EV  +    + ++  N + FG +  SF+  N+D 
Sbjct: 198 ----LAYGPEKLRKICSVVRDDGVYVEVSNNENLMVQKLVRNSNAFGLLSYSFFIRNSDA 253

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           LK   ++G+ P+  +I+SG Y   RP+  YVK  H   V GL++ ++  +S+  +     
Sbjct: 254 LKAHSVNGVRPTYESIMSGQYDFVRPVYLYVKLTHLGLVRGLKDLLNEVLSENALGTYGY 313

Query: 320 LFQYGLIPISNEERKSVRDSIA 341
           L   G++P+ ++E  + R+ +A
Sbjct: 314 LRAIGMVPMPDQELGAAREKVA 335


>gi|167645748|ref|YP_001683411.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Caulobacter sp. K31]
 gi|167348178|gb|ABZ70913.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Caulobacter sp. K31]
          Length = 346

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 102/321 (31%), Positives = 166/321 (51%), Gaps = 6/321 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ +  AGSST+FP+S   AENF++   + K P +ES G+  G+K FC G+G+   DI 
Sbjct: 23  ARDYVWAAGSSTVFPFSTRTAENFAKKTGK-KAPKIESLGTGGGVKMFCGGMGEKFPDIA 81

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR + ++E D C+  GV++I E+ IG DGI++  D+     +  VE LY  L   ++ 
Sbjct: 82  NASRPMKKSEFDACRAKGVNNIVELKIGFDGIVVAMDKSSPDYNFKVEHLYLGLGQTVLR 141

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
             + V NP K W ++    P  RI +Y P    GTR+   +  ++ G   ++ F   + +
Sbjct: 142 GGQFVANPYKTWKDVGAGLPANRILVYGPPPTSGTRDAFVELAIEGG---AKKFPTAKAL 198

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + +        +R DG  ++   +    +  IE      G  G SF + NA+ +K  
Sbjct: 199 HDTDEKAFKAKVDPLRTDGAWVDAGENDNAIIGTIEKTPGALGVFGYSFLEENANKIKGA 258

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            ++G+ P+   I SG YP+SR L  YVK+       GL+E+++  VSD        L   
Sbjct: 259 SVNGVKPTAQAIASGQYPLSRSLYIYVKKDQVGVTPGLKEFIAEFVSDSATGRGGYLQDR 318

Query: 324 GLIPISNEERKSVRDSIAVGK 344
           GLIP+   + ++++   A GK
Sbjct: 319 GLIPLPPAQHEAMK--AAAGK 337


>gi|53802738|ref|YP_115489.1| phosphate binding protein [Methylococcus capsulatus str. Bath]
 gi|53756499|gb|AAU90790.1| putative phosphate binding protein [Methylococcus capsulatus str.
           Bath]
          Length = 383

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 107/339 (31%), Positives = 168/339 (49%), Gaps = 15/339 (4%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           RF        +          F R  + IAGSST+FP +  +A++ S    + + P VES
Sbjct: 4   RFPAYAAASVLFFHAATAQAEFGRPYLLIAGSSTIFPLASAVADHVSASG-KIRKPKVES 62

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            G+  G+K FC G G +  DIV +SR + + E +EC  +GV++I E+ IG+DGI++   R
Sbjct: 63  TGTGGGIKLFCEGTGRNYPDIVLASRMMKKVEREECGLNGVNEITELKIGYDGIVVAQSR 122

Query: 122 DMVSVSLTVEDLYKALASYLIVD-------DKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
                +LT  DLY ALA  ++ D       D+++ NP +KWSE+ P  P++ I ++ P  
Sbjct: 123 KDGPWNLTNRDLYLALAK-MVPDPKCSGSCDRLIPNPYRKWSEVNPALPDLPIVVWGPPL 181

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GTR+   + VL+ GC     F  M+ M   N  +    C S+R+DG+    + +   +
Sbjct: 182 SSGTRDTFAEDVLEAGCA---GFPAMKQMMLANEARFKKLCQSIREDGV---YESEPESS 235

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQH 294
           +     +    G +       +   L   PI+GI P+  ++ S  YP+ RPL  YVK+ H
Sbjct: 236 IIDHVASGHGLGIIDFGVLAKHRSELVAAPIEGIEPTYESVKSQRYPVGRPLYMYVKQAH 295

Query: 295 FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER 333
                G+  Y+    SD     +  L   GLIP+ + ER
Sbjct: 296 LGLAPGMEAYLKEFTSDRAWGDEGYLIADGLIPMPSAER 334


>gi|197105955|ref|YP_002131332.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Phenylobacterium zucineum HLK1]
 gi|196479375|gb|ACG78903.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Phenylobacterium zucineum HLK1]
          Length = 361

 Score =  182 bits (461), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 99/316 (31%), Positives = 170/316 (53%), Gaps = 4/316 (1%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           A+ ++  AGSST+FP++  +AE  +          VES G+  G+K FC G G +  D+ 
Sbjct: 38  AQGQVWAAGSSTVFPFATRVAETVARTTGGAPAK-VESLGTGGGIKLFCGGAGRNFPDVA 96

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR++ ++E + C+ +GV+DI EV IG+DGI++ + ++  +  LT E +Y+ALA+ +  
Sbjct: 97  NASRRMKKSEWEACQANGVTDILEVKIGYDGIVIANAKNAPTFHLTREQIYRALAAEVPQ 156

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
                 N    WS + P  P  RI  Y P    GTR+   +  +++G  +    + ++  
Sbjct: 157 GSGFATNTAATWSAVAPGLPNERIVAYGPPPTSGTRDAFVELAMEKGAEKVPAMAALKSS 216

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            +   +Q +    ++R+DG  I+   +    +  +E   +  G  G SF +NN D +K  
Sbjct: 217 DEEAFKQRA---HTLRKDGAWIDAGENDNVIVQTLEKTPNAVGVFGYSFLENNMDKVKAA 273

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I+G+ P++  I +G YP+SR L  YVKR +     GL+E+V   +S+  +     L Q 
Sbjct: 274 DIEGVSPTLENISTGKYPLSRSLYIYVKRANIGVTPGLKEFVDGFLSEAAVGRGGYLLQR 333

Query: 324 GLIPISNEERKSVRDS 339
           GLIP+  +E  + RD+
Sbjct: 334 GLIPLPADELTAQRDA 349


>gi|294084775|ref|YP_003551533.1| phosphate binding protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664348|gb|ADE39449.1| phosphate binding protein, putative [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 350

 Score =  178 bits (452), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 106/314 (33%), Positives = 169/314 (53%), Gaps = 18/314 (5%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+ I I+GSST+ P++ I+AE      P+FKTP VESGGSSVG K  C G+G +  DI 
Sbjct: 22  ARDYISISGSSTVLPFATIVAERLGRN-PDFKTPVVESGGSSVGKKSVCDGVGTEFTDIG 80

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+S ++ + EL  C  +GV  + E+ +G+DGI++   +    ++++  DL KAL + +  
Sbjct: 81  NASSRMKEKELAYCGTNGVK-LTEIKVGYDGIVVAGSKAGELLTISKADLGKALTAMVPA 139

Query: 144 D-------DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
                   D +V NP  KWSEI PD P++ I +Y P    GTR    + V ++G     +
Sbjct: 140 SEVRNYKTDVMVPNPFTKWSEINPDLPDIAIRVYGPPTTSGTRASFAEMVNEKGYCGKDD 199

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
            +K   + K   ++  + C ++R DG+ +E        + +++ +   +G  G S+   N
Sbjct: 200 EAKR--VLKIMGEKAKI-CRAMRTDGVYVEAGEQDNLIVQKLQEDPTSYGIFGFSYLDQN 256

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS--DEMM 314
           AD L+   I G  P+   I +  Y +SR L FYVK QH   + G+ +Y++      DE  
Sbjct: 257 ADTLQGAVISGTAPTFDNIATDNYSVSRALYFYVKHQHMGVIPGVADYMNEWTKHWDE-- 314

Query: 315 APDSQLFQYGLIPI 328
             D  L + G+IP+
Sbjct: 315 --DGILAESGMIPM 326


>gi|83593370|ref|YP_427122.1| phosphate binding protein [Rhodospirillum rubrum ATCC 11170]
 gi|83576284|gb|ABC22835.1| phosphate binding protein, putative [Rhodospirillum rubrum ATCC
           11170]
          Length = 338

 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/306 (31%), Positives = 153/306 (50%), Gaps = 7/306 (2%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR++ RI GSST+F  +  +AE  S      + P VE  G+  G   FC GIG +T D+V
Sbjct: 34  ARSQARIVGSSTMFALTAAVAERLSR-LGLGQAPLVEVTGTGAGFHRFCAGIGLETPDLV 92

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
            +SR +T  E   C+ +GV DI E+ +GH  ++L         +LT   ++ ALA  +  
Sbjct: 93  AASRTMTDQERARCRANGVDDIGEIYLGHGAVVLARSWQTPFPALTRRMVWLALADEVPR 152

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
              +  NP + WS+I P  P V I I+ P    GTR+ L   ++  GC+          +
Sbjct: 153 KWALETNPNRLWSDIAPGLPAVPIRIFGPPPSSGTRDYLASALMDPGCL------AFPLL 206

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
            +    +   AC  +R+DG  IE   D    + R+  +    GF+G + +  N  ++  +
Sbjct: 207 AERPAAERETACRRLREDGAFIEAGEDDDRLVKRLVDDPTAVGFIGYAAFHRNGHLVSAI 266

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
           PI+GI P++ TI  G YP++  L+ YVK  H   + GL  YV    +++ +  D  L   
Sbjct: 267 PIEGIAPTIETITEGSYPLTTQLILYVKTAHLGLISGLDRYVQAFTAEQAIGEDGYLRAL 326

Query: 324 GLIPIS 329
           GL+P +
Sbjct: 327 GLVPAA 332


>gi|296535818|ref|ZP_06897979.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Roseomonas cervicalis ATCC 49957]
 gi|296263886|gb|EFH10350.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Roseomonas cervicalis ATCC 49957]
          Length = 374

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/340 (30%), Positives = 171/340 (50%), Gaps = 7/340 (2%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           R   +V      L V        R   ++ GSST+ P+S+ +AE   +     +   V S
Sbjct: 29  RLLALVGTAAAFLGVAASAQAQTREVTQVTGSSTVAPFSRAVAEAVGKAAGGERV-RVAS 87

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            G+  G  +FCR  G  + D+ ++SR+IT  E   C ++G+++I E+ IG DGI++   +
Sbjct: 88  TGTVHGFAQFCRSNGLGSPDVQDASRRITSGEFTLCLRNGINEIMEIPIGFDGIVVAHRK 147

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
            + S + T+  L+  +A  +  D ++V NP   W +I PD P+  I +  P    GTR+ 
Sbjct: 148 GLASPNFTLAQLWLGVAKEVPRDGRLVPNPYTSWRQISPDLPDWPIRVIGPPPTSGTRDS 207

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
             +  +  GC  +     + D       + S  CTSVR+DG   +   D    +A+I   
Sbjct: 208 FTELAMMAGCQAAPEVQAIAD-----AAERSRVCTSVREDGRWTDAGEDDQAIVAKIADG 262

Query: 242 KD-VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
            D   G  G SF +   D ++   + GI  +  TI SG YP+SRPL  YVKR + + V G
Sbjct: 263 ADGTLGIFGFSFLEAARDRIEGSMVGGIDDTAETISSGRYPLSRPLFLYVKRPNIDRVPG 322

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L+E+++  VSD  +  D  L + GL+P   +  ++++D++
Sbjct: 323 LKEFLAEYVSDRALGQDGYLARIGLVPPPADRLRAIQDAV 362


>gi|167644235|ref|YP_001681898.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Caulobacter sp. K31]
 gi|167346665|gb|ABZ69400.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Caulobacter sp. K31]
          Length = 347

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 105/306 (34%), Positives = 156/306 (50%), Gaps = 9/306 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ +  AGSST+FP++   AENF++   + K P VES G+  G+K FC G G+   DI N
Sbjct: 26  RDYVWAAGSSTVFPFATRTAENFAKKTGK-KAPKVESLGTGGGIKLFCSGTGEGFPDIAN 84

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR + ++E D C   GV DI  + +G DGI++ +D++    +   E LY  LA  ++  
Sbjct: 85  ASRPMKKSEFDACAAKGVKDIVAIKVGFDGIVVATDKEGADYNFKTEHLYLGLAKTVLKG 144

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            + V NP K W EI    P  RI +Y P    GTR+   +  ++ G   +R F     + 
Sbjct: 145 GQFVANPYKTWDEIGSGLPGNRINVYGPPPTSGTRDAFVELAIEAG---ARKFPTADAIR 201

Query: 205 KYNVQQLSVACTSVRQDGI--AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
             N ++       +R DG   A E D     TL +   +  VFG+   S+ + N D +K 
Sbjct: 202 SDNEKKFKSLVDPLRNDGWIDAGENDNAIVGTLTKTPGSLGVFGW---SYLEENMDKIKG 258

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
             ++G+ PS  TI  G YP+SR L  YVK+ +     GL E++S   SD        L  
Sbjct: 259 ASVNGVRPSAQTIADGSYPLSRSLYIYVKKANIGVTPGLAEFLSEFTSDAASGRGGYLQG 318

Query: 323 YGLIPI 328
            GLIP+
Sbjct: 319 RGLIPL 324


>gi|295691117|ref|YP_003594810.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Caulobacter segnis ATCC 21756]
 gi|295433020|gb|ADG12192.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Caulobacter segnis ATCC 21756]
          Length = 347

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 102/306 (33%), Positives = 159/306 (51%), Gaps = 9/306 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ +  AGSST+FP++   AENF++   + K P VES G+  G+K FC G G+   DI N
Sbjct: 26  RDYVWAAGSSTVFPFATRTAENFAKKSGK-KAPKVESLGTGGGIKLFCGGTGEGFPDIAN 84

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR + ++E D C   GV DI ++ IG DGI++ +D+D    +  +E LY+ L+  ++  
Sbjct: 85  ASRPMKKSEFDACAAKGVKDILQIKIGFDGIVVATDKDGADYNFKLEHLYQGLSKQVLKG 144

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            + V NP K W ++    P  RI +Y P    GTR+   +  ++ G   +R +  +  + 
Sbjct: 145 GQFVANPNKTWDDVAGGLPGNRIQVYGPPPTSGTRDAFVELAIEAG---ARKYPTLDAIR 201

Query: 205 KYNVQQLSVACTSVRQDGI--AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
             N ++       +R DG   A E D     TL +   +  VFG+   S+ + N D +K 
Sbjct: 202 SDNEKKFKALVDPLRNDGWVDAGENDNAIVGTLTKTPGSVGVFGW---SYLEENMDKIKG 258

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
             ++G+ PS  TI  G YP+SR L  YVK+ +     GL E++    SD        L  
Sbjct: 259 ASVNGVRPSAQTISDGSYPLSRSLYIYVKKANIGVTPGLEEFLKEFTSDAATGRGGYLQG 318

Query: 323 YGLIPI 328
            GLIP+
Sbjct: 319 RGLIPL 324


>gi|86751347|ref|YP_487843.1| putative phosphate-binding periplasmic protein [Rhodopseudomonas
           palustris HaA2]
 gi|86574375|gb|ABD08932.1| putative phosphate-binding periplasmic protein [Rhodopseudomonas
           palustris HaA2]
          Length = 339

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 100/316 (31%), Positives = 168/316 (53%), Gaps = 18/316 (5%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           AR+++ IA S +   ++K ++  F      FKTP V+ GG   GL  FCRG+G D  DI 
Sbjct: 29  ARDQLWIAASPSDQSFAKAVSVQFGRAG-RFKTPIVKDGGPPAGLMSFCRGVGPDNFDIA 87

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
            SSR+I  +E++ C K+GV DI +V  G+D ++ V+++   + +L+   +Y A+A  +  
Sbjct: 88  FSSRRIASSEVELCNKNGVKDITQVQFGYDALVFVTNKASQTPALSRTAVYLAIARDVPD 147

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
              +  N  K  +            +Y+PS  HG R+V ++ ++   C  +  ++ ++  
Sbjct: 148 KGTLASNTSKPAN-----------TLYIPSANHGARDVFDEMLMVSSCTSTGAYAIIQ-- 194

Query: 204 FKYNVQQLSVACTSVRQDGIA--IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
            K N  +  VA         A  + +D D + TLAR++ +    G V  SFY NN D LK
Sbjct: 195 -KTNPDKSKVAAQCRAARQAANVVNMDSD-SGTLARLQSDPKGVGVVTWSFYTNNDDKLK 252

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +V +DG+VPS  T+ SG +PI+ PL  YVK+     + G++E+++   S+    PD  L 
Sbjct: 253 VVALDGVVPSKATVASGTFPIAYPLYLYVKKAQIGQIPGIKEWIAEFTSENAFGPDGYLG 312

Query: 322 QYGLIPISNEERKSVR 337
             GL+ + + +R+  R
Sbjct: 313 DSGLVSMPDAQRRQSR 328


>gi|114799207|ref|YP_761667.1| putative phosphate ABC transporter periplasmic phosphate-binding
           protein [Hyphomonas neptunium ATCC 15444]
 gi|114739381|gb|ABI77506.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Hyphomonas neptunium ATCC 15444]
          Length = 365

 Score =  172 bits (436), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 105/310 (33%), Positives = 164/310 (52%), Gaps = 8/310 (2%)

Query: 22  TFARN-RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
             ARN +I+I GSST+ P+S+ +AE F      F TP VE+ G+  G K FC G+G  + 
Sbjct: 39  AIARNQKIKIVGSSTVAPFSRTVAERFG-AVSGFPTPIVETTGTGGGFKAFCEGVGPVSP 97

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
            I N+SR +  +E + C K GV  I EV +G+DGI++ + +      LT E LY ALA  
Sbjct: 98  SIANASRPMKDSERELCAKAGVKAITEVALGYDGIVVANSKLGPDFDLTKEQLYLALAKE 157

Query: 141 LIVDDKVVF--NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
            I D K  F  NP K W ++ PD P   I +  P    GTR+   +  +++G   +    
Sbjct: 158 -IPDGKGGFMPNPHKNWQDVSPDLPNGPIVVLGPPPTSGTRDAFVELGMEKG---AEAIP 213

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
           +++ + + +    +    +VR DG+ ++   + +  +  +  + +  G +G SF + N D
Sbjct: 214 QLKALKESDGDAFAERAHTVRTDGVWVDFGENDSAIVQSLVKSPEAIGVLGFSFLEQNGD 273

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
            +K   + G+  S   IVSG Y ++R + FYVK Q+   V GL E+VS SV +     D 
Sbjct: 274 RVKGARLAGVEASFDNIVSGDYGLARIMFFYVKDQNLPLVEGLAEFVSASVDEGAAGNDG 333

Query: 319 QLFQYGLIPI 328
            L + GLIP+
Sbjct: 334 YLIEKGLIPL 343


>gi|283956026|ref|ZP_06373515.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 1336]
 gi|283792502|gb|EFC31282.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 1336]
          Length = 331

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 100/323 (30%), Positives = 176/323 (54%), Gaps = 27/323 (8%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
           G      ++IAGSST++P++  +AE ++      KTP VES G+  G K FC G    T 
Sbjct: 16  GALNAADLKIAGSSTVYPFTSFVAEEYAS-IKNTKTPIVESLGTGGGFKVFCEG----TT 70

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  ++    +++T ++L+ ALA  
Sbjct: 71  DISNASRPMKLSEFETCKKAGVTDIVGIMIGYDGIVLAQNKTNAPLNITKKELFLALAKE 130

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
           +  + K++ NP   W++I  + P  +I++Y P    GTR+ +E+ V+ +    S+   + 
Sbjct: 131 IPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTIEELVMSD---VSKKIPEY 187

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
           +  +K           ++RQDG  I    +    ++++ ++KD FG  G SF  +N+D +
Sbjct: 188 KGEYK-----------TLRQDGAYIPSGENDNLIVSKLTIDKDAFGIFGYSFLVSNSDKI 236

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFS---VSDEMMAPD 317
            +  IDG+ PS   I    Y ++R L  Y+     N+    +E   F+   +SD++    
Sbjct: 237 NVATIDGVTPSEENIADEKYELARSLFIYI-----NAKKNPKEAFDFAKIYMSDDLAKSG 291

Query: 318 SQLFQYGLIPISNEERKSVRDSI 340
            +L + GLIP+S+++ K+ +  I
Sbjct: 292 GELEKIGLIPLSDDKLKASQKHI 314


>gi|88597073|ref|ZP_01100309.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 84-25]
 gi|88190762|gb|EAQ94735.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 84-25]
          Length = 331

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/334 (30%), Positives = 179/334 (53%), Gaps = 23/334 (6%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L   V     CG    A   ++IAGSST++P++  +AE ++      KTP VES G+  
Sbjct: 4   ILSLSVASLALCGALNAAD--LKIAGSSTVYPFTSFVAEEYAS-IKNTKTPIVESLGTGG 60

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  ++    +
Sbjct: 61  GFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGIMIGYDGIVLAQNKTNAPL 116

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
           ++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+ +E+ V
Sbjct: 117 NITKKELFLALAKEIPQNGKLMPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTIEELV 176

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           + +    S+   + +  +K           ++RQDG  I    +    ++++ ++KD FG
Sbjct: 177 MSD---VSKKIPEYKGEYK-----------TIRQDGAYIPSGENDNLIVSKLTIDKDAFG 222

Query: 247 FVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
             G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+  +   +     E+  
Sbjct: 223 IFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYINAKK--NPKEAFEFAK 280

Query: 307 FSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
             +SD++     +L + GLIP+S+++ K+ +  +
Sbjct: 281 IYMSDDLAKSGGELEKIGLIPLSDDKLKASQKHV 314


>gi|86153532|ref|ZP_01071736.1| periplasmic phosphate binding protein [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|157414895|ref|YP_001482151.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|85843258|gb|EAQ60469.1| periplasmic phosphate binding protein [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|157385859|gb|ABV52174.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|284925874|gb|ADC28226.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni IA3902]
 gi|307747533|gb|ADN90803.1| Phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni M1]
 gi|315931814|gb|EFV10769.1| phosphate binding family protein [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 331

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 100/334 (29%), Positives = 179/334 (53%), Gaps = 23/334 (6%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L   V     CG    A   ++IAGSST++P++  +AE ++      KTP VES G+  
Sbjct: 4   ILSLSVASLALCGALNAAD--LKIAGSSTVYPFTSFVAEEYAS-IKNTKTPIVESLGTGG 60

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  ++    +
Sbjct: 61  GFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGIMIGYDGIVLAQNKTNAPL 116

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
           ++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+ +E+ V
Sbjct: 117 NITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTIEELV 176

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           + +    S+   + +  +K           ++RQDG  I    +    ++++ ++KD FG
Sbjct: 177 MSD---VSKKIPEYKGEYK-----------TIRQDGAYIPSGENDNLIVSKLTIDKDAFG 222

Query: 247 FVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
             G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+  +   +     E+  
Sbjct: 223 IFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYINAKK--NPKEAFEFAK 280

Query: 307 FSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
             +SD++     +L + GL+P+S+++ K+ +  +
Sbjct: 281 IYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHV 314


>gi|86151698|ref|ZP_01069912.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315124133|ref|YP_004066137.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|85841327|gb|EAQ58575.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315017855|gb|ADT65948.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 331

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 181/337 (53%), Gaps = 29/337 (8%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L   V     CG    A   ++IAGSST++P++  +AE ++      KTP VES G+  
Sbjct: 4   ILSLSVASLALCGALNAAD--LKIAGSSTVYPFTSFVAEEYAS-IKNTKTPIVESLGTGG 60

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  ++    +
Sbjct: 61  GFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGMMIGYDGIVLAQNKTNAPL 116

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
           ++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+ +E+ V
Sbjct: 117 NITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTIEELV 176

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           + +    S+   + +  +K           ++RQDG  I    +    ++++ ++KD FG
Sbjct: 177 MSD---VSKKIPEYKSEYK-----------TIRQDGAYIPSGENDNLIVSKLTIDKDAFG 222

Query: 247 FVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
             G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+     N+    +E   
Sbjct: 223 IFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYI-----NAKKNPKEAFD 277

Query: 307 FS---VSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           F+   +SD++     +L + GL+P+S+++ K+ +  +
Sbjct: 278 FAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHV 314


>gi|283954105|ref|ZP_06371630.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 414]
 gi|283794384|gb|EFC33128.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 414]
          Length = 331

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/331 (30%), Positives = 179/331 (54%), Gaps = 29/331 (8%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L   V    +CG    A   ++IAGSST++P++  +AE ++      KTP VES G+  
Sbjct: 4   ILSLSVASFAFCGVLNAAD--LKIAGSSTVYPFTSFVAEEYAS-IKNAKTPIVESLGTGG 60

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  ++    +
Sbjct: 61  GFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGIMIGYDGIVLAQNKTNTPL 116

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
           ++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+ +E+ V
Sbjct: 117 NITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTIEELV 176

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           + +    S+   + +  +K           ++RQDG  I    +    ++++ ++KD FG
Sbjct: 177 MSD---VSKKIPEYKGEYK-----------TIRQDGAYIPSGENDNLIVSKLTIDKDAFG 222

Query: 247 FVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
             G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+     N+    +E   
Sbjct: 223 IFGYSFLVSNSDKINAAIIDGVTPSEESIADEKYELARSLFIYI-----NAKKNPKEAFD 277

Query: 307 FS---VSDEMMAPDSQLFQYGLIPISNEERK 334
           F+   +SD++     +L + GL+P+S+++ K
Sbjct: 278 FAKIYMSDDLAKSGGELEKIGLVPLSDDKLK 308


>gi|153952378|ref|YP_001398149.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Campylobacter jejuni subsp. doylei 269.97]
 gi|152939824|gb|ABS44565.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Campylobacter jejuni subsp. doylei 269.97]
          Length = 331

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/316 (30%), Positives = 175/316 (55%), Gaps = 27/316 (8%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           ++IAGSST++P++  +AE ++      KTP VES G+  G K FC G    T DI N+SR
Sbjct: 23  LKIAGSSTVYPFTSFVAEEYAS-IKNTKTPIVESLGTGGGFKVFCEG----TTDISNASR 77

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            +  +E + CKK GV+DI  + IG+DGI+L  ++    +++T ++L+ ALA  +  + K+
Sbjct: 78  PMKLSEFETCKKEGVTDIVGIMIGYDGIVLAQNKTNAPLNITKKELFLALAKEIPQNGKL 137

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
           + NP   W++I  + P  +I++Y P    GTR+ +E+ V+ +    S+   + +  +K  
Sbjct: 138 IPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTIEELVMSD---VSKKIPEYKGEYK-- 192

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                    ++RQDG  I    +    ++++ ++KD FG  G SF  +N+D +    IDG
Sbjct: 193 ---------TIRQDGAYIPSGENDNLIVSKLTIDKDAFGIFGYSFLVSNSDKINAANIDG 243

Query: 268 IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFS---VSDEMMAPDSQLFQYG 324
           + PS  +I    Y ++R L  Y+     N+    +E   F+   +SD++     +L + G
Sbjct: 244 VTPSEESIADEKYELARSLFIYI-----NAKKNPKEAFDFAKIYMSDDLAKSGGELEKIG 298

Query: 325 LIPISNEERKSVRDSI 340
           L+P+S+++ K+ +  +
Sbjct: 299 LVPLSDDKLKASQKHV 314


>gi|148925969|ref|ZP_01809656.1| possible periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|205355463|ref|ZP_03222234.1| possible periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|145844955|gb|EDK22059.1| possible periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|205346697|gb|EDZ33329.1| possible periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|315928594|gb|EFV07888.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 305]
          Length = 331

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/337 (30%), Positives = 181/337 (53%), Gaps = 29/337 (8%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L   V     CG    A   ++IAGSST++P++  +AE ++      KTP VES G+  
Sbjct: 4   ILSLSVASLALCGALNAAD--LKIAGSSTVYPFTSFVAEEYAS-IKNTKTPIVESLGTGG 60

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  ++    +
Sbjct: 61  GFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGMMIGYDGIVLAQNKTNAPL 116

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
           ++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+ +E+ V
Sbjct: 117 NITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTIEELV 176

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           + +    S+   + +  +K           ++RQDG  I    +    ++++ ++KD FG
Sbjct: 177 MSD---VSKKIPEYKGEYK-----------TIRQDGAYIPSGENDNLIVSKLTIDKDAFG 222

Query: 247 FVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
             G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+     N+    +E   
Sbjct: 223 IFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYI-----NAKKNPKEAFD 277

Query: 307 FS---VSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           F+   +SD++     +L + GL+P+S+++ K+ +  +
Sbjct: 278 FAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHV 314


>gi|58698506|ref|ZP_00373410.1| putative periplasmic phosphate binding protein [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58534974|gb|EAL59069.1| putative periplasmic phosphate binding protein [Wolbachia
           endosymbiont of Drosophila ananassae]
          Length = 283

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 158/280 (56%), Gaps = 7/280 (2%)

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           +ES GS  G K FC GIG+DT DI  SSR + + E + CK++ ++++ E+ IG+DGI++ 
Sbjct: 1   MESIGSGSGFKMFCSGIGEDTPDITTSSRPMKEVERELCKRNKINEVIEIIIGYDGIVIA 60

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           +         T +DL++ L++Y   +DK+V N  K WS++    P+  I IY P    GT
Sbjct: 61  NSNQSHRFDFTKKDLFETLSAYSQENDKLVKNNKKFWSDVNQALPKTEIEIYGPHQNTGT 120

Query: 179 REVLEKKVL--QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
            E L   ++  Q  C+ SR F   ++ +K + ++   AC ++R DG  IEV  +    + 
Sbjct: 121 YETLVNSIMLDQYSCMNSRIF---KENYK-DQEERKQACGNIRDDGRYIEVGINENIIIQ 176

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFN 296
           +++ NK+  G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H +
Sbjct: 177 KLKSNKNALGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPLYLYIKKEHLD 236

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSV 336
           +V GLRE+V   + D +      L + GLIP+S+E+ K  
Sbjct: 237 TVDGLREFVK-EIIDSIGIEGGYLSRLGLIPLSSEDIKKA 275


>gi|315927349|gb|EFV06693.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni DFVF1099]
          Length = 331

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 101/337 (29%), Positives = 181/337 (53%), Gaps = 29/337 (8%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L   V     CG    A   ++IAGSST++P++  +AE ++      KTP VES G+  
Sbjct: 4   ILSLSVASLALCGALNAAD--LKIAGSSTVYPFTSFVAEEYAA-IKNTKTPIVESLGTGG 60

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC G    T DI N+SR +  +E + CKK G++DI  + IG+DGI+L  ++    +
Sbjct: 61  GFKVFCEG----TTDISNASRPMKLSEFETCKKAGITDIVGMMIGYDGIVLAQNKTNAPL 116

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
           ++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+ +E+ V
Sbjct: 117 NITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTIEELV 176

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           + +    S+   + +  +K           ++RQDG  I    +    ++++ ++KD FG
Sbjct: 177 MSD---VSKKIPEYKGEYK-----------TIRQDGAYIPSGENDNLIVSKLTIDKDAFG 222

Query: 247 FVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
             G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+     N+    +E   
Sbjct: 223 IFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYI-----NAKKNPKEAFD 277

Query: 307 FS---VSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           F+   +SD++     +L + GL+P+S+++ K+ +  +
Sbjct: 278 FAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHV 314


>gi|121613740|ref|YP_001000315.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167005264|ref|ZP_02271022.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 81-176]
 gi|218562264|ref|YP_002344043.1| putative periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni NCTC 11168]
 gi|87250126|gb|EAQ73084.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 81-176]
 gi|112359970|emb|CAL34759.1| putative periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni NCTC 11168]
          Length = 331

 Score =  169 bits (428), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 97/316 (30%), Positives = 175/316 (55%), Gaps = 27/316 (8%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           ++IAGSST++P++  +AE ++      KTP VES G+  G K FC G    T DI N+SR
Sbjct: 23  LKIAGSSTVYPFTSFVAEEYAS-IKNTKTPIVESLGTGGGFKVFCEG----TTDISNASR 77

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            +  +E + CKK GV+DI  + IG+DGI+L  ++    +++T ++L+ ALA  +  + K+
Sbjct: 78  PMKLSEFETCKKAGVTDIVGMMIGYDGIVLAQNKTNAPLNITKKELFLALAKEIPQNGKL 137

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
           + NP   W++I  + P  +I++Y P    GTR+ +E+ V+ +    S+   + +  +K  
Sbjct: 138 IPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTIEELVMSD---VSKKIPEYKGEYK-- 192

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                    ++RQDG  I    +    ++++ ++KD FG  G SF  +N+D +    IDG
Sbjct: 193 ---------TIRQDGAYIPSGENDNLIVSKLTIDKDAFGIFGYSFLVSNSDKINAANIDG 243

Query: 268 IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFS---VSDEMMAPDSQLFQYG 324
           + PS  +I    Y ++R L  Y+     N+    +E   F+   +SD++     +L + G
Sbjct: 244 VTPSEESIADEKYELARSLFIYI-----NAKKNPKEAFDFAKIYMSDDLAKSGGELEKIG 298

Query: 325 LIPISNEERKSVRDSI 340
           L+P+S+++ K+ +  +
Sbjct: 299 LVPLSDDKLKASQKHV 314


>gi|222823805|ref|YP_002575379.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Campylobacter lari RM2100]
 gi|222539027|gb|ACM64128.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Campylobacter lari RM2100]
          Length = 327

 Score =  168 bits (425), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 101/339 (29%), Positives = 173/339 (51%), Gaps = 31/339 (9%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           +   + + CFV L             ++IAGSST++P++  +AE ++      KTP VES
Sbjct: 3   KLLALSVACFVSLNAA---------ELKIAGSSTVYPFTSFVAEEYAS-IKNTKTPIVES 52

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            G+  G K FC GI     DI N+SR I  +E + CKK GVSDI  + IG+DGI+L  ++
Sbjct: 53  LGTGGGFKVFCEGI----TDISNASRAIKPSEFETCKKSGVSDIVGIMIGYDGIVLAQNK 108

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
               +++++++L+ ALA  +  D K++ NP   W +I  + P  +I IY P    GTR+ 
Sbjct: 109 INAPLNISMQELFLALAKEIPQDGKLIPNPYTNWQQINKNLPNRKITIYGPPSSSGTRDS 168

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
           +E+ V+ +    S+   + + ++K           ++RQDG  I    +    ++++ V+
Sbjct: 169 IEELVMVD---ISKKIPEYKGVYK-----------TIRQDGAFIPSGENDNLIVSKLSVD 214

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL 301
           K+ FG  G  F  +N D +    IDG+      I  G Y ++R L  Y+  +    V   
Sbjct: 215 KEAFGLFGYGFLASNDDKINAAYIDGVKADEKNISEGKYKLARSLFIYMNAKKNPEVF-- 272

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            E+    +SD++    ++L + GL+P+  +  K  +  I
Sbjct: 273 -EFAKIYMSDDLAKSGAELEKIGLVPLDEKTLKQTQKHI 310


>gi|85710044|ref|ZP_01041109.1| phosphate binding protein, putative [Erythrobacter sp. NAP1]
 gi|85688754|gb|EAQ28758.1| phosphate binding protein, putative [Erythrobacter sp. NAP1]
          Length = 359

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/310 (32%), Positives = 164/310 (52%), Gaps = 12/310 (3%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST++P+++ +AE++         P + S G+  G++EFC G G +T DIVN+SR
Sbjct: 35  ISIVGSSTVYPFAQKVAEDYVAGNEGAAAPVIVSTGTGEGIEEFCAGQGPETADIVNASR 94

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKALASYLIVDDK 146
           ++TQ+E + C+ +GVSDI EV +G DGI+ VS  D  + + LT   +Y ALA+  + +++
Sbjct: 95  QMTQSEFERCRTNGVSDIIEVKVGRDGIVFVSAMDEGIELELTPGIIYNALAAMPLGEEQ 154

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
              N    WS++    P   I +Y P    GTR+ L   ++   C   R  S+M  + + 
Sbjct: 155 TAEN----WSDVDSSLPSEPIIVYGPPETSGTRDALLDVIMTPAC---RRNSEMAALEES 207

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLAR-IEVNKDVFGFVGLSFYKNNADVLKLVPI 265
           +  Q    C  +R D   ++  G+  + L R +  N    G +G S+   NA+ +K +PI
Sbjct: 208 DPAQFERDCHELRSDEAYLD-QGEQDDLLVRKVANNPRAIGVLGYSYLDENAESVKGLPI 266

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGL 325
            G+  S  TI  G Y  SR L  YVK+ H     GL  Y++     +    +  L   GL
Sbjct: 267 GGVEASAETIADGSYAGSRALYIYVKKAHIGVTPGLENYLAQWA--QSWGTEGPLADIGL 324

Query: 326 IPISNEERKS 335
           +P+++ ++ +
Sbjct: 325 VPLTDADQAA 334


>gi|57167642|ref|ZP_00366782.1| probable periplasmic phosphate binding protein Cj0613
           [Campylobacter coli RM2228]
 gi|305433147|ref|ZP_07402303.1| phosphate ABC superfamily ATP binding cassette transporter,
           periplasmic phosphate binding protein [Campylobacter
           coli JV20]
 gi|57020764|gb|EAL57428.1| probable periplasmic phosphate binding protein Cj0613
           [Campylobacter coli RM2228]
 gi|304443848|gb|EFM36505.1| phosphate ABC superfamily ATP binding cassette transporter,
           periplasmic phosphate binding protein [Campylobacter
           coli JV20]
          Length = 331

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/324 (29%), Positives = 172/324 (53%), Gaps = 27/324 (8%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
            G      ++IAGSST++P++  +AE ++      KTP VES G+  G K FC GI    
Sbjct: 15  AGALNAADLKIAGSSTVYPFTSFVAEEYAAIH-NTKTPIVESLGTGGGFKVFCEGI---- 69

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI N+SR +  +E + CKK GV+DI  + +G+DGI+L  ++    +++T ++L+ ALA 
Sbjct: 70  TDISNASRAMKFSEFETCKKAGVTDIVGIMVGYDGIVLAQNKANAPLNITKKELFLALAK 129

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            +  + K++ NP   W++I  + P  +I++Y P    GTR+ +E+ V+ +    S+   +
Sbjct: 130 EIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTVEELVMSD---ISKKIPE 186

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
            +  +K           ++RQDG  I    +    ++++ ++KD FG  G  F  +N D 
Sbjct: 187 YKGEYK-----------TIRQDGAYIPSGENDNLIVSKLTIDKDAFGLFGYGFLVSNVDK 235

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFS---VSDEMMAP 316
           +    IDG+      I  G Y ++R L  Y+     N+    +E   F+   +SD++   
Sbjct: 236 INAADIDGVKADEKNIADGKYDLARSLFIYI-----NAKKNPKEAFEFAKIYMSDDLAKS 290

Query: 317 DSQLFQYGLIPISNEERKSVRDSI 340
             +L + GL+P+S+++ K+ +  +
Sbjct: 291 GGELEKIGLVPLSDDKLKASQKHV 314


>gi|57238191|ref|YP_178728.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni RM1221]
 gi|57166995|gb|AAW35774.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni RM1221]
 gi|315058027|gb|ADT72356.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Campylobacter jejuni subsp. jejuni S3]
          Length = 331

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/337 (29%), Positives = 177/337 (52%), Gaps = 29/337 (8%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L   V     CG    A   ++IAGSST++P++  +AE ++      KTP VES G+  
Sbjct: 4   ILSLSVASLALCGALNAAD--LKIAGSSTVYPFTSFVAEEYAAIH-NTKTPIVESLGTGG 60

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC GI     DI N+SR +  +E + CKK GV+DI  + +G+DGI+L  ++    +
Sbjct: 61  GFKVFCEGI----TDISNASRAMKFSEFETCKKAGVTDIVGIMVGYDGIVLAQNKTNAPL 116

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
           ++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+ +E+ V
Sbjct: 117 NITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTVEELV 176

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           + +    S+   + +  +K           ++RQDG  I    +    ++++ ++KD FG
Sbjct: 177 MSD---ISKKIPEYKGEYK-----------TIRQDGAYIPSGENDNLIVSKLTIDKDAFG 222

Query: 247 FVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
             G  F  +N D +    IDG+      I  G Y ++R L  Y+     N+    +E   
Sbjct: 223 LFGYGFLVSNVDKINAADIDGVKADEKNIADGKYDLARSLFIYI-----NAKKNPKEAFD 277

Query: 307 FS---VSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           F+   +SD++     +L + GL+P+S+++ K+ +  +
Sbjct: 278 FAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHV 314


>gi|289924|gb|AAA50281.1| putative [Ehrlichia ruminantium]
          Length = 277

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 141/260 (54%), Gaps = 8/260 (3%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            I + GSST FP+   IAE F   F ++ TP +ES GS +G   FC+ + + T DI  SS
Sbjct: 23  HIHVVGSSTAFPFIAAIAEEFGR-FSDYGTPIIESVGSGMGFSMFCQSVENSTPDIAMSS 81

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD- 145
           RKI   E++ CK + V DI E+ IG+DGI++ +  +   +  T +DL+KAL+ Y   ++ 
Sbjct: 82  RKIKDAEVELCKSNDVHDIIEIIIGYDGIVIANSNNSNKLDFTKKDLFKALSKYATSEEY 141

Query: 146 --KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
              +  N  K WSEI   FP + I +Y P    GT  +L ++++Q+ C+  +NF ++   
Sbjct: 142 THSIPVNDFKYWSEINNRFPNIDIEVYGPYKNTGTYNILIEEIMQDSCMNHKNFIEVYP- 200

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              ++++   AC+ +R DG  IEV  +    + +I  N   FG    SF   N D +   
Sbjct: 201 ---DLKKRQHACSMIRNDGKYIEVAANENIIIQKIAKNNAAFGIFSFSFLIQNQDKIHGN 257

Query: 264 PIDGIVPSMGTIVSGLYPIS 283
            I G+ P+  TI SG Y +S
Sbjct: 258 KIAGVEPTYETISSGKYILS 277


>gi|86149779|ref|ZP_01068008.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85839597|gb|EAQ56857.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni CF93-6]
          Length = 331

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 98/337 (29%), Positives = 176/337 (52%), Gaps = 29/337 (8%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L   V     CG    A   ++IAGSST++P++  +AE ++      KTP VES G+  
Sbjct: 4   ILSLSVASLALCGALNAAD--LKIAGSSTVYPFTSFVAEEYAAIH-NTKTPIVESLGTGG 60

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC GI     DI N+SR +  +E + CKK GV+DI  + +G+DGI+L  ++    +
Sbjct: 61  GFKVFCEGI----TDISNASRAMKFSEFETCKKAGVTDIVGIMVGYDGIVLAQNKTNAPL 116

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
           ++  ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+ +E+ V
Sbjct: 117 NIAKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRDTVEELV 176

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           + +    S+   + +  +K           ++RQDG  I    +    ++++ ++KD FG
Sbjct: 177 MSD---ISKKIPEYKGEYK-----------TIRQDGAYIPSGENDNLIVSKLTIDKDAFG 222

Query: 247 FVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
             G  F  +N D +    IDG+      I  G Y ++R L  Y+     N+    +E   
Sbjct: 223 LFGYGFLVSNVDKINAADIDGVKADEKNIADGKYELARSLFIYI-----NAKKNPKEAFD 277

Query: 307 FS---VSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           F+   +SD++     +L + GL+P+S+++ K+ +  +
Sbjct: 278 FAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHV 314


>gi|83859248|ref|ZP_00952769.1| phosphate ABC transporter-like protein, periplasmic binding protein
           [Oceanicaulis alexandrii HTCC2633]
 gi|83852695|gb|EAP90548.1| phosphate ABC transporter-like protein, periplasmic binding protein
           [Oceanicaulis alexandrii HTCC2633]
          Length = 405

 Score =  162 bits (410), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 110/354 (31%), Positives = 168/354 (47%), Gaps = 43/354 (12%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
           G G   R  +R+ GSST+FP++  +AENF      F TP VES G+  G+  FC G+G  
Sbjct: 49  GAGVGGREGLRMVGSSTVFPFATAVAENFGAK-SAFPTPVVESTGTGGGMNLFCAGVGLG 107

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVE--DLYKA 136
             D+  +SR I   E   C+ +GV  I E+ IG+DGI+L     +VS ++ +E   L+ A
Sbjct: 108 FPDLTGASRPIKATEYQLCQDNGVVAITEIPIGYDGIVL--GNSVVSDAMDIERVQLFLA 165

Query: 137 LASY--LIVD---------------------------DKVVFNPLKKWSEIRPDFPEVRI 167
           L +   + VD                           D  + NP ++WS+I  + P  RI
Sbjct: 166 LVAETPMPVDAEGRPLFDGRGEISEGRNYGEIAGFSCDSFITNPFQRWSDISAELPSQRI 225

Query: 168 AIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI---A 224
            ++ P    GTR+   +  + EG        ++ D   +  ++L+   + +R+DG    A
Sbjct: 226 EVFGPPPTSGTRDAFVELDMIEGAQHVPCLDELSDTDAHMFERLA---SRIREDGAWVDA 282

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISR 284
            E D    +TLA    +   FG  G SF + N D ++   IDGI P+   I +G+YP SR
Sbjct: 283 GENDNTIVQTLAN---SPSAFGIFGYSFLEQNGDRIQAARIDGIEPTYENISNGVYPGSR 339

Query: 285 PLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRD 338
            L  YVK QH     GL+ +V    S++   P   L + GLI +    R+   +
Sbjct: 340 SLFVYVKNQHDGVAPGLQAFVEELTSEDAWGPFGYLAERGLIALPEARRQQAAE 393


>gi|301063523|ref|ZP_07204055.1| phosphate ABC transporter, periplasmic phosphate-binding family
           protein [delta proteobacterium NaphS2]
 gi|300442462|gb|EFK06695.1| phosphate ABC transporter, periplasmic phosphate-binding family
           protein [delta proteobacterium NaphS2]
          Length = 342

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 93/339 (27%), Positives = 170/339 (50%), Gaps = 8/339 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR     L+    + V C     AR++IRI GS+++ P+ +IIAENFS ++ +F  P +E
Sbjct: 1   MRHLMRNLIIAGAVFVLCIGSAHARDQIRIVGSNSVLPFMQIIAENFSHHW-DFPPPSIE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G + F  G+     DIV + R +T++E   C+KHGV  + E+ IG D ++L + 
Sbjct: 60  DTGTGRGFRLFGSGVSFQFPDIVATPRPMTESEWAFCEKHGVDAVTEIVIGLDAVVLTNP 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +     + T+  L+ A+A  +  + +VV NP  +W+ I  + P++ I I  P       +
Sbjct: 120 KASPQHNFTISQLFNAMAEKVQKEGRVVSNPYARWNRIDKELPDMPIEIMRPQPGSPVED 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQ-DGIAIEVDGDYTETLARIE 239
            + + V+ +GC           +   + Q+    C   R      ++     ++ L  + 
Sbjct: 180 AVVQLVMIKGC------ESFPAILLLDEQESFRVCRMFRPYSKNFVKALKHTSQMLHWLS 233

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            N + F F+  + Y++  D L    ++G+  ++ +I +  YP+SRP+  YVK  H  +V 
Sbjct: 234 QNPNAFIFLPYAVYRDYTDRLMANAVNGVPATLESISTRAYPLSRPIYLYVKIPHVEAVP 293

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRD 338
           GL++++  + S+  + PD  L   G +P+ +  R   RD
Sbjct: 294 GLQKFLYETTSERAIGPDGYLVDKGFVPLDDRGRNQARD 332


>gi|213019025|ref|ZP_03334832.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|212995134|gb|EEB55775.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 272

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 95/275 (34%), Positives = 150/275 (54%), Gaps = 13/275 (4%)

Query: 71  FCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTV 130
           FC GIG+ T DI  SSR + + E + CK++ V+++ E+ IG+DGI++ +         T 
Sbjct: 2   FCSGIGEGTPDITTSSRPMKEVERELCKRNKVNEVIEIIIGYDGIVIANSNQSHRFDFTK 61

Query: 131 EDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL--Q 188
            DL++ L+SY   +D++V N  K WS++    P+  I IY P    GT E L   ++  Q
Sbjct: 62  NDLFETLSSYSEDNDRLVKNNKKFWSDVNQALPKTEIKIYGPHQNTGTHETLINFIMLDQ 121

Query: 189 EGCVRSRNFSKMRDMFKYNVQ---QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
             C+ SR       +FK N Q   +   AC+++R DG  IEV  +    + +++ NK+  
Sbjct: 122 YSCMNSR-------IFKENYQDQEKRKKACSNIRDDGRYIEVGINENIIIQKLKSNKNAL 174

Query: 246 GFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H ++V GLRE++
Sbjct: 175 GIFSFSFLAKNQDEIQGSTIAGIEPTYKNISSGEYMLARPLYLYIKKEHLDTVDGLREFI 234

Query: 306 SFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
              V D +      L + GLIP+S+E  K V + +
Sbjct: 235 R-EVVDSISTEGGYLSRLGLIPLSSENIKKVLEKV 268


>gi|58697202|ref|ZP_00372609.1| PERIPLASMIC PHOSPHATE BINDING PROTEIN [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58536476|gb|EAL59872.1| PERIPLASMIC PHOSPHATE BINDING PROTEIN [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 239

 Score =  152 bits (384), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 84/242 (34%), Positives = 137/242 (56%), Gaps = 6/242 (2%)

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           +ES GS  G K FC GIG+DT DI  SSR + + E + CK++ ++++ E+ IG+DGI++ 
Sbjct: 1   MESIGSGSGFKMFCSGIGEDTPDITTSSRPMKEVERELCKRNKINEVIEIIIGYDGIVIA 60

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           +         T +DL++ L++Y   +DK+V N  K WS++    P+  I IY P    GT
Sbjct: 61  NSNQSHRFDFTKKDLFETLSAYSQENDKLVKNNKKFWSDVNQALPKTEIEIYGPHQNTGT 120

Query: 179 REVLEKKVL--QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
            E L   ++  Q  C+ SR F   ++ +K + ++   AC ++R DG  IEV  +    + 
Sbjct: 121 YETLVNSIMLDQYSCMNSRIF---KENYK-DQEERKQACGNIRDDGRYIEVGINENIIIQ 176

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFN 296
           +++ NK+  G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H +
Sbjct: 177 KLKSNKNALGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPLYLYIKKEHLD 236

Query: 297 SV 298
           +V
Sbjct: 237 TV 238


>gi|218458177|ref|ZP_03498268.1| phosphate ABC transporter, periplasmic binding protein [Rhizobium
           etli Kim 5]
          Length = 261

 Score =  149 bits (377), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 88/240 (36%), Positives = 134/240 (55%), Gaps = 8/240 (3%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I+I GSST+FPY++ +AE F+    +   P VES G+  G K FC G+G D  DI  
Sbjct: 24  RDQIKIVGSSTVFPYTQAVAEEFANKSGK-AAPVVESTGTGGGFKAFCGGVGPDFADITG 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIV 143
           +SR I  +E+  C  +GV+DI E  IG+DG+ + VS  +    +LT   +++ALA+ L  
Sbjct: 83  ASRAIKDSEVKLCAGNGVTDITEALIGYDGLSIAVSRNNKTEWNLTKAQIFQALAAQL-P 141

Query: 144 DDK--VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
           D K  +V NP KKWS+I    P+V I  + P    GTR+   + V+  GC ++     ++
Sbjct: 142 DGKGGLVANPNKKWSDIDKSLPDVNITAFGPPPTSGTRDAFVELVMHPGCEKTAGMDAVK 201

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
              K + ++ + AC  +RQDG  IE   +    + R+E + +  G  G SF   N D LK
Sbjct: 202 ---KADEKKYTEACARMRQDGPFIEAGENDNLIVQRLESDPNSVGIFGYSFLYENEDKLK 258


>gi|224367300|ref|YP_002601463.1| PstS1 [Desulfobacterium autotrophicum HRM2]
 gi|223690016|gb|ACN13299.1| PstS1 [Desulfobacterium autotrophicum HRM2]
          Length = 277

 Score =  149 bits (376), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 133/247 (53%), Gaps = 9/247 (3%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           +R+ I I GSST++P++ ++AE F +   +FKTP +ES GS  G K F  G+G    DI 
Sbjct: 26  SRDYISIVGSSTVYPFATVVAERFGKS-TKFKTPKIESTGSGGGHKLFGAGVGVQHPDIT 84

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           NSSR+I ++E ++  K+G+  I EV IG+DGI++ + +      LT  DL+ ALA  +  
Sbjct: 85  NSSRRIKKSEFEKATKNGIR-IVEVKIGYDGIVVANSKQAAPFKLTRRDLFLALAKTVPS 143

Query: 144 DDKVVF----NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            D +      NP K W ++ P  P+V+I +  P    GTR+   + V++ G      F  
Sbjct: 144 TDNIAGNTQPNPYKTWKDVNPSLPDVKIEVLGPPPTSGTRDAFVELVMEAGA---EEFGW 200

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           ++ M K + +     C +VR+DG  IE   +    + ++E N D  G  G SF   N D 
Sbjct: 201 IKAMAKTDKKAYKALCHTVREDGAYIEAGENDNLIVQKLEANPDALGIFGFSFLDQNTDK 260

Query: 260 LKLVPID 266
           ++   ID
Sbjct: 261 IQGSFID 267


>gi|288962805|ref|YP_003453099.1| ABC-type phosphate transport system [Azospirillum sp. B510]
 gi|288915071|dbj|BAI76555.1| ABC-type phosphate transport system [Azospirillum sp. B510]
          Length = 355

 Score =  136 bits (342), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 87/320 (27%), Positives = 150/320 (46%), Gaps = 16/320 (5%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFK--TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +A S+T  P+++ +A+      P  +   P +    ++ G +  C G    T+  V ++R
Sbjct: 37  LAVSTTQMPFARAVADRVGRRDPGLREPVPILRDVATAEGFERLCSGA--PTLAAVIATR 94

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
           ++T  E D C+   V D+ E+T+G   + LV    +    LT   LY A+A  +  D K+
Sbjct: 95  RMTAREYDRCRAAEVIDVVELTVGLSALGLVHGAALPIDGLTSRSLYLAIARMVPRDGKL 154

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
           V NP   W EI P  P + IA+ +PS +   R   +  +++ GC   R   ++R +  Y 
Sbjct: 155 VPNPYTSWHEIDPALPAIPIAVALPSPREARRAQFDDAIMEAGC---RPLPEIRSV--YG 209

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEV-NKDVFGFVGLSFYKNNAD-----VLK 261
             +    C   R DG+  E D D  E + RI      V   + L+  ++ A+     V  
Sbjct: 210 ADKRRQLCIQARTDGMVQEAD-DPAELIRRIAAPGSTVLTILSLADLRSGAEEGAPAVNA 268

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
            + IDGI P     + G YP++     Y+ R+  +   GLR+YV+  + +  + P   L 
Sbjct: 269 PISIDGIPPVPDRFLDGRYPLTMATRLYLTRRALDQAGGLRDYVAEFLREAAIGPGGYLE 328

Query: 322 QYGLIPISNEERKSVRDSIA 341
             GL+P+  ++R+  R + A
Sbjct: 329 PLGLVPLPTDDRRLARRNAA 348


>gi|68171551|ref|ZP_00544929.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Ehrlichia chaffeensis str. Sapulpa]
 gi|67999035|gb|EAM85708.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Ehrlichia chaffeensis str. Sapulpa]
          Length = 239

 Score =  135 bits (340), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 73/238 (30%), Positives = 132/238 (55%), Gaps = 7/238 (2%)

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVF---NPLKKWSEIRPDFP 163
           E+ IG+DGI++ + +D   + +T +DL+KAL+ Y   ++ V     N  + WSEI   FP
Sbjct: 1   EIIIGYDGIVIANSKDSAKLDVTKKDLFKALSKYSTSNEYVETIPSNNFRYWSEINNRFP 60

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
            + I IY P    GT  +L ++++Q+ C+ ++NF    D++    ++  + C+ +R DG 
Sbjct: 61  NIDIEIYGPYKNTGTYNILVEEIMQDACMNNQNFI---DVYSDPTKRRRI-CSIMRNDGK 116

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPIS 283
            IEV  +    + +I  N+D FG +  SF   N D +    I GI P+  TI SG Y +S
Sbjct: 117 YIEVAANENIIIQKIAKNQDAFGILSFSFLVKNQDKIHANKIAGIEPNYETISSGKYILS 176

Query: 284 RPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           RP+  Y+K++H +    L+E++   + ++ +  +  L   G IP+S+++ +  ++ I 
Sbjct: 177 RPIYLYIKQEHISFSPSLKEFIKVILREDSIGKNGYLIGLGFIPLSDKDLQDTKNRIT 234


>gi|307151021|ref|YP_003886405.1| phosphate-binding protein [Cyanothece sp. PCC 7822]
 gi|306981249|gb|ADN13130.1| phosphate binding protein [Cyanothece sp. PCC 7822]
          Length = 333

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 99/357 (27%), Positives = 168/357 (47%), Gaps = 57/357 (15%)

Query: 2   RFFFVVLMCFVVLEVY----CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           RF    L+ F++   Y    C      ++++ I G++  FP S  +AE + +  PE +  
Sbjct: 6   RFKNSFLLTFLLFITYSLSACSGSEQKQSQVSIDGAAVGFPISLAVAEEYGKLNPEAQIS 65

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-L 116
            V S G+  G  +FC G     +DIV +SR I + E++ CKK+GV  I E+ I  DGI +
Sbjct: 66  -VASSGTGGGFSKFCAG----DLDIVGASRTIKEEEIERCKKNGVEFI-ELPIALDGIAV 119

Query: 117 LVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKH 176
           +V+ ++  +  LT+++L K   +    D+KV+      W++I P+FP+  + +Y P+   
Sbjct: 120 IVNRKNDFAKCLTIKELAKMWNAK--ADEKVL-----SWNQINPNFPDEPLKLYAPASDT 172

Query: 177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
           GT +   + +  +      ++S                  S  Q+ +   V GD +    
Sbjct: 173 GTFDYFTQAITGKAKNSRTDYS-----------------PSHNQNLLVQGVAGDTS---- 211

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDG-------IVPSMGTIVSGLYPISRPLLFY 289
                    G+VGLS+Y  N D L LV I+G        VP    I +   P+SRPL  Y
Sbjct: 212 -------ALGYVGLSYYLQNQDKLNLVAIEGPDGKCQKPVPVDNVIKNIYNPLSRPLFIY 264

Query: 290 VKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           V ++  +    LRE++ F + +     DS     G +P+ +E    V + +A G++G
Sbjct: 265 VNKKALDGKASLREFLDFYLRNSWKWVDS----VGYVPLPDEAYSKVINKLATGETG 317


>gi|298674020|ref|YP_003725770.1| phosphate-binding protein [Methanohalobium evestigatum Z-7303]
 gi|298287008|gb|ADI72974.1| phosphate binding protein [Methanohalobium evestigatum Z-7303]
          Length = 344

 Score =  122 bits (306), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 81/314 (25%), Positives = 153/314 (48%), Gaps = 49/314 (15%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           ++ + GSST++P S+ +AE F +  P   T  V S G+  G K+F +G      DI ++S
Sbjct: 62  QVIVDGSSTVYPVSQAMAEEFKKQHPGVTTS-VTSSGTGGGFKKFVQG----ETDINDAS 116

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R I  +E  +CK++G+  + E  +  DGI +V +++         D   +++   + +  
Sbjct: 117 RPIKPSESQKCKENGIEYV-EFKVATDGISVVVNQNA--------DWIDSVSKDTLAEIW 167

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL-QEGCVRSRNFSKMRDMFK 205
              NP +KWS+++ ++P+  + +Y P+   GT +   + ++ +E   R+   +   D F 
Sbjct: 168 GPENPPQKWSDVKSEWPDKNVELYGPTSASGTFDFFTEHIVGEEDASRTDYQTTENDNF- 226

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                                        +  +  +++  G++G ++Y+ N + +K + I
Sbjct: 227 ----------------------------IIKGVRGSENAMGYLGYAYYQQNENSVKAIGI 258

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF-QYG 324
           +G+ P+  TI SG YP+SRPL FYV   H      LRE+V F +       DS++  Q G
Sbjct: 259 NGVKPTEQTISSGEYPLSRPLFFYVNIDHLKENEALREFVKFYIE----KSDSEIINQVG 314

Query: 325 LIPISNEERKSVRD 338
            +P +  ++K + D
Sbjct: 315 YVPATESQQKDLMD 328


>gi|159030676|emb|CAO88346.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 341

 Score =  119 bits (298), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 90/339 (26%), Positives = 160/339 (47%), Gaps = 58/339 (17%)

Query: 7   VLMCFVVLEVY-------CGTGTFARNR-IRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           V M F  L ++       CG G F  N+ I+I GSST++P ++ +AE F    P      
Sbjct: 9   VKMVFSALSIFGISLLSACGIGEFPANKSIKIDGSSTVYPITQAVAEKFKSSQPGTAEVS 68

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           V+  G++ G +EFC G      DI N+SR I  +E+  C ++GV  I E+ +  D + +V
Sbjct: 69  VKFSGTTGGFREFCEG----KTDISNASRPIQADEMSLCNRYGVRYI-ELPVAFDALTVV 123

Query: 119 SDRDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
            +++   + S+T+E+L K         +      +  W++IRP+FP   + ++      G
Sbjct: 124 VNQENNWIDSITLEELKKMW-------EPAAEGKITNWNQIRPEFPNKPLNLFGAGQDSG 176

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T                         F Y  + +     + R+D +A E D    + +++
Sbjct: 177 T-------------------------FDYFTEAVVGKSGASRKDYVASEDDNTLVQGVSQ 211

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKR 292
              + +  G+ GL++Y+ N   LK + ID     I+PS  T+V+  Y P++RPL  YV  
Sbjct: 212 ---DPNALGYFGLAYYEQNPQKLKALGIDSGKGAILPSRETVVNSQYQPLARPLFIYVNA 268

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNE 331
           +       L+E+V + + +     +S + + G IP+++E
Sbjct: 269 EKAQKSRALQEFVEYYLDN----AESIVKEVGYIPLTDE 303


>gi|11498952|ref|NP_070185.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           (phoX) [Archaeoglobus fulgidus DSM 4304]
 gi|2649219|gb|AAB89890.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           (phoX) [Archaeoglobus fulgidus DSM 4304]
          Length = 327

 Score =  117 bits (292), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 89/329 (27%), Positives = 161/329 (48%), Gaps = 64/329 (19%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKE-FCRGIGD 77
           G G      +++AGSST++P +  +AE F++ +PE     V+S G+  G +  F  G+  
Sbjct: 34  GQGKEISGEVKVAGSSTVYPITAAMAEEFNKLYPEVVVS-VQSTGTGGGFRNFFIPGL-- 90

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKA 136
              DI ++SR I Q+ELDE +K+GV  + E  +G+D + ++V+  +  +  L+ +DL K 
Sbjct: 91  --TDINDASRPIKQSELDEARKNGVEPL-EFLVGYDALTVIVNPENDWAECLSFDDLRK- 146

Query: 137 LASYLIVDDKVVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGC 191
                      ++ P     + +WS++ P++P+  + +Y P+   GT +   + V+ E  
Sbjct: 147 -----------IWGPDATESITRWSQVNPEWPDEEMHLYGPTSASGTFDFFTEHVIGESG 195

Query: 192 VRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLS 251
                                      RQD    E D    + +AR   +KD  G++GL+
Sbjct: 196 AH-------------------------RQDYHGTEEDNTIIQAVAR---DKDAMGYLGLA 227

Query: 252 FYKNNADVLKLVPI-----DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
           +Y  N D +K   I     + + PS+ T  SG YP++RPL  YV ++       +RE+V 
Sbjct: 228 YYLENKDKVKAAKIKSEQGECVEPSIETGQSGEYPLARPLFIYVNKESLKKP-AVREFVK 286

Query: 307 FSVSDEMMAPDSQLF-QYGLIPISNEERK 334
           F + +     DS +  + G +P+S ++++
Sbjct: 287 FYLEN----LDSGIVEEIGYVPVSKDQKE 311


>gi|315648815|ref|ZP_07901910.1| phosphate binding protein [Paenibacillus vortex V453]
 gi|315275783|gb|EFU39135.1| phosphate binding protein [Paenibacillus vortex V453]
          Length = 332

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 93/328 (28%), Positives = 148/328 (45%), Gaps = 68/328 (20%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSSTL P ++ IAE F    P+ + P + +GG+  G K F        I + N+SR
Sbjct: 58  IEIDGSSTLHPLTEAIAEEFGAANPDVRIP-IGTGGTGAGFKRF----NSSEIAVANASR 112

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I   E +E K +G+ +  EV + +DG+ ++V+  +     LTV++L K           
Sbjct: 113 PIKDTEAEEAKANGI-EYHEVLVAYDGLSVVVNPSNEFVDKLTVDELKK----------- 160

Query: 147 VVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            ++ P   +K W+++R  +P   I IY P   HGT                         
Sbjct: 161 -IYEPNSTVKTWADVREGWPAEEIKIYSPGTDHGT------------------------- 194

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           F Y  + ++    S R D   I    D    +  +  +K+  G+ G SFY+ N D LKLV
Sbjct: 195 FDYFTEAINGEAQSSRNDK-QITFSADTNAVVQGVAGDKNSIGYFGFSFYEENQDKLKLV 253

Query: 264 PIDG----IVPSMGTIVSGLY-PISRPLLFYV-----KRQHFNSVLGLREYVSFSVSDEM 313
           PID     + PS+ TI    Y P+SRPLL YV     +R   N+ +      + S++ E+
Sbjct: 254 PIDNGTATVAPSIETIKDNSYAPLSRPLLLYVNDKELERPEVNAFMNFYLENAASLAGEV 313

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIA 341
                     G +P+ +++ +   D +A
Sbjct: 314 ----------GFVPLQDDQYQEEIDKLA 331


>gi|261408697|ref|YP_003244938.1| phosphate-binding protein [Paenibacillus sp. Y412MC10]
 gi|329929162|ref|ZP_08282948.1| phosphate binding protein [Paenibacillus sp. HGF5]
 gi|261285160|gb|ACX67131.1| phosphate binding protein [Paenibacillus sp. Y412MC10]
 gi|328936839|gb|EGG33274.1| phosphate binding protein [Paenibacillus sp. HGF5]
          Length = 334

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 99/331 (29%), Positives = 150/331 (45%), Gaps = 58/331 (17%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T T     I I GSSTL P ++ IAE F    P+ + P + +GG+  G K F  G     
Sbjct: 52  TTTALSGTIEIDGSSTLHPLTEAIAEEFGAANPDVRIP-IGTGGTGGGFKRFNNG----E 106

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALA 138
           I I N+SR I  +E +E K  G+S   EV + +DG+ ++V+  +     LTV++L K   
Sbjct: 107 IPISNASRPIKDSEAEEAKSKGIS-YHEVLVAYDGLSVVVNPSNEFVDKLTVDELKK--- 162

Query: 139 SYLIVDDKVVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
                    ++ P   +K W+++R  +P   I IY P   HGT                 
Sbjct: 163 ---------IYEPNSTVKTWADVREGWPAEEIKIYSPGTDHGT----------------- 196

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                   F Y  + ++    + R D   I    D    +  +  +K+  G+ G SFY+ 
Sbjct: 197 --------FDYFTEAINGEAQASRNDS-QITFSADTNAVVQGVAGDKNSIGYFGFSFYEE 247

Query: 256 NADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVS 310
           N D LKLVPID     + PSM TI    Y P+SRPLL YV  +        R  VS  ++
Sbjct: 248 NQDKLKLVPIDNGTATVAPSMETIKDNSYAPLSRPLLLYVNDKELE-----RPEVSAFMT 302

Query: 311 DEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
             +    S   + G +P+ +E+ +  +D +A
Sbjct: 303 FYLDNAASLAGEVGFVPLQDEQYQEEKDKLA 333


>gi|328950118|ref|YP_004367453.1| phosphate binding protein [Marinithermus hydrothermalis DSM 14884]
 gi|328450442|gb|AEB11343.1| phosphate binding protein [Marinithermus hydrothermalis DSM 14884]
          Length = 319

 Score =  115 bits (287), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 93/324 (28%), Positives = 157/324 (48%), Gaps = 64/324 (19%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           +G  A+  IR+ GSST++P +  IAE F+   P+ +   V   G+  G K+FC G     
Sbjct: 14  SGALAQGDIRVDGSSTVYPITLAIAEEFAIENPKARVT-VAFSGTGGGFKKFCAG----E 68

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD-MVSVSLTVEDLYKALA 138
            DI ++SR I Q+E++ C+++GV  I E+ +  DG+ +V +R+   +  L+VE+L +   
Sbjct: 69  TDINDASRPIKQSEIEMCRENGVEFI-EIPVAFDGVTVVVNRENTFAECLSVEELRR--- 124

Query: 139 SYLIVDDKVVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQE-GCVRS 194
                    ++ P   ++ WS++RP++P+  I +Y P    GT +   + V+ E G +R+
Sbjct: 125 ---------IWEPNSTVRYWSDVRPEWPKEEIVLYGPGTDSGTFDYFTEAVVGETGAIRT 175

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
             F    D    NV                          +A +E +    GF G ++Y 
Sbjct: 176 DYFPSEDD----NV-------------------------LVAGVEGSPYAMGFFGYAYYV 206

Query: 255 NNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
             AD L  + ID     + P+  TI +G Y P+SRPL  YV++        L E+V F +
Sbjct: 207 EEADRLNAIAIDNGQGCVAPTEETINNGTYAPLSRPLFIYVRKDALGHNPLLVEFVRFYL 266

Query: 310 SDEMMAPDSQLF--QYGLIPISNE 331
           S+     D++ F    G +P+ +E
Sbjct: 267 SE-----DAREFIADTGYVPLPDE 285


>gi|186684858|ref|YP_001868054.1| phosphate binding protein [Nostoc punctiforme PCC 73102]
 gi|186467310|gb|ACC83111.1| phosphate binding protein [Nostoc punctiforme PCC 73102]
          Length = 333

 Score =  113 bits (283), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 91/354 (25%), Positives = 155/354 (43%), Gaps = 57/354 (16%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
           F    LM        C +G   ++++ I G++  FP S  +AE + +  PE K   V S 
Sbjct: 11  FLLTFLMLITSSITACNSGQELKSQVSIDGAAVGFPVSLAVAEEYEKVKPEAKVS-VASS 69

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR- 121
           G+  G  +FC G     IDI  +SR I   E+ +CK   + D  E+ I  DGI ++++R 
Sbjct: 70  GTGGGFSKFCNG----DIDIAGASRTIRDEEIKKCKSKNI-DFVELPIALDGIAVIANRQ 124

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           +  +  LT+++L K   +     D  + N    W+++ P FP  ++ +Y P+   GT   
Sbjct: 125 NNFAKCLTIKELGKIWGAK---SDGKILN----WNQVNPKFPNQKLKLYAPASDTGT--- 174

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
                                 F Y  Q ++    + R D         + + L    V+
Sbjct: 175 ----------------------FDYMTQAVTGKAKNGRTD-----YTPSHNQNLLVQGVS 207

Query: 242 KDV--FGFVGLSFYKNNADVLKLVPIDG-------IVPSMGTIVSGLYPISRPLLFYVKR 292
            DV   G+VG+S+Y  N + L LV ++         VP    I +   P+SRPL  YV +
Sbjct: 208 GDVSSLGYVGISYYIQNQEKLNLVAVESPTGKCEKPVPVDNVIKNIYTPLSRPLFIYVSK 267

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +  ++   ++E+V F + +     DS     G + + +E    V+   A G++G
Sbjct: 268 KSLDTKPAVKEFVDFYLENSWKWVDS----VGYVALPDEAYVKVKQKFATGETG 317


>gi|114331003|ref|YP_747225.1| phosphate binding protein [Nitrosomonas eutropha C91]
 gi|114308017|gb|ABI59260.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Nitrosomonas eutropha C91]
          Length = 337

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 92/309 (29%), Positives = 150/309 (48%), Gaps = 52/309 (16%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG--GS 64
           ++  F++L    G    AR+ I+I GSST+FP ++ ++E+F     +     V +G  G+
Sbjct: 15  LITAFILLSGISGY-IQARSLIKIDGSSTVFPITEAVSEDFQT--AKKGATMVTAGISGT 71

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL-VSDRDM 123
             G K+FCRG     IDIVN+SR I  +E+++C+++GV  I E+ I  D + + V+ R+ 
Sbjct: 72  GGGFKKFCRG----EIDIVNASRPILSSEMEQCRQNGVQYI-EMPIAFDALTVAVNPRNN 126

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              S+T+ +L K         +K++      W++I P +P+ RI ++      GT     
Sbjct: 127 WIKSITIAELKKMWEP--AAQEKIL-----NWNQINPAWPDARIKLFGAGADSGT----- 174

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
                               F Y  + +     S R D  A E D    + +A    + +
Sbjct: 175 --------------------FDYFTEAVVGKAKSSRGDFTASEDDNVLVQGVAS---DLN 211

Query: 244 VFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
             GF G ++Y  N   LK V ID    G++PSM T+ +G Y P+SRPL  YV  +  N  
Sbjct: 212 ALGFFGFAYYIENQKKLKAVAIDHGAGGVLPSMLTVQNGSYQPLSRPLFIYVNAKSANKP 271

Query: 299 LGLREYVSF 307
             ++E+V F
Sbjct: 272 -EIKEFVIF 279


>gi|229174946|ref|ZP_04302466.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus MM3]
 gi|228608614|gb|EEK65916.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus MM3]
          Length = 305

 Score =  109 bits (273), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 145/311 (46%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF+    Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFL----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRAMKQVEENEMKKNSIQ-FTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D+      K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWVDNMTVDEL-----RLLWSEDE----SEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ   +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQNSRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SRPL  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGKYKPLSRPLFAYVNDASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|33865820|ref|NP_897379.1| ABC transporter substrate-binding protein [Synechococcus sp. WH
           8102]
 gi|33632990|emb|CAE07801.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. WH 8102]
          Length = 382

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 85/315 (26%), Positives = 150/315 (47%), Gaps = 49/315 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF-V 59
           +R F V+  C  ++ +  G+   + + IRI+GSST+FP +K   + F          F V
Sbjct: 44  VRSFLVIAGCSALIGL-AGSSAESADTIRISGSSTVFPITKAAIQGFRTTGQGKSVDFDV 102

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLV 118
           +  GS+ G +EFC       I + N+SR I+  EL  C ++G++ I E+ I  D I ++V
Sbjct: 103 KETGSTAGFREFCSA----NIPLANASRPISGKELKRCAENGINFI-ELPIAFDAITVVV 157

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           +  +  + S+TV +L +         +K     + +W+++  D+P+  I +  P    GT
Sbjct: 158 NPGNHWARSMTVNELSRLW-------NKSAQGTINRWNQVNLDYPDQAIKLCGPGNDSGT 210

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
            +V  K +         N SK                T+ R D +A E D +  + +A  
Sbjct: 211 YDVFNKTI---------NGSK----------------TNSRTDYLASEDDNELVKCVAD- 244

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKR 292
             N+    + G ++YKNN   LK V I     + ++PS+ ++ +  Y P+SRPL  Y+  
Sbjct: 245 --NRQALAYFGYAYYKNNIKKLKAVKIVNSKDNAVMPSVKSVQNEKYRPLSRPLFLYIND 302

Query: 293 QHFNSVLGLREYVSF 307
           Q   +    R+++S+
Sbjct: 303 QSLRNNKPFRQFISY 317


>gi|89099173|ref|ZP_01172051.1| Phosphate-binding protein [Bacillus sp. NRRL B-14911]
 gi|89086019|gb|EAR65142.1| Phosphate-binding protein [Bacillus sp. NRRL B-14911]
          Length = 329

 Score =  109 bits (272), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 90/294 (30%), Positives = 140/294 (47%), Gaps = 53/294 (18%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           +  I I GSST++P  + + E F    P  K   V S G+  G K F  G   DT D+ N
Sbjct: 53  QGEINIDGSSTVYPIMEAVVEEFGMEQPGVKVS-VASSGTGGGFKAFIAG---DT-DLSN 107

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIV 143
           +SR I + E  E +  G+ +  E  + +DG+ +V  +D   V  LTVE+L K     + +
Sbjct: 108 ASRPIKEEEAAELESKGI-EYTEFKLANDGLSVVVSKDNDWVDHLTVEELKK-----MWI 161

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           +D  V    KKWS+IR  +PE  I  Y P    GT +  ++ +L+E  +  +        
Sbjct: 162 EDGSV----KKWSDIREGWPEEEIKFYSPGTDSGTYDYFDEVILEEAPIVEK-------- 209

Query: 204 FKYNVQQLSVACTSVRQDGIAIE-VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                       T    D + ++ V GD           K+  G+ G ++Y  N D LK+
Sbjct: 210 -----------ATLSEDDNVLVQGVTGD-----------KNAIGYFGYAYYAENKDSLKV 247

Query: 263 VPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           VPIDG    + P+  T+ SG Y P+SRPL  YVK +   +   + E+V +++ +
Sbjct: 248 VPIDGGNGPVEPNNETVESGEYAPLSRPLFTYVKNESLKNEE-VYEFVKYTIEN 300


>gi|158320151|ref|YP_001512658.1| phosphate binding protein [Alkaliphilus oremlandii OhILAs]
 gi|158140350|gb|ABW18662.1| phosphate binding protein [Alkaliphilus oremlandii OhILAs]
          Length = 319

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 93/320 (29%), Positives = 156/320 (48%), Gaps = 54/320 (16%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            IRI GSST+FP ++ IAE F     + + P V   G+  G K+F   I  +T D+ ++S
Sbjct: 47  EIRIDGSSTVFPITEAIAEEFRAVNSDVRVP-VGVSGTGGGFKKF---IAKET-DVNDAS 101

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           R I   E  + K +GV +  E+ +  DG+ +LV+ ++    +LTV++L K  A       
Sbjct: 102 RPIKDQEAKDAKANGV-EYTELKVAFDGLSVLVNPQNTWVDNLTVDELKKIWAPD----- 155

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
               + +K WS++RP++P  +I  Y P    GT                         F 
Sbjct: 156 ----SNIKMWSDVRPEWPAEQIKFYAPGTDSGT-------------------------FD 186

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
           Y  ++++    ++R D    E D    + +A    +K+  GF G ++Y+ N D +K VPI
Sbjct: 187 YFTEEINGESGAIRPDFTGSEDDNILVQGIAG---DKNALGFFGYAYYEENKDKVKTVPI 243

Query: 266 DG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           D     + P+  TI SG Y P+SRP+  YV      + L ++E+++F +     A D  +
Sbjct: 244 DNGDGPVEPTYDTIKSGAYAPLSRPIFIYVNNDSL-ARLEVKEFITFYLE---TAKDI-V 298

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G I + +EE ++  +SI
Sbjct: 299 REVGYIALPDEEYEAELESI 318


>gi|262197757|ref|YP_003268966.1| phosphate binding protein [Haliangium ochraceum DSM 14365]
 gi|262081104|gb|ACY17073.1| phosphate binding protein [Haliangium ochraceum DSM 14365]
          Length = 345

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 89/312 (28%), Positives = 143/312 (45%), Gaps = 58/312 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I + GSST+ P S+ +AE F +      T  V   G+  G ++FCR    + I +  +SR
Sbjct: 43  IVVDGSSTVLPVSQAVAEAFEKQSEAHVT--VGKSGTGGGFQKFCR----NEIVVTGASR 96

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIVDDK 146
            + ++E   CK+ G+  I E+ + +DGI +V  +D   V  LTVE+L    A     ++K
Sbjct: 97  PVKESERAACKEAGIEFI-ELPVAYDGIAVVVHKDNSWVDHLTVEELKTMWAPE--AEEK 153

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           V+      WS+IR  FPE  + ++ P    GT +   K ++        +F    D    
Sbjct: 154 VM-----NWSDIREGFPEENLRLFGPGLDSGTYDYFTKAIVGTEHASRSDFQPNEDD--- 205

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                +V    V  D  A+                    GF G ++YK N DVLK+VPID
Sbjct: 206 -----NVLVRGVSTDAQAL--------------------GFFGFAYYKENTDVLKIVPID 240

Query: 267 G---------IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
                     + P+M ++  G Y P+SRP+  YV ++       + E+VSF ++      
Sbjct: 241 DGTADNGDGPVAPTMESVADGSYQPLSRPIFIYVNKEALEKRPEVAEFVSFYLNQ----- 295

Query: 317 DSQLFQYGLIPI 328
           D+ + + G IP+
Sbjct: 296 DALVEKVGYIPL 307


>gi|206977987|ref|ZP_03238873.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus H3081.97]
 gi|217961763|ref|YP_002340333.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH187]
 gi|222097717|ref|YP_002531774.1| phosphate ABC transporter , phosphate-binding protein [Bacillus
           cereus Q1]
 gi|206743787|gb|EDZ55208.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus H3081.97]
 gi|217063680|gb|ACJ77930.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH187]
 gi|221241775|gb|ACM14485.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Q1]
          Length = 305

 Score =  107 bits (268), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 145/311 (46%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKKNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D+      K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWVDNMTVDEL-----RLLWSEDE----SEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ+  +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQKSRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+  GFVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIGFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVASYIEFMI 273


>gi|229031920|ref|ZP_04187907.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1271]
 gi|228729384|gb|EEL80374.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1271]
          Length = 294

 Score =  107 bits (267), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 82/306 (26%), Positives = 141/306 (46%), Gaps = 54/306 (17%)

Query: 10  CFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           CF+    Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   +   G+ 
Sbjct: 5   CFL----YVGTSTAFAANEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTG 59

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +R    
Sbjct: 60  GGFNRFSKG----EVDINNASRAMKQVEENEMKKNSIQ-FTPFEVAYDGLTIVVNRQNTW 114

Query: 126 V-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           V ++TV++L       L  +D       K+WS+I   +P  ++  Y P    GT +  + 
Sbjct: 115 VDNMTVDEL-----RLLWSED----GSEKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQN 165

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
            +LQ   +                    V   S+ +D   I         +  +  +K+ 
Sbjct: 166 VILQNSRI--------------------VKKVSLSEDDQVI---------MQGVMNDKNA 196

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLRE 303
             FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SRPL  YV      + + +  
Sbjct: 197 IAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGKYKPLSRPLFAYVNDASIRNKMNVAN 256

Query: 304 YVSFSV 309
           Y+ F +
Sbjct: 257 YIEFMI 262


>gi|82702026|ref|YP_411592.1| phosphate binding protein [Nitrosospira multiformis ATCC 25196]
 gi|82410091|gb|ABB74200.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Nitrosospira multiformis ATCC 25196]
          Length = 332

 Score =  107 bits (266), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 89/313 (28%), Positives = 141/313 (45%), Gaps = 61/313 (19%)

Query: 9   MCFVVLEVYCG--TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +  VVL    G  +  +A   I+I GSST+FP ++ +AE+F           V   G+  
Sbjct: 9   IVVVVLGALLGAVSPVYAEPVIKIDGSSTVFPITEAVAEDFQIAKKGAAKVTVGISGTGG 68

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD--RDMV 124
           G K+FCRG     IDI N+SR I + E+D CK  GV  + E+ + +D + +V++   D V
Sbjct: 69  GFKKFCRG----EIDIANASRPILKKEMDACKAAGVQYV-EMPVAYDALTVVANPRNDWV 123

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            V +TV DL K            ++ P     +  W +I P +P+  I +Y P    GT 
Sbjct: 124 KV-ITVADLKK------------IWEPDAQGKITSWKQINPAWPDEPIKLYGPGADSGT- 169

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
                                   F Y  + +     S R D  A E D    + +A   
Sbjct: 170 ------------------------FDYFTEAIVGKAKSSRGDFTASEDDNVLVQGVAS-- 203

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQH 294
            +K+  G+ G ++Y  N   L+ + +D    GI+PS+ T+  G Y P+SRP+  Y+  + 
Sbjct: 204 -DKNALGYFGFAYYNENQKKLRALAVDGGKGGIIPSVETVEDGSYQPLSRPIFIYISIKA 262

Query: 295 FNSVLGLREYVSF 307
                 +RE++ F
Sbjct: 263 TEKP-EVREFIEF 274


>gi|220929517|ref|YP_002506426.1| phosphate binding protein [Clostridium cellulolyticum H10]
 gi|219999845|gb|ACL76446.1| phosphate binding protein [Clostridium cellulolyticum H10]
          Length = 313

 Score =  107 bits (266), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 90/317 (28%), Positives = 145/317 (45%), Gaps = 58/317 (18%)

Query: 5   FVVLMCFVVLEVYCGTGTFARN--------RIRIAGSSTLFPYSKIIAENFSEYFPEFKT 56
            V+ +   V    CG  T +          +I I GSST++P S  +AE F    P+ + 
Sbjct: 13  LVLGVALTVSLTACGDNTKSNQDVSTKLTGKIVIDGSSTVYPVSSAVAEEFQNEQPDVEV 72

Query: 57  PFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGIL 116
               S G+  G+K+F  G     IDI ++SRKI   E +  K  G+ D  E+ + +DGI 
Sbjct: 73  SVAMS-GTGGGMKKFAAG----EIDICDASRKIKPEEAEAAKAKGI-DFVELEVAYDGIS 126

Query: 117 LVSDRDMV-SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
           +V ++D   + S+TV++L K        D KV     K W E+ P +P+  + +Y P   
Sbjct: 127 VVVNKDNTWAESITVDELNKIWGK----DSKV-----KTWKEVNPAWPDEPLKLYGPGTD 177

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GT E   + + ++      +++   D              +V   GIA    GD     
Sbjct: 178 SGTFEFFTEVINKKAKESRTDYTPSED-------------DNVLVQGIA----GD----- 215

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYV 290
                 KD  G+ G ++Y+ N D L+++ ID     I P++ TI +  Y P+SRPL  YV
Sbjct: 216 ------KDAMGYFGFAYYEENQDSLRVLKIDSGKGPIEPNLETIKNNTYSPLSRPLYIYV 269

Query: 291 KRQHFNSVLGLREYVSF 307
            +   N    ++E++ F
Sbjct: 270 NKNKINQSP-VKEFIEF 285


>gi|324328178|gb|ADY23438.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 305

 Score =  106 bits (265), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 143/311 (45%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAANEMGEVRVDGSSTVFPIIEAVAEEYTKVHPSVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E K++ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKRNSIQ-FTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R+   V ++TV++L       L  +D       K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RENTWVDNMTVDEL-----RLLWSED----GNEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ   +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQNNRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + +DG++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVDGVLPTKDTIQSGKYKPLSRSLFAYVNDASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  YV F +
Sbjct: 263 MNVANYVEFMI 273


>gi|52141227|ref|YP_085602.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus E33L]
 gi|51974696|gb|AAU16246.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus E33L]
          Length = 305

 Score =  106 bits (264), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 144/311 (46%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+FP  + IAE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAIAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKKNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D+      K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWVDNMTVDEL-----RLLWSEDE----SEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ+  +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQKSRI--------------------VKTVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFSYVNDASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|30248546|ref|NP_840616.1| phosphate-binding protein [Nitrosomonas europaea ATCC 19718]
 gi|30138432|emb|CAD84442.1| Phosphate-binding protein [Nitrosomonas europaea ATCC 19718]
          Length = 337

 Score =  105 bits (263), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 94/319 (29%), Positives = 149/319 (46%), Gaps = 57/319 (17%)

Query: 1   MRF---FFVVLMCFVVLEVYCGTGTF--ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFK 55
           +RF   F V ++ F +L    G GT   AR  ++I+GSST+FP ++ ++E+F        
Sbjct: 6   LRFDTGFLVAILGFALL---SGIGTMVQARPLVKISGSSTVFPITEAVSEDFQAAKKGAI 62

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
                  G+  G K+FCR    D +DIVN+SR I  +E+++C+++GV  I E+ I  D +
Sbjct: 63  MVTAGIAGTGGGFKKFCR----DEVDIVNASRPILSSEMEQCRQNGVQYI-EMPIAFDAL 117

Query: 116 LLVSD--RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPS 173
            +V +   D +  S+TV +L K       + +      +  W+++ P +P  RI ++   
Sbjct: 118 TVVVNPGNDWIK-SMTVAELKK-------IWEPAAQEKILNWNQVNPAWPNARIKLFGAG 169

Query: 174 GKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTE 233
              GT                         F Y  + +     S R D  A E D    +
Sbjct: 170 ADSGT-------------------------FDYFTEAVVGKAKSSRGDFTASEDDNVLVQ 204

Query: 234 TLARIEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLF 288
            +A    + +  GF G ++Y  N   LK V ID    GI+PSM T+ +G Y P+SRPL  
Sbjct: 205 GVAS---DLNALGFFGFAYYIENHKKLKAVAIDNGSGGILPSMLTVQNGSYQPLSRPLFI 261

Query: 289 YVKRQHFNSVLGLREYVSF 307
           YV  +       +RE+V F
Sbjct: 262 YVNARSAGKP-EVREFVIF 279


>gi|47567834|ref|ZP_00238542.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Bacillus cereus G9241]
 gi|47555511|gb|EAL13854.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Bacillus cereus G9241]
          Length = 305

 Score =  105 bits (262), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 144/311 (46%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKKNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D+      K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWVDNITVDEL-----RLLWSEDE----SEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ+  +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQKSRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFVYVNHASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|42783398|ref|NP_980645.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 10987]
 gi|42739326|gb|AAS43253.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 10987]
          Length = 305

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 143/311 (45%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++ +CF     Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSICFF----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKKNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D       K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNAWVDNMTVDEL-----RLLWSEDA----SEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ   +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQNNRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|37519583|ref|NP_922960.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
 gi|35210574|dbj|BAC87955.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
          Length = 335

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 84/291 (28%), Positives = 130/291 (44%), Gaps = 56/291 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+I GSST+FP ++  AE F +         VE  G+  G K+FCRG      DI ++SR
Sbjct: 32  IQIDGSSTVFPITEAAAEAFQKSKQGAVKVTVEVSGTGGGFKKFCRG----ETDISDASR 87

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I + E+D CKK G+  I E+ +  D + ++V   +  +  LTV +L            K
Sbjct: 88  PILKKEMDACKKMGIQYI-ELPVAFDALTVMVHPSNTWAGDLTVAEL------------K 134

Query: 147 VVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
            ++ P     +  W+++R  FP V + +Y P    GT                       
Sbjct: 135 TIWEPAAQIKITNWNQVRSSFPNVPLKLYGPGTDSGT----------------------- 171

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
             F Y  + +     + R D  A E D    + +A    +K+  G+ G ++Y  N + LK
Sbjct: 172 --FDYFTEAVVGKAKASRGDFTASEDDNVLVQGIAN---DKNALGYFGYAYYAENKNKLK 226

Query: 262 LVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
            V IDG    ++PS  T+  G Y P+SRP+  YV          LR++V F
Sbjct: 227 AVGIDGGKGPVLPSEKTVEDGSYSPLSRPIFIYVNAAAAVEKPELRQFVEF 277


>gi|326204676|ref|ZP_08194532.1| phosphate binding protein [Clostridium papyrosolvens DSM 2782]
 gi|325985243|gb|EGD46083.1| phosphate binding protein [Clostridium papyrosolvens DSM 2782]
          Length = 313

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 88/305 (28%), Positives = 140/305 (45%), Gaps = 60/305 (19%)

Query: 18  CGTGTFARN--------RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLK 69
           CG+ T   N        +I I GSST++P +  +AE F       +     SG +  G+K
Sbjct: 26  CGSSTKNDNASNSNLSGKIVIDGSSTVYPVTSAVAEEFKNEQSGVEVSVAMSG-TGGGMK 84

Query: 70  EFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV-SVSL 128
           +F  G     IDI ++SRKI   E++  K  G+ D  E+ I +DGI +V ++D   + ++
Sbjct: 85  KFTAG----EIDICDASRKIKPEEVEAAKAKGI-DYVELEIAYDGISVVVNKDNTWAETI 139

Query: 129 TVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQ 188
           TV++L K        D KV     K W E+ P +P+  I +Y P    GT E   +K+ +
Sbjct: 140 TVDELNKIWGK----DSKV-----KTWKEVNPAWPDEPIKLYGPGTDSGTFEFFTEKINK 190

Query: 189 EGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE-VDGDYTETLARIEVNKDVFGF 247
           +      +++   D                  D + ++ + GD           KD  G+
Sbjct: 191 KAKESRTDYTPSED------------------DNVLVQGISGD-----------KDAMGY 221

Query: 248 VGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
            G ++Y+ N D LK++ ID     I P+  TI    Y P+SRPL  YV +   N    ++
Sbjct: 222 FGFAYYEENQDSLKVLKIDSGKGPIEPTAKTIKDKTYSPLSRPLYIYVNKNKLNQSP-VK 280

Query: 303 EYVSF 307
           E+V F
Sbjct: 281 EFVKF 285


>gi|228987520|ref|ZP_04147639.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228772252|gb|EEM20699.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 305

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 82/311 (26%), Positives = 143/311 (45%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKKNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D       K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWVDNITVDEL-----RLLWSED----GSEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ+  +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQKSRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFVYVNHASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|30264344|ref|NP_846721.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Ames]
 gi|47529791|ref|YP_021140.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|49187171|ref|YP_030423.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           anthracis str. Sterne]
 gi|65321649|ref|ZP_00394608.1| COG0226: ABC-type phosphate transport system, periplasmic component
           [Bacillus anthracis str. A2012]
 gi|118479445|ref|YP_896596.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           thuringiensis str. Al Hakam]
 gi|165872056|ref|ZP_02216696.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0488]
 gi|167634632|ref|ZP_02392952.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0442]
 gi|167638572|ref|ZP_02396848.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0193]
 gi|170687382|ref|ZP_02878599.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0465]
 gi|170707428|ref|ZP_02897882.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0389]
 gi|177655048|ref|ZP_02936714.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0174]
 gi|190565843|ref|ZP_03018762.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis Tsiankovskii-I]
 gi|196035050|ref|ZP_03102457.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus W]
 gi|196046398|ref|ZP_03113624.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 03BB108]
 gi|225866254|ref|YP_002751632.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 03BB102]
 gi|227817048|ref|YP_002817057.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. CDC 684]
 gi|229186513|ref|ZP_04313675.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BGSC 6E1]
 gi|229604682|ref|YP_002868562.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0248]
 gi|254684031|ref|ZP_05147891.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. CNEVA-9066]
 gi|254721865|ref|ZP_05183654.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A1055]
 gi|254736380|ref|ZP_05194086.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Western North America USA6153]
 gi|254741417|ref|ZP_05199104.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Kruger B]
 gi|254753946|ref|ZP_05205981.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Vollum]
 gi|254757818|ref|ZP_05209845.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Australia 94]
 gi|30258989|gb|AAP28207.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Ames]
 gi|47504939|gb|AAT33615.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|49181098|gb|AAT56474.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Sterne]
 gi|118418670|gb|ABK87089.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Bacillus thuringiensis str. Al Hakam]
 gi|164712187|gb|EDR17724.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0488]
 gi|167513420|gb|EDR88790.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0193]
 gi|167530084|gb|EDR92819.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0442]
 gi|170127672|gb|EDS96545.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0389]
 gi|170668577|gb|EDT19323.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0465]
 gi|172080309|gb|EDT65398.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0174]
 gi|190562762|gb|EDV16728.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis Tsiankovskii-I]
 gi|195992589|gb|EDX56550.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus W]
 gi|196022868|gb|EDX61549.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 03BB108]
 gi|225786224|gb|ACO26441.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 03BB102]
 gi|227005283|gb|ACP15026.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. CDC 684]
 gi|228596944|gb|EEK54602.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BGSC 6E1]
 gi|229269090|gb|ACQ50727.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0248]
          Length = 305

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 144/311 (46%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E K++ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKRNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D+      K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWVDNMTVDEL-----RLLWSEDE----SEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ+  +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQKSRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|301055766|ref|YP_003793977.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           anthracis CI]
 gi|300377935|gb|ADK06839.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus biovar anthracis str. CI]
          Length = 305

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 144/311 (46%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E K++ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKRNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D+      K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWVDNMTVDEL-----RLLWSEDE----SEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ+  +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQKSRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|229071774|ref|ZP_04204989.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus F65185]
 gi|228711369|gb|EEL63329.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus F65185]
          Length = 305

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 139/308 (45%), Gaps = 46/308 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+        +  +R+ GSST+FP  + +AE +++  P+ K   +   G+
Sbjct: 11  FVLSIWFLCFEMSTAFALNDKGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +R   
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 125 WVDDMSVDEL-----RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 176 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 207 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIRNKMNVA 266

Query: 303 EYVSFSVS 310
            YV F + 
Sbjct: 267 NYVEFMIQ 274


>gi|49481283|ref|YP_038331.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|49332839|gb|AAT63485.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar konkukian str. 97-27]
          Length = 305

 Score =  103 bits (258), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 143/311 (45%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E K++ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKRNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D       K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWVDNMTVDEL-----RLLWSED----GNEKRWSQIHSSWPRKQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ+  +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQKSRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|229157885|ref|ZP_04285960.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 4342]
 gi|228625842|gb|EEK82594.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 4342]
          Length = 305

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 144/311 (46%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E +K+ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMRKNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    + ++TV++L       L  +D+      K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWIDNITVDEL-----RLLWSEDE----SEKRWSQIHSSWPREQVKFYAPGIDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ+  +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQKSRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|228960537|ref|ZP_04122186.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228799137|gb|EEM46105.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pakistani str. T13001]
          Length = 305

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 138/307 (44%), Gaps = 46/307 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K   +   G+
Sbjct: 11  FVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +R   
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTSFEVANDGLTIVVNRHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 125 WVDDMSVDEL-----RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 176 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 207 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVA 266

Query: 303 EYVSFSV 309
            YV F +
Sbjct: 267 NYVEFMI 273


>gi|196041587|ref|ZP_03108879.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus NVH0597-99]
 gi|196027575|gb|EDX66190.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus NVH0597-99]
          Length = 305

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 81/311 (26%), Positives = 143/311 (45%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+FP  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E  E K++ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEETEMKRNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D+      K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWVDNMTVDEL-----RLLWSEDE----SEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ+  +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQKSRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|82701620|ref|YP_411186.1| phosphate binding protein [Nitrosospira multiformis ATCC 25196]
 gi|82409685|gb|ABB73794.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Nitrosospira multiformis ATCC 25196]
          Length = 339

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 128/277 (46%), Gaps = 46/277 (16%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
            G  A   ++I GSST+FP ++ +AE+F           V   G+  G K+FCRG     
Sbjct: 29  AGANAGGLVKIDGSSTVFPITEAVAEDFQNAKKGAVRVTVGISGTGGGFKKFCRG----E 84

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALA 138
            DIVN+SR I Q E++ECKK G+  + E+ +  D + ++++ ++  + +LTV +L K   
Sbjct: 85  TDIVNASRPILQKEMEECKKSGIQYV-EMPVAFDALTVVINPKNDWANTLTVAELKK--- 140

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
               + +      + KW++  P +P+ ++ +Y      GT                    
Sbjct: 141 ----IWEPEAQGKITKWNQANPAWPDEKLKLYGAGADSGT-------------------- 176

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
                F Y  + +     S R D  A E D    + +A    +K+  GF G ++Y  N  
Sbjct: 177 -----FDYFTEAIVGKTKSSRGDFTASEDDNVLVQGVAS---DKNALGFFGFAYYVENQK 228

Query: 259 VLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYV 290
            LK V ID     ++PS  T+  G Y P+SRP+  YV
Sbjct: 229 KLKAVAIDSGKGPVLPSEKTVEDGSYQPLSRPIFIYV 265


>gi|150021695|ref|YP_001307049.1| phosphate binding protein [Thermosipho melanesiensis BI429]
 gi|149794216|gb|ABR31664.1| phosphate binding protein [Thermosipho melanesiensis BI429]
          Length = 273

 Score =  103 bits (257), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 76/284 (26%), Positives = 136/284 (47%), Gaps = 50/284 (17%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           I GS+T+FP +++  E   E  PE +   +E  GSS G+        + T DI NSSR +
Sbjct: 23  IKGSNTVFPIAQLWIERLKEISPELEIT-LEGAGSSTGIAALF----NKTADIANSSRWL 77

Query: 90  TQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVF 149
            ++EL++    G   I  + IG+DGI ++ +R +   ++T+E L            K+  
Sbjct: 78  KESELEKMHSMGRYFIP-IVIGYDGIAVIVNRKIDLENITLEML-----------KKIYT 125

Query: 150 NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQ 209
             ++ W++I P+ P+ +I IY  +   GT E  EK VL+    +   + +M +  ++ V+
Sbjct: 126 GKIRYWNQIDPNLPKKQIQIYSRNTASGTFETFEKIVLKNE--KMAPWVRMVESTRFEVE 183

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV 269
                                       +E N     ++G+ +  +   VLK   ++GI+
Sbjct: 184 S---------------------------VEKNPYAIAYIGIGYVTDEVKVLK---VEGIL 213

Query: 270 PSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDE 312
           P+  TI+ G YPISRPL  +V   + +     +++Y++F +S E
Sbjct: 214 PTKETILDGTYPISRPLFMFVDATNGYPEAGAIKKYITFGLSKE 257


>gi|152976705|ref|YP_001376222.1| phosphate binding protein [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152025457|gb|ABS23227.1| phosphate binding protein [Bacillus cytotoxicus NVH 391-98]
          Length = 305

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 147/308 (47%), Gaps = 52/308 (16%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRI---RIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           F+V +C + L +   +  FA N+I   R+ GSST+FP  + +AE +++  P  K   +  
Sbjct: 11  FIVSICSIFLYM---SPAFAANKIGEVRVDGSSTVFPIMEAVAEEYTKKEPHVKVS-ISI 66

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            G+  G + F  G     +D+ N+SR + + E    +++ +     + I +DG+ ++ +R
Sbjct: 67  SGTGGGFQRFGAG----EVDMNNASRSMKRVEEKMMRENSIQ-FTPLEIAYDGLTMIVNR 121

Query: 122 DMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
               V ++TVE+L +     L  +D      +K+WS I P++P+  +  Y P    GT +
Sbjct: 122 QNKWVDNMTVEELRR-----LWSED----GSIKRWSHIHPEWPKENVQFYAPGVDSGTYD 172

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             +  VLQ+  +                    V   S+ +D   I         +  +  
Sbjct: 173 YFQNVVLQKNRL--------------------VKTVSLSEDDQVI---------MQGVMN 203

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVL 299
           +++   FVG ++Y  N D +K + ++G+ P+  TI  G+Y P+SRPL  YV     ++  
Sbjct: 204 DRNAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQFGMYKPLSRPLFAYVNHASLHNKE 263

Query: 300 GLREYVSF 307
            + +YV+F
Sbjct: 264 SVADYVAF 271


>gi|30022352|ref|NP_833983.1| phosphate-binding protein [Bacillus cereus ATCC 14579]
 gi|229129550|ref|ZP_04258521.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-Cer4]
 gi|229146857|ref|ZP_04275222.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST24]
 gi|296504768|ref|YP_003666468.1| phosphate-binding protein [Bacillus thuringiensis BMB171]
 gi|29897909|gb|AAP11184.1| Phosphate-binding protein [Bacillus cereus ATCC 14579]
 gi|228636685|gb|EEK93150.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST24]
 gi|228654155|gb|EEL10022.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-Cer4]
 gi|296325820|gb|ADH08748.1| phosphate-binding protein [Bacillus thuringiensis BMB171]
          Length = 305

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 138/308 (44%), Gaps = 46/308 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K   +   G+
Sbjct: 11  FVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +R   
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 125 WVDDMSVDEL-----RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 176 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 207 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYEPLSRPLLTYVNNASIRNKMNVA 266

Query: 303 EYVSFSVS 310
            YV F + 
Sbjct: 267 NYVEFMIQ 274


>gi|325982675|ref|YP_004295077.1| phosphate binding protein [Nitrosomonas sp. AL212]
 gi|325532194|gb|ADZ26915.1| phosphate binding protein [Nitrosomonas sp. AL212]
          Length = 332

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 89/317 (28%), Positives = 150/317 (47%), Gaps = 56/317 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           + F   +   F+    Y G  + A   ++I GSST+FP ++ +AE+F     +  T  V 
Sbjct: 5   LNFRAPIAAVFLSALFYTGFAS-ATPIVKIDGSSTVFPITEAVAEDFQ--IAKRGTIRVT 61

Query: 61  SG--GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LL 117
            G  G+  G K+FCR    + IDIVN+SR IT+ E++ CKK G   I E+ I  D + ++
Sbjct: 62  VGISGTGGGFKKFCR----NEIDIVNASRPITELEMEACKKEGAQFI-EMPIAFDALTVV 116

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+ ++  S ++TVE+L K       + +      +  W++I P +P+ +I +Y P    G
Sbjct: 117 VNPKNTWSRTITVEELQK-------IWEPSAQGKITNWNQINPAWPDKKIKLYGPGADSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T                         F+Y  + +     S R D  A E D    + +A 
Sbjct: 170 T-------------------------FEYFTEAIVGKAKSSRGDFTASEDDNVLVQGVAS 204

Query: 238 IEVNKDVF--GFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYV 290
                D++  GF G ++Y  N+  +  V ID    G++PS  T+ +  Y P+SRP+  YV
Sbjct: 205 -----DLYALGFFGFAYYIENSKKINAVAIDSGDGGVLPSAATVENNSYKPLSRPIFIYV 259

Query: 291 KRQHFNSVLGLREYVSF 307
             +       ++E+++F
Sbjct: 260 NAKS-TEKPEVKEFINF 275


>gi|229180549|ref|ZP_04307891.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 172560W]
 gi|228602973|gb|EEK60452.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 172560W]
          Length = 305

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 138/308 (44%), Gaps = 46/308 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K   +   G+
Sbjct: 11  FVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +R   
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 125 WVDDMSVDEL-----RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 176 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 207 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIRNKMNVA 266

Query: 303 EYVSFSVS 310
            YV F + 
Sbjct: 267 NYVEFMIQ 274


>gi|206971230|ref|ZP_03232181.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1134]
 gi|206734002|gb|EDZ51173.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1134]
          Length = 305

 Score =  103 bits (256), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 138/308 (44%), Gaps = 46/308 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K   +   G+
Sbjct: 11  FVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +R   
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 125 WVDDMSVDEL-----RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 176 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 207 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIRNKMNVA 266

Query: 303 EYVSFSVS 310
            YV F + 
Sbjct: 267 NYVEFMIQ 274


>gi|229111745|ref|ZP_04241293.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock1-15]
 gi|229152472|ref|ZP_04280664.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus m1550]
 gi|228631080|gb|EEK87717.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus m1550]
 gi|228671739|gb|EEL27035.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock1-15]
          Length = 305

 Score =  103 bits (256), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 138/308 (44%), Gaps = 46/308 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K   +   G+
Sbjct: 11  FVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +R   
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 125 WVDDMSVDEL-----RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 176 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 207 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVA 266

Query: 303 EYVSFSVS 310
            YV F + 
Sbjct: 267 NYVEFMIQ 274


>gi|170289337|ref|YP_001739575.1| phosphate binding protein [Thermotoga sp. RQ2]
 gi|170176840|gb|ACB09892.1| phosphate binding protein [Thermotoga sp. RQ2]
          Length = 274

 Score =  103 bits (256), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 89/329 (27%), Positives = 147/329 (44%), Gaps = 61/329 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ FFV+L   V + +   T       + I GS+T+FP +++  E F +  P+ +   +E
Sbjct: 1   MKRFFVLLFAMVSVFLVAKT-------LVIKGSNTVFPIAQLWIEEFKKVHPDVQVT-LE 52

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GSS G+     G    T DI NSSR +   E++   K G   I    +G DGI +V +
Sbjct: 53  GAGSSTGIAALFNG----TADIANSSRWLKPEEIERMNKEGKYFIP-FLVGFDGIAIVVN 107

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           + +    +++E L            K+    ++ WS++ P+ P  RIA+Y  +   GT E
Sbjct: 108 KKLGIDDISIETL-----------KKIYTGEIQYWSQVNPNLPRKRIAVYSRNTASGTYE 156

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E KVL  G  R   + +M            V  T +              E +AR   
Sbjct: 157 TFENKVL--GGARMAPYVRM------------VESTQIE------------IENVAR--- 187

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N     +VG+ +  ++  VLK   ++GI P+   I+ G YP++RPL  +V   +    +G
Sbjct: 188 NPYAIAYVGVGYVTDDVKVLK---VNGIYPTKENILKGKYPLARPLFMFVDATNGFPEMG 244

Query: 301 --LREYVSFSVS---DEMMAPDSQLFQYG 324
             + EY+ F+ S    E++     +  YG
Sbjct: 245 SLVFEYIMFAFSKKGQELLEKAGYVAAYG 273


>gi|229047989|ref|ZP_04193565.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH676]
 gi|228723446|gb|EEL74815.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH676]
          Length = 302

 Score =  103 bits (256), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 79/308 (25%), Positives = 138/308 (44%), Gaps = 46/308 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K   +   G+
Sbjct: 8   FVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGT 66

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +R   
Sbjct: 67  GGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNT 121

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 122 WVDDMSVDEL-----RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQ 172

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 173 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 203

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 204 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVA 263

Query: 303 EYVSFSVS 310
            YV F + 
Sbjct: 264 NYVEFMIQ 271


>gi|304407967|ref|ZP_07389617.1| phosphate binding protein [Paenibacillus curdlanolyticus YK9]
 gi|304342986|gb|EFM08830.1| phosphate binding protein [Paenibacillus curdlanolyticus YK9]
          Length = 340

 Score =  102 bits (255), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 78/278 (28%), Positives = 128/278 (46%), Gaps = 50/278 (17%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           +  + I GSST++P ++  AE F +   + +     SG      K FC G       I +
Sbjct: 65  KGEVEIDGSSTVYPLTEAAAEEFGKDNADVRVTVGVSGTGGG-FKRFCNG----ETAISD 119

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLI 142
           +SR I   E   CK  G+ +  ++ + +DG+ +V   D D +   LTVE+L K       
Sbjct: 120 ASRPIKDEEAAACKAKGI-EYTDLQVAYDGLSIVVSKDNDFID-HLTVEELNKIF----- 172

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
               V  + +K W+++R  +P   I +Y P    GT +   +++L++  +R         
Sbjct: 173 ----VTGSTVKTWADVRAGWPAEEIKMYSPGADSGTYDYFNEEILEKKGIR--------- 219

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
               N  Q+S +               D    +  +E +KD  G+ G ++Y+ NAD LKL
Sbjct: 220 ----NDTQISFS--------------EDDNTLVQGVEGSKDAIGYFGFAYYEENADKLKL 261

Query: 263 VPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
           VP+D     I P++ TI  G Y P+SRPL  YV ++  
Sbjct: 262 VPVDAGKGAISPTVETIKDGTYAPLSRPLFIYVNKKEL 299


>gi|332705020|ref|ZP_08425105.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1,
           substrate-binding protein [Lyngbya majuscula 3L]
 gi|332356197|gb|EGJ35652.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1,
           substrate-binding protein [Lyngbya majuscula 3L]
          Length = 313

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/277 (25%), Positives = 128/277 (46%), Gaps = 52/277 (18%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
            R  +RI GSST++P ++ +AE F +         V   G+  G K+FC+G      DI 
Sbjct: 32  GRPTVRIDGSSTVYPITEAVAEEFQDLKKNGVRVTVGISGTGGGFKKFCKG----ETDIS 87

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLI 142
           ++SR I   E   C ++G+ +   + + +D I +V ++   +V+ + VE+L K       
Sbjct: 88  DASRPIKDKEKALCAENGI-EYMAIPVAYDAITVVVNKGNTAVTDIKVEELNK------- 139

Query: 143 VDDKVVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
                ++ P     + KWS++   +P++ + +Y P    GT +   KKV  +      ++
Sbjct: 140 -----IWKPESEGTVTKWSQVNSAWPDLPLVLYGPGADSGTFDYFTKKVNGKSGASRTDY 194

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
           +   D                  D + ++           +E ++    + GLS+Y  N 
Sbjct: 195 TPSED------------------DNVLVQ----------GVETDRRALAYFGLSYYLENQ 226

Query: 258 DVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           D LK V I+G+ PS+ T+ +G Y P+SRP+  YV + 
Sbjct: 227 DKLKAVAINGVTPSLTTVRNGTYTPLSRPIFIYVNKN 263


>gi|229192481|ref|ZP_04319444.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 10876]
 gi|228591058|gb|EEK48914.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 10876]
          Length = 305

 Score =  102 bits (255), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 138/308 (44%), Gaps = 46/308 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K   +   G+
Sbjct: 11  FVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +R   
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            +  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 125 WIDDMSVDEL-----RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 176 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 207 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIRNKMNVA 266

Query: 303 EYVSFSVS 310
            YV F + 
Sbjct: 267 NYVEFMIQ 274


>gi|158333405|ref|YP_001514577.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Acaryochloris marina MBIC11017]
 gi|158303646|gb|ABW25263.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Acaryochloris marina MBIC11017]
          Length = 337

 Score =  102 bits (254), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 82/285 (28%), Positives = 132/285 (46%), Gaps = 50/285 (17%)

Query: 20  TGTFAR--NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
           TGT A    +I I GSST+ P ++ +AE F     + K    +S G+  G K+FC G   
Sbjct: 32  TGTDANLSGKITIDGSSTVLPIAEAMAEEFQAANSDVKITVGKS-GTGGGFKKFCAG--- 87

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKA 136
              +I N+SR I Q E+D C +  +  I E+ + +D + +V ++D   +  +TV++L  A
Sbjct: 88  -ETEISNASRPIKQKEIDLCAEKNIEYI-EIPVAYDALSVVVNKDNDWAECMTVDELKTA 145

Query: 137 LASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
            A       K     + KW+++   +P+  + +Y P    GT +   + +  E   R  +
Sbjct: 146 WA-------KGAQGKISKWNQVNSKYPDAPLTLYGPGTDSGTFDYFNEAITDEEGSRG-D 197

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
           F+                 TS   + I   V GD           K+  G+ G S+Y+ N
Sbjct: 198 FA-----------------TSEDDNTIVRGVAGD-----------KNAMGYFGYSYYEEN 229

Query: 257 ADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
            D L+ V IDG    I PS  T++ G Y P++RPL  YV +   +
Sbjct: 230 KDSLRAVQIDGGDGCITPSDATVLDGTYSPLARPLFIYVSKTAMD 274


>gi|254421495|ref|ZP_05035213.1| Bacterial extracellular solute-binding protein, putative
           [Synechococcus sp. PCC 7335]
 gi|196188984|gb|EDX83948.1| Bacterial extracellular solute-binding protein, putative
           [Synechococcus sp. PCC 7335]
          Length = 343

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 93/333 (27%), Positives = 154/333 (46%), Gaps = 63/333 (18%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            I+I GSST+FP S+ +AE F    P+ +     S GS  G K+FC G      DI N+S
Sbjct: 57  EIQIDGSSTVFPISEAMAEEFQIANPDTRVTVGVS-GSGGGFKKFCAG----ETDISNAS 111

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSD-RDMVSVSLTVEDLYKALASYLIVDD 145
           R I + E+  C + G+  I EV I +DGI LV++  +  +  LTVE L            
Sbjct: 112 RPIKEEEVALCDEAGIEFI-EVPIAYDGITLVTNPENDWAQCLTVEQL------------ 158

Query: 146 KVVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
             +++P     ++ W+++ P+FP+  + ++ P    GT                      
Sbjct: 159 NAMWSPDAEGSVENWNQVDPEFPDEPLELFGPGTDSGT---------------------- 196

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
              F Y   ++S    + R D  A E D      +  +E      G+ G ++Y+ N D L
Sbjct: 197 ---FDYFTDEVSGEEGASRGDYTASEDD---NVIVTGVESTSGGLGYFGYAYYEENQDQL 250

Query: 261 KLVPIDG-----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           K V I+      + PS  TI  G Y P+SRPL FYV+++ +++   ++ +V +    ++ 
Sbjct: 251 KSVEIENEAGECVAPSRETIADGSYNPMSRPLYFYVQKEAYDTKPQVKAFVDY----QLD 306

Query: 315 APDSQLFQ-YGLIPISNEERKSVRDSIAVGKSG 346
           A + +L Q  G I + ++     +  +  GK G
Sbjct: 307 AENGELVQEAGYITLPDDALAQAKSRVEEGKLG 339


>gi|126660068|ref|ZP_01731189.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Cyanothece sp. CCY0110]
 gi|126618665|gb|EAZ89413.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Cyanothece sp. CCY0110]
          Length = 312

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/285 (23%), Positives = 125/285 (43%), Gaps = 37/285 (12%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
            R  I+I GSST++P ++ +AE F           V   G+  G K+FC        DI 
Sbjct: 32  GRQVIKIDGSSTVYPITEAVAEEFQNKKRGAVQVTVGISGTGGGFKKFCSDNEAVKTDIS 91

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I  +E + C K GV+   E+ + +D I +V  +D     +T  +L K        
Sbjct: 92  NASRPIKDSEKEMCAKAGVT-FMEIPVAYDAITVVVSQDNPLTDITTAELKKMW------ 144

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            +    N + KW+++  ++P+  + +Y P    GT +    +V+ +      +++   D 
Sbjct: 145 -EPAATNKITKWNQVNSNWPDATLKLYGPGADSGTFDYFTDEVIGKSGESRTDYTPSED- 202

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                            D + ++           +  +K    + G ++Y+ N + LK +
Sbjct: 203 -----------------DNVLVQ----------GVANDKQALAYFGYTYYEENKNKLKAL 235

Query: 264 PIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
            +DG+ PS  T+  G Y P++RP+  YV      +   ++E+V +
Sbjct: 236 KVDGVAPSSKTVSDGTYTPLARPIFIYVNLDAVKNNSAVKEFVEY 280


>gi|218440272|ref|YP_002378601.1| phosphate binding protein [Cyanothece sp. PCC 7424]
 gi|218173000|gb|ACK71733.1| phosphate binding protein [Cyanothece sp. PCC 7424]
          Length = 349

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 137/298 (45%), Gaps = 46/298 (15%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           V C +       I+I GSST++P ++ + E F     +     +E  G++ G ++FC G 
Sbjct: 26  VSCASVPEESQDIKIDGSSTVYPITEKVVEEFKTNRKQDTNISLEVSGTTGGFRQFCEG- 84

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLY 134
                DI N+SR I   E+  C ++GVS I E+ +  D + ++V+  +  + +LT ++L 
Sbjct: 85  ---KTDINNASRPILAEEMALCSRNGVSYI-ELPVAFDALTVVVNPNNTWAKTLTTQELK 140

Query: 135 KALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
           K         +      + +W++IR +FP+  + ++    K GT                
Sbjct: 141 KMW-------EPAAEGKISRWNQIRAEFPDRPLNLFGAGSKSGT---------------- 177

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
                    F Y  + +  A  + RQD +A E D    + +++   + D  G+ GLS+Y+
Sbjct: 178 ---------FGYFNEAIVGAEDASRQDYVATEDDNIIVQGVSQ---DPDALGYFGLSYYE 225

Query: 255 NNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
            N + LK V ID     I P+   +    Y P++RPL  YV  +       LR++++F
Sbjct: 226 ANQNKLKAVEIDSGKGAIAPTREAVAKAQYQPLARPLFIYVNLKASQEKEDLRQFITF 283


>gi|218905408|ref|YP_002453242.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH820]
 gi|218537349|gb|ACK89747.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH820]
          Length = 305

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 80/311 (25%), Positives = 143/311 (45%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGT-FARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           F++  CF     Y GT T FA N    +R+ GSST+ P  + +AE +++  P  K   + 
Sbjct: 11  FILSTCFF----YVGTSTAFAVNEMGEVRVDGSSTVXPIIEAVAEEYTKVHPNVKIS-IS 65

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G   F +G     +DI N+SR + Q E +E K++ +       + +DG+ +V +
Sbjct: 66  VSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKRNSI-QFTPFEVAYDGLTIVVN 120

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           R    V ++TV++L       L  +D+      K+WS+I   +P  ++  Y P    GT 
Sbjct: 121 RQNTWVDNMTVDEL-----RLLWSEDE----SEKRWSQIHSSWPREQVKFYAPGVDSGTY 171

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  +  +LQ+  +                    V   S+ +D   I         +  + 
Sbjct: 172 DYFQNVILQKSRI--------------------VKKVSLSEDDQVI---------MQGVM 202

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV      + 
Sbjct: 203 NDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNK 262

Query: 299 LGLREYVSFSV 309
           + +  Y+ F +
Sbjct: 263 MNVANYIEFMI 273


>gi|218295963|ref|ZP_03496743.1| phosphate binding protein [Thermus aquaticus Y51MC23]
 gi|218243701|gb|EED10229.1| phosphate binding protein [Thermus aquaticus Y51MC23]
          Length = 323

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 131/273 (47%), Gaps = 55/273 (20%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           +IR  GSST++P ++ +AE F++  P  K   V   G+  G K+FCRG      DI N+S
Sbjct: 21  QIRADGSSTVYPITQAVAEEFTQRNPGVKVA-VAFSGTGGGFKKFCRG----ETDIQNAS 75

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           R I + EL+EC+K+G+  I E+ I +D + ++V+ R+  +  L   ++            
Sbjct: 76  RPIKKAELEECEKNGIKFI-EIPIAYDALSIIVNPRNTWATCLKTSEV------------ 122

Query: 146 KVVFNPLKK---WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           + ++ P  K   WS++R ++P+ RI ++      GT                        
Sbjct: 123 RAIWEPNSKVQFWSDVRKEWPKARIVLFGAGTDSGT------------------------ 158

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
            F Y  + +     ++R+D    E   D   T+  +       GF+G+++ + N D +K 
Sbjct: 159 -FDYFTEAIMGKSGAIRKDYQPTE---DDNVTIRGVAAGLYAMGFLGVAYVEENKDKVKP 214

Query: 263 VPIDG----IVPSMGTIVSGLY-PISRPLLFYV 290
           V ID     ++P+   +++G Y P+SRPL  YV
Sbjct: 215 VAIDNGRGCVLPTRENVLNGSYQPLSRPLFIYV 247


>gi|75906270|ref|YP_320566.1| phosphate binding protein [Anabaena variabilis ATCC 29413]
 gi|75699995|gb|ABA19671.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Anabaena variabilis ATCC 29413]
          Length = 333

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 80/337 (23%), Positives = 155/337 (45%), Gaps = 53/337 (15%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
           C +G   ++++ I G++  FP S  +AE + +   + K   V S G+  G  +FC G   
Sbjct: 26  CNSGQELKSQVSIDGAAVGFPISLAVAEEYQKVKADAKVS-VASSGTGGGFSKFCNG--- 81

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD-RDMVSVSLTVEDLYKA 136
             IDIV +SR I   E+ +CK   + +  E+ IG DG+ ++++ ++  +  LT++++   
Sbjct: 82  -DIDIVGASRTIRNEEIAKCKSKNI-EFVELPIGLDGVAVIANPKNKFAQCLTIKEMNTI 139

Query: 137 LASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
            ++    D K++      W+++ P FP++ + +Y P+   GT + L + V  +      +
Sbjct: 140 WSAK--SDGKIL-----TWNQVNPKFPKLPLKLYAPASDTGTFDYLTQAVTGKAKNGRTD 192

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
           ++                  S  Q+ +   V GD           +   G+VG+S+Y  N
Sbjct: 193 YT-----------------PSHNQNLLVQGVSGD-----------ESALGYVGISYYIQN 224

Query: 257 ADVLKLVPIDGI-------VPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSV 309
            + L LV I+ +       VP    + +   P+SRPL  YV +   ++   ++E+V F +
Sbjct: 225 QEKLNLVAIENLKGECKKPVPLDNVLKNTYTPLSRPLFIYVSKISLDNKPVVKEFVDFYL 284

Query: 310 SDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            +     D      G + + +E    V+   A G++G
Sbjct: 285 ENSWKWVDGA----GYVALPDEAYVKVKQKFAAGETG 317


>gi|148239564|ref|YP_001224951.1| ABC transporter, substrate binding protein, phosphate
           [Synechococcus sp. WH 7803]
 gi|147848103|emb|CAK23654.1| ABC transporter, substrate binding protein, phosphate
           [Synechococcus sp. WH 7803]
          Length = 339

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 83/314 (26%), Positives = 143/314 (45%), Gaps = 52/314 (16%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF-VE 60
           R FF  L    ++  +  T + A   + IAGSST++P + +  + F+E          + 
Sbjct: 5   RSFF--LASLALIAPFISTASAAS--LSIAGSSTVYPVTSLAIKKFNETGQGQNVKISLR 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GSS G +EFC     + I + N+SR I+  E+ +CK++GV+ I E+ I  D I +V++
Sbjct: 61  STGSSAGFREFC----SNKIPLTNASRPISAQEIKQCKQNGVNFI-ELPIAFDAITVVAN 115

Query: 121 RDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           +    + +LT  +L +  +       K     +  W+++  DFPE  I +  P    GT 
Sbjct: 116 QSNNWLNTLTPSELSRLWS-------KSSQGKVSTWNQVNLDFPEQPIKLCGPGKDSGTF 168

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           ++  K + Q                           T+ R D  + E D      +A+  
Sbjct: 169 DIFNKAINQSK-------------------------TNSRTDYKSSEDDNVIVNCVAK-- 201

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
            N +  G+ G S+Y+NN  +LK + I     + I+PS+  +   +Y P+SRPL  Y+   
Sbjct: 202 -NVNALGYFGFSYYQNNRSLLKAIRIVNPKGNAILPSVTAVQKEIYQPLSRPLFLYINDL 260

Query: 294 HFNSVLGLREYVSF 307
                  LR +++F
Sbjct: 261 SLRKKTPLRNFITF 274


>gi|229198399|ref|ZP_04325105.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus m1293]
 gi|228585099|gb|EEK43211.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus m1293]
          Length = 278

 Score =  100 bits (250), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 133/284 (46%), Gaps = 46/284 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+SR
Sbjct: 7   VRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNASR 61

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146
            + Q E +E KK+ +       + +DG+ +V +R    V ++TV++L       L  +D+
Sbjct: 62  VMKQVEENEMKKNSIQ-FTPFEVAYDGLTIVVNRQNTWVDNMTVDEL-----RLLWSEDE 115

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +              
Sbjct: 116 ----SEKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRI-------------- 157

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                 V   S+ +D   I         +  +  +K+  GFVG ++Y  N D ++ + ++
Sbjct: 158 ------VKKVSLSEDDQVI---------MQGVMNDKNAIGFVGYAYYMANRDKVRAIKVN 202

Query: 267 GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           G++P+  TI SG Y P+SR L  YV      + + +  Y+ F +
Sbjct: 203 GVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNKMNVANYIEFMI 246


>gi|229141008|ref|ZP_04269551.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST26]
 gi|228642441|gb|EEK98729.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST26]
          Length = 278

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 73/284 (25%), Positives = 133/284 (46%), Gaps = 46/284 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+SR
Sbjct: 7   VRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNASR 61

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146
            + Q E +E KK+ +       + +DG+ +V +R    V ++TV++L       L  +D+
Sbjct: 62  VMKQVEENEMKKNSIQ-FTPFEVAYDGLTIVVNRQNTWVDNMTVDEL-----RLLWSEDE 115

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +              
Sbjct: 116 ----SEKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRI-------------- 157

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                 V   S+ +D   I         +  +  +K+  GFVG ++Y  N D ++ + ++
Sbjct: 158 ------VKKVSLSEDDQVI---------MQGVMNDKNAIGFVGYAYYMANRDKVRAIKVN 202

Query: 267 GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           G++P+  TI SG Y P+SR L  YV      + + +  Y+ F +
Sbjct: 203 GVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNKMNVASYIEFMI 246


>gi|15644020|ref|NP_229069.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermotoga maritima MSB8]
 gi|4981819|gb|AAD36338.1|AE001781_9 phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermotoga maritima MSB8]
          Length = 274

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 132/285 (46%), Gaps = 51/285 (17%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           I GS+T+FP +++  E F +  P+ +   +E  GSS G+     G    T DI NSSR +
Sbjct: 23  IKGSNTVFPIAQLWIEEFKKLHPDLQVT-LEGAGSSTGIAALFNG----TTDIANSSRWL 77

Query: 90  TQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVF 149
             +E++   K G   I    I  DGI ++ ++D+    +++E L            K+  
Sbjct: 78  KPSEIERMNKEGKYFI-PFLIAFDGIAIIVNKDLGIDDISIETL-----------KKIYT 125

Query: 150 NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQ 209
             ++ WS++ P+ P+ RI +Y  +   GT E  E KVL  G  R   + +M       V+
Sbjct: 126 GEIQYWSQVNPNLPKQRIVVYSRNTASGTYETFENKVL--GGARMAPYVRM-------VE 176

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV 269
              +   SV ++  AI                     +VG+ +  ++  VLK   ++GI 
Sbjct: 177 STQLEVESVSKNPYAI--------------------AYVGVGYVTDDVKVLK---VNGIY 213

Query: 270 PSMGTIVSGLYPISRPLLFYVKRQHFNSVLG--LREYVSFSVSDE 312
           P+   I+ G YPI+RPL  +V   +    +G  + EY+ F+ S +
Sbjct: 214 PTKENILKGKYPIARPLFMFVDATNGFPEMGSLVFEYIMFAFSKK 258


>gi|302388937|ref|YP_003824758.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Thermosediminibacter oceani DSM 16646]
 gi|302199565|gb|ADL07135.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Thermosediminibacter oceani DSM 16646]
          Length = 318

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 90/323 (27%), Positives = 149/323 (46%), Gaps = 69/323 (21%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNR---------IRIAGSSTLFPYSKIIAENFSEYFPEF 54
            F + +  V++   CG     RN+         I I GSST++P ++ +AE F   +P+ 
Sbjct: 16  LFTLSLAAVLVVTACGASN--RNQGGQANLSGSIEIDGSSTVYPITEAVAEEFMNTYPDV 73

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
               V   G+  G K F  G      DI N+SR I+  E  + K+ GV  I E+ + +DG
Sbjct: 74  NI-TVGVSGTGGGFKRFTAG----ETDISNASRPISDEEAAKAKESGVEYI-ELPVAYDG 127

Query: 115 ILLVSDRDMVSVS-LTVEDLYKALASYLIVDDKVVFNP---LKKWSEIRPDFPEVRIAIY 170
           I +V +++   V  LTVE+L K            +++P   + KWS+IRP +P+ +I +Y
Sbjct: 128 ITVVVNKENDWVDHLTVEELKK------------IWSPGSKVTKWSDIRPGWPDEKINLY 175

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE-VDG 229
            P    GT E   + V  E      +++   D                  D + ++ V G
Sbjct: 176 GPGTDSGTFEYFTEAVNGEAKKSRSDYTASED------------------DNVLVQGVSG 217

Query: 230 DYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISR 284
           D           +   G+ G ++Y  N+D +K VPIDG    + P+  +I +G Y P++R
Sbjct: 218 D-----------RYALGYFGFAYYLENSDKVKAVPIDGGSGPVEPTAESIKNGTYKPLAR 266

Query: 285 PLLFYVKRQHFNSVLGLREYVSF 307
           P+  YV ++       ++E+V F
Sbjct: 267 PIFIYVNKKSLERPE-VKEFVKF 288


>gi|148270631|ref|YP_001245091.1| phosphate binding protein [Thermotoga petrophila RKU-1]
 gi|281412941|ref|YP_003347020.1| phosphate binding protein [Thermotoga naphthophila RKU-10]
 gi|147736175|gb|ABQ47515.1| phosphate binding protein [Thermotoga petrophila RKU-1]
 gi|281374044|gb|ADA67606.1| phosphate binding protein [Thermotoga naphthophila RKU-10]
          Length = 274

 Score =  100 bits (249), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/285 (27%), Positives = 132/285 (46%), Gaps = 51/285 (17%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           I GS+T+FP +++  E F +  P+ +   +E  GSS G+     G    T DI NSSR +
Sbjct: 23  IKGSNTVFPIAQLWIEEFKKLHPDLQVT-LEGAGSSTGIAALFNG----TTDIANSSRWL 77

Query: 90  TQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVF 149
             +E++   K G   I    I  DGI ++ ++D+    +++E L            K+  
Sbjct: 78  KPSEIERMNKEGKYFI-PFLIAFDGIAIIVNKDLGIDDISIETL-----------KKIYT 125

Query: 150 NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQ 209
             ++ WS++ P+ P+ RI +Y  +   GT E  E KVL  G  R   + +M       V+
Sbjct: 126 GEIQYWSQVNPNLPKQRIVVYSRNTASGTYETFENKVL--GGARMAPYVRM-------VE 176

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV 269
              +   SV ++  AI                     +VG+ +  ++  VLK   ++GI 
Sbjct: 177 STQLEIESVSKNPYAI--------------------AYVGVGYVTDDVKVLK---VNGIY 213

Query: 270 PSMGTIVSGLYPISRPLLFYVKRQHFNSVLG--LREYVSFSVSDE 312
           P+   I+ G YPI+RPL  +V   +    +G  + EY+ F+ S +
Sbjct: 214 PTKENILKGKYPIARPLFMFVDATNGFPEMGSLVFEYIMFAFSKK 258


>gi|148242465|ref|YP_001227622.1| ABC-type phosphate transport system, substrate binding protein
           [Synechococcus sp. RCC307]
 gi|147850775|emb|CAK28269.1| ABC-type phosphate transport system, substrate binding protein
           [Synechococcus sp. RCC307]
          Length = 352

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 91/345 (26%), Positives = 157/345 (45%), Gaps = 59/345 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTF---ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFK-- 55
           +R    +L   V L    G G     A   I I GSST+ P + +  + F       K  
Sbjct: 8   LRAVSGMLAVGVGLLTASGAGGLKAQATAPILITGSSTVGPITTLAIQGFRSTAAGRKVR 67

Query: 56  -TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
            +P VESG +S G ++FC G       I N+SR I+Q EL  C   G+    E+ I  D 
Sbjct: 68  FSPVVESG-TSAGFRDFCSG----KTPISNASRPISQKELKRCADQGI-KFFELPIAFDA 121

Query: 115 I-LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPS 173
           I ++V+  +  + S++V +L +  +       +     +K+W+++  D+PE  IA+Y P 
Sbjct: 122 ITVVVNPANTWAKSISVAELRRLWS-------RSAQGTIKRWNQVSLDWPEKPIALYGPG 174

Query: 174 GKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTE 233
              GT +   + +         N SK RD                R D ++ E D    +
Sbjct: 175 ADSGTFDTFNQAI---------NGSK-RDS---------------RSDYVSSENDNVLVQ 209

Query: 234 TLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLF 288
            +A    N +  G+ G ++Y  N + L+ +P++     ++PS+ T+ +G Y P+SRP+  
Sbjct: 210 GVAS---NSNALGYFGYAYYAANRNKLRALPVESDQGPVMPSLETVQNGSYSPLSRPVFI 266

Query: 289 YVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY-GLIPISNEE 332
           YV  +       LR +V + +++      +QL +  G IP++  +
Sbjct: 267 YVNAKSLKDSASLRAFVQYYLNNA-----TQLVEKEGSIPLTKAQ 306


>gi|228910105|ref|ZP_04073925.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis IBL 200]
 gi|228849622|gb|EEM94456.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis IBL 200]
          Length = 305

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 137/308 (44%), Gaps = 46/308 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K   +   G+
Sbjct: 11  FVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +    
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNWHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 125 WVDDMSVDEL-----RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 176 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 207 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVA 266

Query: 303 EYVSFSVS 310
            YV F + 
Sbjct: 267 NYVEFMIQ 274


>gi|218899438|ref|YP_002447849.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus G9842]
 gi|218542847|gb|ACK95241.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus G9842]
          Length = 305

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 137/308 (44%), Gaps = 46/308 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K   +   G+
Sbjct: 11  FVLSIWFLCFEMSTAFALNNTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +    
Sbjct: 70  GGGFNRFGKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNWHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 125 WVDDMSVDEL-----RLLWSED----GSEKRWSQIHSTWPREQVNFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 176 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 207 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVA 266

Query: 303 EYVSFSVS 310
            YV F + 
Sbjct: 267 NYVEFMIQ 274


>gi|172036078|ref|YP_001802579.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
 gi|171697532|gb|ACB50513.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
          Length = 312

 Score =  100 bits (248), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 74/285 (25%), Positives = 119/285 (41%), Gaps = 37/285 (12%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
            R  I+I GSST++P ++ +AE F           V   G+  G K+FC        DI 
Sbjct: 32  GRAVIKIDGSSTVYPITEAVAEEFQNKKRGAVQVTVGISGTGGGFKKFCSDNEAVKTDIS 91

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I  +E   C   GV    E+ + +D I +V  +D     +T  +L K        
Sbjct: 92  NASRPIKDSEKKMCADAGVK-YMEIPVAYDAITVVVSKDNPLTDITTAELKKMW------ 144

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            +    N + KW+++   +P+V + +Y P    GT                         
Sbjct: 145 -EPAATNKITKWNQVNSSWPDVPLKLYGPGADSGT------------------------- 178

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           F Y   ++       R D    E D    + +A    +K    + G ++Y+ N + LK +
Sbjct: 179 FDYFTDEVIGNSGDSRTDYTPSEDDNVLVQGVAN---DKQALAYFGYTYYEENKNKLKAL 235

Query: 264 PIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
            IDG+ PS  T+  G Y P+SRP+  YV      S   ++E+V +
Sbjct: 236 KIDGVAPSSQTVSDGTYTPLSRPIFIYVNLDAVKSNSAVKEFVEY 280


>gi|163942031|ref|YP_001646915.1| phosphate binding protein [Bacillus weihenstephanensis KBAB4]
 gi|163864228|gb|ABY45287.1| phosphate binding protein [Bacillus weihenstephanensis KBAB4]
          Length = 302

 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 75/302 (24%), Positives = 133/302 (44%), Gaps = 46/302 (15%)

Query: 10  CFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLK 69
           CF+   +     T     +R+ GSST+FP  + +AE +++  P  K   +   G+  G  
Sbjct: 13  CFLCFNMSTAFATNEMGEVRVDGSSTVFPIIEAVAEEYTKAHPNVKIS-ISISGTGGGFN 71

Query: 70  EFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SL 128
            F +G     +DI N+SR +   E +  +K+ +       + +DG+ +V +R    V ++
Sbjct: 72  RFSKG----EVDINNASRLMKPVEENAMQKNSI-QFTPFEVAYDGLTIVVNRQNTWVNNM 126

Query: 129 TVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQ 188
           T+++L       L+  +      LK+WS+I   +   ++  Y P    GT +  +  VLQ
Sbjct: 127 TIDEL------RLLWSEN---GRLKRWSQIHSSWSREQVKFYAPGVDSGTYDYFQNVVLQ 177

Query: 189 EGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFV 248
              +                    V   S+ +D   I         +  +  +K+   FV
Sbjct: 178 NNRL--------------------VKTVSLSEDDQVI---------MQGVMNDKNAIAFV 208

Query: 249 GLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
           G ++Y  N D +K + +DG+ P+  TI SG Y P+SRPL  YV      + + +  YV F
Sbjct: 209 GYAYYMANRDKVKAIQVDGVFPTKETIQSGTYKPLSRPLFTYVNHASIRNKINVANYVEF 268

Query: 308 SV 309
            +
Sbjct: 269 MI 270


>gi|218231613|ref|YP_002369079.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus B4264]
 gi|218159570|gb|ACK59562.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus B4264]
          Length = 305

 Score =  100 bits (248), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 78/308 (25%), Positives = 137/308 (44%), Gaps = 46/308 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           FV+ + F+  E+           +R+ GSST+FP  + +AE +++   + K   +   G+
Sbjct: 11  FVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHADVKIS-ISISGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E KK+ +       + +DG+ +V +R   
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V  ++V++L       L  +D       K+WS+I   +P  ++  Y P    GT +  +
Sbjct: 125 WVDDMSVDEL-----RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K 
Sbjct: 176 NVILQNHRI--------------------VKKVSLSEDDQVI---------MQGVMNDKH 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + + 
Sbjct: 207 AIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVA 266

Query: 303 EYVSFSVS 310
            YV F + 
Sbjct: 267 NYVEFMIQ 274


>gi|257093591|ref|YP_003167232.1| phosphate-binding protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257046115|gb|ACV35303.1| phosphate binding protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 342

 Score = 99.8 bits (247), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 76/290 (26%), Positives = 131/290 (45%), Gaps = 47/290 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           ++I GSST++P ++ +A+ F           V   G+S G  +FCRG      DI ++SR
Sbjct: 36  VKIDGSSTVYPIAEAMAQEFQRARLHEVHVNVGVSGTSGGFAKFCRG----ETDIASASR 91

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I + E++ C K GV    E+ + +D + ++V+ ++    SL+V +L K       + + 
Sbjct: 92  PILKKEMEACAKAGVR-YYEMPLAYDALTVVVNPQNSFVSSLSVAELRK-------LWEP 143

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W ++ P +P  +I +Y P    GT                         F+Y
Sbjct: 144 RAQGKITTWRDLNPAWPPQKIKLYAPGADSGT-------------------------FEY 178

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI- 265
             + +     + R D    E   D+   +  I  +KD  G+V L +Y  N   LK V I 
Sbjct: 179 FTEVVVGTAKASRADATTAE---DHAVLVQGIAADKDALGYVALDYYVENQQKLKAVAIG 235

Query: 266 ---DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
              D ++P++  I SG Y P+SRP+  YV  +       +R++V FS+ +
Sbjct: 236 DGKDAVLPTIANIRSGGYQPLSRPIFLYVSEKSIEKP-AVRQFVDFSMKN 284


>gi|292656502|ref|YP_003536399.1| putative phosphate ABC transporter periplasmic substrate-binding
           protein [Haloferax volcanii DS2]
 gi|291372133|gb|ADE04360.1| ABC-type transport system periplasmic substrate-binding protein
           (probable substrate phosphate) [Haloferax volcanii DS2]
          Length = 345

 Score = 99.8 bits (247), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 81/325 (24%), Positives = 146/325 (44%), Gaps = 59/325 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I IAGSST+FP +  +AE F     E       +G        FC G      D  N+SR
Sbjct: 60  IDIAGSSTVFPLATAMAERFQTEHSEVNINLQSTGSGGGFANYFCTG----QTDFNNASR 115

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDD 145
            I   E D+C+ + V+ + E+ +  D + ++  +D D +   LTVE L    ++      
Sbjct: 116 PIKGEEQDQCESNDVTPV-ELKVATDALTVIVNNDNDFLGEGLTVEQLQTIFSAE----- 169

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE-VLEKKVLQEGCVRSRNFSKMRDMF 204
               +    WS++  ++P+  I IY P+   GT +  +E  + +EG    +++S      
Sbjct: 170 ----STPTTWSDVNSEWPDEEIEIYGPTNASGTYDYFIEAIIGEEGPGHRQDYS------ 219

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                       +  QD   I+           +E ++   G++G ++Y  N D ++ VP
Sbjct: 220 ------------ATEQDRTIIQ----------GVEGSEYAIGYLGFAYYSENTDAVQAVP 257

Query: 265 IDG-----IVPSMGTIVSGLY-PISRPLLFYVKRQHF---NSVLGLREYVSFSVSDEMMA 315
           I+      + PS+ T +SG Y P+SRPL  Y  R+     +     R ++  S S E++A
Sbjct: 258 IENDAGEFVEPSLDTALSGEYNPLSRPLFTYPARESLAEEHVAEFARYWIENSTSREIVA 317

Query: 316 PDSQLFQYGLIPISNEERKSVRDSI 340
                 + G +P+  ++++ + D++
Sbjct: 318 D-----EVGYVPLDEDDQQEMLDTL 337


>gi|217076257|ref|YP_002333973.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermosipho africanus TCF52B]
 gi|217036110|gb|ACJ74632.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermosipho africanus TCF52B]
          Length = 273

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 88/320 (27%), Positives = 154/320 (48%), Gaps = 71/320 (22%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR  FV+   F +L V+     F+R  + I GS+T+FP +++  E   + +P+ +   +E
Sbjct: 1   MRKIFVI---FAILLVFFA---FSRTLV-IKGSNTIFPVAQLWIEELKKMYPDMEIT-LE 52

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDEC---KKHGVSDIQEVTIGHDGILL 117
             GSS G+      + ++T DI NSSR + ++E+++    KK+ V     + +G+DGI +
Sbjct: 53  GAGSSTGIA----ALFNETADIANSSRWLKESEIEKMHSMKKYFVP----IIVGYDGIAV 104

Query: 118 VSDRDM----VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPS 173
           + ++++    +S+  T++D+Y     Y              WS++ P+ P+ +I IY  +
Sbjct: 105 IVNKNLGIENISID-TLKDIYTGKIRY--------------WSQVDPNLPKKQIVIYSRN 149

Query: 174 GKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTE 233
              GT E  E KVL        N  KM    +  V+       SV+ +  AI        
Sbjct: 150 TASGTFETFENKVL--------NKEKMAPWVRM-VESTQFEIESVKNNPYAI-------- 192

Query: 234 TLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
                        + G+ +   +  VLK   +DG++P+   I+ G YPISRPL  +V   
Sbjct: 193 ------------AYTGIGYVTEDVKVLK---VDGVLPTKRNILEGTYPISRPLYMFVDAS 237

Query: 294 HFNSVLGL-REYVSFSVSDE 312
           +   V  L ++YV+F+VS +
Sbjct: 238 NGYLVDDLIKKYVNFAVSKK 257


>gi|228941436|ref|ZP_04103987.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228974367|ref|ZP_04134936.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228980960|ref|ZP_04141263.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis Bt407]
 gi|228778751|gb|EEM27015.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis Bt407]
 gi|228785417|gb|EEM33427.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228818217|gb|EEM64291.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|326942054|gb|AEA17950.1| phosphate-binding protein [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 284

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 78/294 (26%), Positives = 133/294 (45%), Gaps = 49/294 (16%)

Query: 22  TFARN---RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
            FA N    +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G    
Sbjct: 4   AFALNDMGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISVSGTGGGFNRFSKG---- 58

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKAL 137
            +DI N+SR + Q E +E KK+ +       + +DG+ +V +R    V  ++V++L    
Sbjct: 59  EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNTWVDDMSVDEL---- 113

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
              L  +D       K+WS+I   +P  ++  Y P    GT +  +  +LQ   +     
Sbjct: 114 -RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQNVILQNHRI----- 163

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
                          V   S+ +D   I         +  +  +K    FVG ++Y  N 
Sbjct: 164 ---------------VKKVSLSEDDQVI---------MQGVMNDKHAIAFVGYAYYMANR 199

Query: 258 DVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVS 310
           D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + +  YV F + 
Sbjct: 200 DKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVANYVEFMIQ 253


>gi|229081530|ref|ZP_04214029.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock4-2]
 gi|228701837|gb|EEL54324.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock4-2]
          Length = 284

 Score = 99.4 bits (246), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/288 (26%), Positives = 131/288 (45%), Gaps = 46/288 (15%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           +  +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G     +DI N
Sbjct: 10  KGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGTGGGFNRFSKG----EVDINN 64

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIV 143
           +SR + Q E +E KK+ +       + +DG+ +V +R    V  ++V++L       L  
Sbjct: 65  ASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNTWVDDMSVDEL-----RLLWS 118

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           +D       K+WS+I   +P  ++  Y P    GT +  +  +LQ   +           
Sbjct: 119 ED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQNVILQNHRI----------- 163

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                    V   S+ +D   I         +  +  +K    FVG ++Y  N D +K +
Sbjct: 164 ---------VKKVSLSEDDQVI---------MQGVMNDKHAIAFVGYAYYMANRDKVKAI 205

Query: 264 PIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVS 310
            ++G+ P+  TI SG Y P+SRPLL YV      + + +  YV F + 
Sbjct: 206 KVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIRNKMNVANYVEFMIQ 253


>gi|55980228|ref|YP_143525.1| phosphate ABC transporter periplasmid phosphate-biniding protein
           [Thermus thermophilus HB8]
 gi|55771641|dbj|BAD70082.1| phosphate ABC transporter, periplasmid phosphate-biniding protein
           [Thermus thermophilus HB8]
          Length = 322

 Score = 99.4 bits (246), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 76/273 (27%), Positives = 125/273 (45%), Gaps = 55/273 (20%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           +IR  GSST++P ++ +AE F    P+ +   V   G+  G ++FCRG      D+ N+S
Sbjct: 20  QIRADGSSTVYPITQAVAEEFVTRNPQVRIS-VAFSGTGAGFQKFCRG----ETDVQNAS 74

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           R I ++EL+ C+K G+  I E+ + +D + +LV+ ++  +  LT   L            
Sbjct: 75  RPIRKSELEACQKAGIQFI-EIPVAYDALSILVNRQNTWAQCLTTAQL------------ 121

Query: 146 KVVFNPLKK---WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           K ++ P  K   W ++ P +P  RI ++      GT                        
Sbjct: 122 KSIWEPNAKVNYWKDLNPAWPNRRIVLFGAGTDSGT------------------------ 157

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
            F Y  + +     S+R+D    E D      +  +  N     FVG ++Y+ N D +K 
Sbjct: 158 -FDYFTEAIMGRAGSIRKDYFPSEDD---NVIMRGVTGNPYAMAFVGFAYYEENKDKVKA 213

Query: 263 VPIDG----IVPSMGTIVSGLY-PISRPLLFYV 290
           V ID     ++PS  T++ G Y P+SRPL  YV
Sbjct: 214 VAIDHGKGCVLPSRETVLDGTYQPLSRPLFIYV 246


>gi|110640183|ref|YP_680393.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Cytophaga hutchinsonii ATCC 33406]
 gi|110282864|gb|ABG61050.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Cytophaga hutchinsonii ATCC 33406]
          Length = 340

 Score = 99.4 bits (246), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 91/368 (24%), Positives = 165/368 (44%), Gaps = 76/368 (20%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARN-------RIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           +  F+V +   +    CG G    N        I++ GSST+FP S+ ++E F     E 
Sbjct: 3   KLIFIVFVAAFLSS--CGGGAKTENAGASEKTSIKVDGSSTVFPISEAVSEEF-----EI 55

Query: 55  KTPFVE----SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
           + P V+    + G+  G K+F R    + ID+  +SR I  +E  +C  + +  + E+ I
Sbjct: 56  ENPTVQITANASGTGAGFKKFIR----NEIDVTGASRPIKASEDKDCAANNIQYL-EIPI 110

Query: 111 GHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI 169
            +DG+ ++VS  +  + +LTV +L K       + +      +  W ++R  +P  +I +
Sbjct: 111 AYDGLAIVVSKENTWADNLTVAELKK-------IWEPAAKGTITHWDQVRAGWPHEKINL 163

Query: 170 YVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDG 229
           Y    + GT                         F Y  + +     S R D  A E D 
Sbjct: 164 YGAGTESGT-------------------------FDYFTEAIVGEARSCRTDYTASEDDN 198

Query: 230 DYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID---------GIVPSMGTIVSGLY 280
                +A    +K   G+ G +++  N D LKLV ID          ++P++ TIV+G Y
Sbjct: 199 GLVSGVAG---DKYSLGYFGYAYFFENQDKLKLVAIDDADEANGKGAVLPTIETIVNGTY 255

Query: 281 -PISRPLLFYVKRQHFNSVLGLREYVSFSVSD-EMMAPDSQLFQYGLIPISNEERKSVRD 338
            P+SRPLL Y+ +   +    ++++V++ + + + + P++     G + +S E  K V+ 
Sbjct: 256 QPLSRPLLIYINKVS-SERPEVKKFVNYYIDNAQTLVPET-----GYVALSPEAYKLVKA 309

Query: 339 SIAVGKSG 346
               G +G
Sbjct: 310 RFETGTTG 317


>gi|228923023|ref|ZP_04086316.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228836656|gb|EEM82004.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 284

 Score = 99.4 bits (246), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 133/293 (45%), Gaps = 49/293 (16%)

Query: 22  TFARN---RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
            FA N    +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G    
Sbjct: 4   AFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGTGGGFNRFSKG---- 58

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKAL 137
            +DI N+SR + Q E +E KK+ +       + +DG+ +V +R    V  ++V++L    
Sbjct: 59  EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNTWVDDMSVDEL---- 113

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
              L  +D       K+WS+I   +P  ++  Y P    GT +  +  +LQ   +     
Sbjct: 114 -RLLWSED----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQNVILQNHRI----- 163

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
                          V   S+ +D   I         +  +  +K    FVG ++Y  N 
Sbjct: 164 ---------------VKKVSLSEDDQVI---------MQGVMNDKHAIAFVGYAYYMANR 199

Query: 258 DVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + +  YV F +
Sbjct: 200 DKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIRNKMNVANYVEFMI 252


>gi|222100283|ref|YP_002534851.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermotoga neapolitana DSM 4359]
 gi|221572673|gb|ACM23485.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermotoga neapolitana DSM 4359]
          Length = 277

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 87/329 (26%), Positives = 145/329 (44%), Gaps = 61/329 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+  FV+L   V + +   T       + I GS+T+FP +++  E F +  P+ +   +E
Sbjct: 4   MKRLFVLLFAMVSVFLVAKT-------LVIKGSNTVFPIAQLWIEEFKKVHPDVQVT-LE 55

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GSS G+     G    T DI NSSR +   E++   K G   I    +G DGI +V +
Sbjct: 56  GAGSSTGIAALFNG----TADIANSSRWLKPEEIERMNKEGKYFIP-FLVGFDGIAIVVN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           + +    +++E L            K+    ++ WS++ P+ P  RI +Y  +   GT E
Sbjct: 111 KKLGIDDISIETL-----------KKIYTGEIQYWSQVNPNLPRKRIVVYSRNTASGTYE 159

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E KVL  G  R   + +M            V  T +              E +AR   
Sbjct: 160 TFENKVL--GGARMAPYVRM------------VESTQIE------------IENVAR--- 190

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N     +VG+ +  ++  VLK   ++GI P+   I+ G YP++RPL  +V   +    +G
Sbjct: 191 NPYAIAYVGVGYVTDDVKVLK---VNGIYPTKENILKGKYPLARPLFMFVDATNGFPEMG 247

Query: 301 --LREYVSFSVS---DEMMAPDSQLFQYG 324
             + EY+ F+ S    E++     +  YG
Sbjct: 248 SLVFEYIMFAFSKKGQELLEKAGYVAAYG 276


>gi|46200028|ref|YP_005695.1| phosphate-binding protein [Thermus thermophilus HB27]
 gi|46197655|gb|AAS82068.1| phosphate-binding protein [Thermus thermophilus HB27]
          Length = 322

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/273 (27%), Positives = 127/273 (46%), Gaps = 55/273 (20%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           +IR  GSST++P ++ +AE F+   P  +   V   G+  G K+FCRG      DI N+S
Sbjct: 20  QIRADGSSTVYPITQAVAEEFTARNPNIRV-VVAFSGTGGGFKKFCRG----ETDIQNAS 74

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           R I   EL+ C+++G+  I E+ + +D + ++V+ ++  +  L   +L            
Sbjct: 75  RPIRPEELEVCQENGIQFI-ELPVAYDALTVIVNPKNTWAACLKTSEL------------ 121

Query: 146 KVVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           K ++ P   +++WS+IR  +P   + +Y      GT                        
Sbjct: 122 KAIWEPGSKIQRWSQIRQGWPNQPLRLYGAGADSGT------------------------ 157

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
            F Y  + +     ++R D    E D     T+  +  +    GF+G ++Y+ N D +K 
Sbjct: 158 -FDYFTEAIVGKAKAIRTDYQPTEDD---NVTIKGVAGDTYAMGFLGYAYYEENKDKVKA 213

Query: 263 VPIDG----IVPSMGTIVSGLY-PISRPLLFYV 290
           V ID     ++PS  T++ G Y P+SRPL  YV
Sbjct: 214 VAIDHGKGCVLPSRETVLDGTYQPLSRPLFIYV 246


>gi|37519584|ref|NP_922961.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
 gi|35210575|dbj|BAC87956.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
          Length = 338

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/329 (25%), Positives = 148/329 (44%), Gaps = 54/329 (16%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFK-TPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
           +++I GSST++P ++  A+ F E    ++ T  V   G+  G K+FC G    T DI ++
Sbjct: 32  KVKIDGSSTVYPITRAAAKAFEEQNKPYQGTIAVAFSGTGGGFKKFCAG----TTDISDA 87

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SR I Q E+D C+ + V+   E+ +  D + ++V  ++  +  +TV +L K       + 
Sbjct: 88  SRPILQKEIDACRNNNVA-FMELPVAFDALTVVVHPKNTWASEITVAELKK-------IW 139

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
           ++     + +WS++R  FP+  + +Y P    GT +   + +L                 
Sbjct: 140 ERASQGKVTRWSQVRAGFPDRPLKLYGPGRDSGTYDYFAEAIL----------------- 182

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR-IEVNKDVFGFVGLSFYKNNADVLKLV 263
                    A T  R D     VD +  + L + +  + D  G+ G ++Y+ N D LK +
Sbjct: 183 -------GSANTDTRSD----YVDSEDDDVLVKGVSEDPDALGYFGYAYYEANKDKLKAL 231

Query: 264 PIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD-EMMAPD 317
            +DG    + P+   +  G Y P+SRPL  YV          +RE+V + + + E +A  
Sbjct: 232 AVDGGKGPVPPTDKNVEKGTYAPLSRPLFIYVNIVSTQKKPEVREFVKYYLDNGEKLAA- 290

Query: 318 SQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                 G +P+  E      +    GK G
Sbjct: 291 ----SVGYVPLPEEGYHIASNHFFRGKRG 315


>gi|51891902|ref|YP_074593.1| phosphate ABC transporter phosphate-binding protein
           [Symbiobacterium thermophilum IAM 14863]
 gi|51855591|dbj|BAD39749.1| phosphate ABC transporter phosphate-binding protein
           [Symbiobacterium thermophilum IAM 14863]
          Length = 319

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 142/320 (44%), Gaps = 59/320 (18%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
            GT     + + GSST+ P S  +AE F +  P    P V   GSS G+ +F +      
Sbjct: 41  AGTELSGTVTLDGSSTVGPISIAVAEEFRKVHPRVDVP-VGISGSSAGIGKFVK----RE 95

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALA 138
           +DI N+SR I + EL+E + +G+  I E+ + +DG+ +V +++   ++ +T E L+K   
Sbjct: 96  VDIANASRPIKEKELEEARNNGLDPI-ELPVAYDGLSVVVNKENDFLTCITTEQLHKIWG 154

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
               V          +W+E+ P +P+  I +Y P    GT E   + V  +G     +F+
Sbjct: 155 PESTV---------TRWNEVDPSWPDAPIKLYGPGTASGTFEYFNEMVNGKGDASRSDFT 205

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIE-VDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
              D                  D + ++ V GD           K   G+ G ++Y  N 
Sbjct: 206 ASED------------------DNVLVQGVAGD-----------KYAMGYFGYAYYAENK 236

Query: 258 DVLKLVPIDG----IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSD-- 311
           D +K + ID     + P+  TI +G YP SR +  Y  RQ       ++ +V+F + +  
Sbjct: 237 DTMKALAIDAGDGCVEPNDDTIAAGSYPFSRLIYIYPSRQALERPE-VKAFVTFYMENAG 295

Query: 312 EMMAPDSQLFQYGLIPISNE 331
           E+ A      Q G  P+  E
Sbjct: 296 ELAA------QVGYTPLPEE 309


>gi|304319987|ref|YP_003853630.1| phosphate binding protein [Parvularcula bermudensis HTCC2503]
 gi|303298890|gb|ADM08489.1| phosphate binding protein, putative [Parvularcula bermudensis
           HTCC2503]
          Length = 339

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/332 (22%), Positives = 146/332 (43%), Gaps = 21/332 (6%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           V++C   L +  G G     R+ IAG++++ P+++++ +   +         +   GS+ 
Sbjct: 5   VVICLAALTLTAGFGA-GLERVEIAGATSVTPFAEVVQKILHDDI----LVTLNQRGSTR 59

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           GL++ C      T+  V SS ++T   LD C+ HG   ++E+ +   G++L  +     +
Sbjct: 60  GLRQLCEKASVPTV--VLSSHRVTAETLDRCRVHGFDWLREIKVARYGLVLAQNASTSPL 117

Query: 127 SLTVEDLYKALASYLIVDDK---VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            LT  DL+ AL +   + D+   ++ N    WS +R   P   I +  P+          
Sbjct: 118 ELTTRDLFLALGARTPLSDQDCTLLTNNRTSWSAVRSSLPARPILMIGPAQGTDRFNDFV 177

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDG---IAIEVDGDYTETLARIEV 240
              L++G   +R+F  +  + +    Q+      VR D    +A + +G     L  +  
Sbjct: 178 DLALRDG---ARSFPCLATL-EVKAPQIFDRAVKVRNDQHWVVAGDDEGAVAGVLRHLPH 233

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
              +FG+  L       D L ++P++G+ P+  TI    YP+++    Y    H      
Sbjct: 234 GLALFGWSSLI----GTDELAILPLNGVHPTTSTIADRTYPLTQDFYLYTAEAHLGEESA 289

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEE 332
           +R  V   V+    +P  +LF+ G +P  + E
Sbjct: 290 VRRVVEPFVNLGETSPGGRLFEIGFVPPRDSE 321


>gi|228954555|ref|ZP_04116580.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228805212|gb|EEM51806.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 284

 Score = 98.6 bits (244), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 126/283 (44%), Gaps = 44/283 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G     +DI N+SR
Sbjct: 13  VRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGTGGGFNRFSKG----EVDINNASR 67

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            + Q E +E KK+ +       + +DG+ +V +R    V     D  + L S    +   
Sbjct: 68  VMKQVEKNEMKKNSIQ-FTPFEVANDGLTIVVNRHNTWVDDMSVDELRLLWSENGRE--- 123

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
                K+WS+I   +P  ++  Y P    GT +  +  +LQ   +               
Sbjct: 124 -----KRWSQIHSTWPREQVKFYAPGVDSGTYDYFQNVILQNHRI--------------- 163

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                V   S+ +D   I         +  +  +K    FVG ++Y  N D +K + ++G
Sbjct: 164 -----VKKVSLSEDDQVI---------MQGVMNDKHAIAFVGYAYYMANRDKVKAIKVNG 209

Query: 268 IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           + P+  TI SG Y P+SRPLL YV      + + +  YV F +
Sbjct: 210 VFPTKETIQSGKYKPLSRPLLAYVNNASIRNKMNVANYVEFMI 252


>gi|229061965|ref|ZP_04199292.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH603]
 gi|229169018|ref|ZP_04296734.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH621]
 gi|228614427|gb|EEK71536.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH621]
 gi|228717349|gb|EEL69021.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH603]
          Length = 284

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 131/293 (44%), Gaps = 49/293 (16%)

Query: 22  TFARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
            FA N    +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G    
Sbjct: 4   AFATNEMGEVRVDGSSTVFPIIEAVAEEYTKAHPNVKIS-ISISGTGGGFNRFSKG---- 58

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKAL 137
            +DI N+SR +   E +  +K  +       + +DG+ +V +R    V+ +T+++L    
Sbjct: 59  EVDINNASRLMKPVEENAMQKKSI-QFTPFEVAYDGLTIVVNRQNTWVNNMTIDELR--- 114

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
              L+  +      LK+WS+I   +P  ++  Y P    GT +  +  VLQ   +     
Sbjct: 115 ---LLWSEN---GRLKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVVLQNNRL----- 163

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
                          V   S+ +D   I         +  +  +K+   FVG ++Y  N 
Sbjct: 164 ---------------VKTVSLSEDDQVI---------MQGVMNDKNAIAFVGYAYYMANR 199

Query: 258 DVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           D +K + +DG+ P+  TI SG Y P+SRPL  YV      + + +  YV F +
Sbjct: 200 DKVKAIQVDGVFPTKETIQSGTYKPLSRPLFTYVNHASIRNKINVANYVEFMI 252


>gi|228929316|ref|ZP_04092341.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|229123810|ref|ZP_04253004.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 95/8201]
 gi|228659631|gb|EEL15277.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 95/8201]
 gi|228830330|gb|EEM75942.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
          Length = 278

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 132/284 (46%), Gaps = 46/284 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+SR
Sbjct: 7   VRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNASR 61

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146
            + Q E +E K++ +       + +DG+ +V +R    V ++TV++L       L  +D+
Sbjct: 62  VMKQVEENEMKRNSIQ-FTPFEVAYDGLTIVVNRQNTWVDNMTVDEL-----RLLWSEDE 115

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +              
Sbjct: 116 ----SEKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRI-------------- 157

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                 V   S+ +D   I         +  +  +K+   FVG ++Y  N D ++ + ++
Sbjct: 158 ------VKKVSLSEDDQVI---------MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVN 202

Query: 267 GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           G++P+  TI SG Y P+SR L  YV      + + +  Y+ F +
Sbjct: 203 GVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNKMNIANYIEFMI 246


>gi|326326062|ref|YP_004250871.1| putative protein sphX [Vibrio nigripulchritudo]
 gi|323669113|emb|CBJ93162.1| Putative protein sphX precursor [Vibrio nigripulchritudo]
          Length = 331

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 89/348 (25%), Positives = 156/348 (44%), Gaps = 52/348 (14%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
             L  F++  V CG   +A++ I+I GSST++P +  IAE +           V   G+ 
Sbjct: 10  TTLSWFLLAGVTCGA--YAKDLIKIEGSSTVYPITHQIAERYMLSEGTGTQVVVGISGTG 67

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G ++FCRG      D+ N+SR +  NE   C+++ +  I E+ +  D I +V +R+   
Sbjct: 68  GGFRKFCRG----RTDVSNASRPMKANEKALCQENSIEYI-ELPVALDAITIVVNRNNDW 122

Query: 126 VS-LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           +S L+++DL        ++ +    N +  W  +RP +P + I ++ P    GT      
Sbjct: 123 LSALSLDDLK-------LLWEVGAQNSITTWRHLRPHYPAIPINLHGPGMDSGT------ 169

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
                              + Y V  +++     RQD  A E D      +A +  +K+ 
Sbjct: 170 -------------------YDYFV-DVTLGGQKSRQDYRANEDD---EAMVAEVAEDKNA 206

Query: 245 FGFVGLSFYKNNADVLKLVPID---GI--VPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
             F+G ++Y  N D LK V I    G+  +PS+G++  G Y  +SRPL  YV +      
Sbjct: 207 MAFLGFAYYLKNQDKLKAVAISERGGVPTLPSVGSVTQGQYGSLSRPLFIYVNKTALEKR 266

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
             +R ++        +  +  + + G IP+S+    +VR  +    SG
Sbjct: 267 GSVRRFLELYFHPSNI--NGIVTRAGYIPLSSRMYSAVRQRLKNKVSG 312


>gi|229093341|ref|ZP_04224450.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-42]
 gi|228690065|gb|EEL43864.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-42]
          Length = 278

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 132/284 (46%), Gaps = 46/284 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+SR
Sbjct: 7   VRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNASR 61

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146
            + Q E +E K++ +       + +DG+ +V +R    V ++TV++L       L  +D+
Sbjct: 62  VMKQVEENEMKRNSIQ-FTPFEVAYDGLTIVVNRQNTWVDNMTVDEL-----RLLWSEDE 115

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +              
Sbjct: 116 ----SEKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRI-------------- 157

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                 V   S+ +D   I         +  +  +K+   FVG ++Y  N D ++ + ++
Sbjct: 158 ------VKKVSLSEDDQVI---------MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVN 202

Query: 267 GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           G++P+  TI SG Y P+SR L  YV      + + +  Y+ F +
Sbjct: 203 GVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNKMNVANYIEFMI 246


>gi|229163217|ref|ZP_04291172.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus R309803]
 gi|228620280|gb|EEK77151.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus R309803]
          Length = 284

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 128/283 (45%), Gaps = 44/283 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+SR
Sbjct: 13  VRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNASR 67

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            + Q E +E KK+ V       + +DG+ +V +R     +  V+D+       L  +D  
Sbjct: 68  VMKQVEENEMKKNSVQ-FTPFEVAYDGLTIVVNRQ----NHWVDDMSVDELRLLWSED-- 120

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
                K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +               
Sbjct: 121 --GREKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRI--------------- 163

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                V   S+ +D   I         +  +  +K+   FVG ++Y  N D +K + ++G
Sbjct: 164 -----VKKVSLSEDDQVI---------MQGVMNDKNAIAFVGYAYYMANRDKVKAIRVNG 209

Query: 268 IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           + P+ GTI SG Y P+SR L  YV      + + +  YV F +
Sbjct: 210 VFPTKGTIQSGKYKPLSRSLFTYVNDASIRNEMNVASYVEFMI 252


>gi|319651561|ref|ZP_08005688.1| phosphate ABC transporter [Bacillus sp. 2_A_57_CT2]
 gi|317396628|gb|EFV77339.1| phosphate ABC transporter [Bacillus sp. 2_A_57_CT2]
          Length = 322

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 84/319 (26%), Positives = 143/319 (44%), Gaps = 56/319 (17%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVE--SGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I GS T++P+   +AEN   Y  E +   VE    G+S G K+F   + +D  D  ++SR
Sbjct: 48  IDGSGTVYPFMARMAEN---YMGEQENVSVEVSRSGTSAGFKKF---LAEDGTDFNDASR 101

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
           +I   E    +  G+ D+QE+ +  DGI +V +++         D    L    +VD  +
Sbjct: 102 QIKDEEKASAEDLGI-DVQEMKVALDGITIVINKE--------NDWATELTQQEVVDIFL 152

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
                KKWS++RP+FP+  I  Y P+  HGT E + + +L+E  +              N
Sbjct: 153 ASAGKKKWSDVRPEFPDEEIQTYGPNENHGTYEFMFENILEEQDLPEN----------IN 202

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID- 266
           +QQ                   DY+  +  +  +K+  GF G  +Y +N D L  V +D 
Sbjct: 203 LQQ-------------------DYSTLVDLVSKDKNAIGFFGYGYYDSNKDKLTAVKVDF 243

Query: 267 ---GIVPSMGTIVS-GLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
               + PS+ TI   G Y P +RP+  Y+          + +Y  ++    M        
Sbjct: 244 GSGPVEPSLDTIKEDGDYAPFTRPVFTYLNTNMAKEKPQVLDYAIYT----MENAQDVAA 299

Query: 322 QYGLIPISNEERKSVRDSI 340
           + G  P+S+E+ ++  D++
Sbjct: 300 ETGFAPLSDEDIQASLDAL 318


>gi|221633805|ref|YP_002523031.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Thermomicrobium roseum DSM 5159]
 gi|221155820|gb|ACM04947.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermomicrobium roseum DSM 5159]
          Length = 388

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 89/333 (26%), Positives = 153/333 (45%), Gaps = 66/333 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST+FP S+ +AE F + +P+ K   V   G+  G K+FC    +   DI ++SR
Sbjct: 88  ITIDGSSTVFPISEAVAEEFQKKYPQVKV-TVGISGTGGGFKKFC----NKETDISDASR 142

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDD 145
            I  +E++ C+K G   I E+ +  DG+ +V     D V   LTVE+L            
Sbjct: 143 PIKDSEVEACQKSGREYI-ELPVAFDGLAVVVHPQNDWVD-HLTVEEL------------ 188

Query: 146 KVVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
            +++ P     + +W+++RP++P+  + +Y      GT                      
Sbjct: 189 NLIWKPESQGVITRWNQVRPNWPDAPLNLYGAGTDSGT---------------------- 226

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
              F Y  + ++    + R D  A E D    + +A    +K+  G+ GL++   N   +
Sbjct: 227 ---FDYFTEAINGKAGASRGDYTASEDDNVLVQGVAG---DKNALGYFGLAYAIENKGRV 280

Query: 261 KLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
           K+VPI        + P++ T+ +G Y P+SRPL  YV R   +    ++ +V F + +  
Sbjct: 281 KIVPIVNPKTGKPVEPNLETVKTGQYQPLSRPLFIYVARDQADRPE-VQAFVEFYLDN-- 337

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            A  SQ  + G IP+ +E  +  +      K+G
Sbjct: 338 AAELSQ--EVGYIPLPDEAYQLAKKRFQARKTG 368


>gi|228916905|ref|ZP_04080467.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228935592|ref|ZP_04098408.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228947985|ref|ZP_04110271.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228811675|gb|EEM58010.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228824130|gb|EEM69946.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228842729|gb|EEM87815.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
          Length = 278

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 132/284 (46%), Gaps = 46/284 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+SR
Sbjct: 7   VRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNASR 61

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146
            + Q E +E K++ +       + +DG+ +V +R    V ++TV++L       L  +D+
Sbjct: 62  VMKQVEENEMKRNSIQ-FTPFEVAYDGLTIVVNRQNTWVDNMTVDEL-----RLLWSEDE 115

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +              
Sbjct: 116 ----SEKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRI-------------- 157

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                 V   S+ +D   I         +  +  +K+   FVG ++Y  N D ++ + ++
Sbjct: 158 ------VKKVSLSEDDQVI---------MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVN 202

Query: 267 GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           G++P+  TI SG Y P+SR L  YV      + + +  Y+ F +
Sbjct: 203 GVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNKMNVANYIEFMI 246


>gi|39996201|ref|NP_952152.1| phosphate ABC transporter ATP-binding protein [Geobacter
           sulfurreducens PCA]
 gi|39982966|gb|AAR34425.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Geobacter sulfurreducens PCA]
          Length = 342

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/332 (25%), Positives = 155/332 (46%), Gaps = 55/332 (16%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           A   ++I GSST++P ++ +AE F +         V   G+  G K+FCRG     ID+ 
Sbjct: 34  ADKLVKIDGSSTVYPITEAVAEEFQKAKRGAVKVTVGISGTGGGFKKFCRG----EIDLS 89

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLI 142
            +SR I + E++ CK+ G+  I E+ + +D + ++V+ ++    S+TV++L K       
Sbjct: 90  GASRPILKKEMEACKQAGIQYI-ELPVAYDALTVVVNPQNTWVKSMTVDELKK------- 141

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           + +      + KW+++ P +P   + ++ P    GT                        
Sbjct: 142 IWEPAAQGKITKWNQVNPAWPNQPLKLFGPGADSGT------------------------ 177

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
            F Y  + +     S R D  A E D    + ++R   ++   G+ G ++Y  N+  LK 
Sbjct: 178 -FDYFTEAVVGKAKSSRGDFTASEDDNVLVQGVSR---DRGGLGYFGYAYYAENSKKLKA 233

Query: 263 VPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           VPI        + PS+ T+ +G Y P+SRP+  YV  +  +    ++E+V F ++    A
Sbjct: 234 VPIVEKAGKPAVSPSIDTVKNGSYQPLSRPIFIYVNAKSVDKPE-VKEFVDFYLN---QA 289

Query: 316 PD-SQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           P  S+  +Y  +P+ ++     + + A  K+G
Sbjct: 290 PKLSKAVKY--VPLPDKAYALAKSNFAKKKTG 319


>gi|228993016|ref|ZP_04152939.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           pseudomycoides DSM 12442]
 gi|228766664|gb|EEM15304.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           pseudomycoides DSM 12442]
          Length = 284

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 131/282 (46%), Gaps = 46/282 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + IAE +++  P  K   +   G+  G   F +G     +DI N+SR
Sbjct: 13  VRVDGSSTVFPIMEAIAEEYTKKEPRVKIS-ISISGTGGGFHRFGKG----EVDINNASR 67

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDR-DMVSVSLTVEDLYKALASYLIVDDK 146
           ++ Q E +  K++ +       I +DG+ ++ +R +  + ++T+E+L       L  +D 
Sbjct: 68  QVKQVEENFMKENSI-QFTPFEIAYDGLTIIVNRQNTWADNMTIEEL-----RLLWSED- 120

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K+WS I P +P  ++  Y P    GT +  +  VL     R+   +K       
Sbjct: 121 ---GRTKRWSHIHPKWPHEKVQFYAPGVDSGTYDYFQSVVL-----RNNRLAK------- 165

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                     ++ +D   I         +  +  +K+   FVG ++Y  N D +K V ++
Sbjct: 166 --------TVALSEDDQVI---------MQGVMNDKNAIAFVGYAYYMANRDKVKAVKVN 208

Query: 267 GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
           G+ P+   I SG+Y P+SRPL  YV      +   + EYV F
Sbjct: 209 GVPPTKANIQSGVYKPLSRPLFAYVNHASIRNKSSVAEYVVF 250


>gi|282899650|ref|ZP_06307614.1| Phosphate binding protein [Cylindrospermopsis raciborskii CS-505]
 gi|281195529|gb|EFA70462.1| Phosphate binding protein [Cylindrospermopsis raciborskii CS-505]
          Length = 348

 Score = 97.4 bits (241), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 83/289 (28%), Positives = 132/289 (45%), Gaps = 50/289 (17%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           +++I GSST++P ++ I + F++      +  V   G+  G K+FC     +  DI N+S
Sbjct: 44  KVKIDGSSTVYPITQAIVKEFTKDGKNSSSVEVSVSGTGGGFKKFC----SNETDINNAS 99

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           R I+  E+ EC K+GV  I E+ +  D + ++V+ R+     +TV++L K   S      
Sbjct: 100 RPISAKEMAECNKNGVRYI-EIPVAFDALTVVVNPRNNWVQDMTVDELRKIWESQ----- 153

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                 + KW+++R  +P+  + +Y P    GT                         + 
Sbjct: 154 --SQGKITKWNQVRASWPDRPLKLYGPGKDSGT-------------------------YD 186

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV--FGFVGLSFYKNNADVLKLV 263
           Y V+ +     + R D  A E D    E      VNKDV   G+ G ++Y+ N D LKLV
Sbjct: 187 YFVEAIIGKEKASRNDYTASEDDDVLVEG-----VNKDVNALGYFGYAYYEKNQDKLKLV 241

Query: 264 PIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
            +D     I+PS  T+    Y P+SRPL  YV          L E+V F
Sbjct: 242 AVDNKKGPILPSPETVGKSKYQPLSRPLFIYVNLWSGEKRAELYEFVDF 290


>gi|228999066|ref|ZP_04158648.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides Rock3-17]
 gi|228760683|gb|EEM09647.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides Rock3-17]
          Length = 284

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 131/282 (46%), Gaps = 46/282 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + IAE +++  P  K   +   G+  G   F +G     +DI N+SR
Sbjct: 13  VRVDGSSTVFPIMEAIAEEYTKKEPRVKIS-ISISGTGGGFHRFGKG----EVDINNASR 67

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDR-DMVSVSLTVEDLYKALASYLIVDDK 146
           ++ Q E +  K++ +       I +DG+ ++ +R +  + ++T+E+L       L  +D 
Sbjct: 68  QVKQVEENFMKENSI-QFTPFEIAYDGLTIIVNRQNTWADNMTIEEL-----RLLWSED- 120

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K+WS I P +P  ++  Y P    GT +  +  VL     R+   +K       
Sbjct: 121 ---GRTKRWSHIHPKWPHEKVQFYAPGVDSGTYDYFQSVVL-----RNNRLAK------- 165

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                     ++ +D   I         +  +  +K+   FVG ++Y  N D +K V ++
Sbjct: 166 --------TVALSEDDQVI---------MQGVMNDKNAIAFVGYAYYMANRDKVKSVKVN 208

Query: 267 GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
           G+ P+   I SG+Y P+SRPL  YV      +   + EYV F
Sbjct: 209 GVPPTKANIQSGVYKPLSRPLFAYVNHASIRNKSSVAEYVVF 250


>gi|229006614|ref|ZP_04164249.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides Rock1-4]
 gi|228754663|gb|EEM04073.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides Rock1-4]
          Length = 284

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 131/282 (46%), Gaps = 46/282 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + IAE +++  P  K   +   G+  G   F +G     +DI N+SR
Sbjct: 13  VRVDGSSTVFPIMEAIAEEYTKKEPRVKIS-ISISGTGGGFHRFGKG----EVDINNASR 67

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDR-DMVSVSLTVEDLYKALASYLIVDDK 146
           ++ Q E +  K++ +       I +DG+ ++ +R +  + ++T+E+L       L  +D 
Sbjct: 68  QVKQVEENFMKENSI-QFTPFEIAYDGLTIIVNRQNTWADNMTIEEL-----RLLWSED- 120

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K+WS I P +P  ++  Y P    GT +  +  VL     R+   +K       
Sbjct: 121 ---GRTKRWSHIHPKWPHEKVQFYAPGVDSGTYDYFQSVVL-----RNNRLAK------- 165

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                     ++ +D   I         +  +  +K+   FVG ++Y  N D +K V ++
Sbjct: 166 --------TVALSEDDQVI---------MQGVMNDKNAIAFVGYAYYMANRDKVKSVKVN 208

Query: 267 GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
           G+ P+   I SG+Y P+SRPL  YV      +   + EYV F
Sbjct: 209 GVPPTKANIQSGVYKPLSRPLFAYVNHASIRNKSSVAEYVVF 250


>gi|134093760|ref|YP_001098835.1| phosphate transporter [Herminiimonas arsenicoxydans]
 gi|133737663|emb|CAL60708.1| Phosphate-binding periplasmic protein precursor (PBP)
           [Herminiimonas arsenicoxydans]
          Length = 333

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 89/356 (25%), Positives = 164/356 (46%), Gaps = 56/356 (15%)

Query: 1   MRFFFVVLMCFVVLE-VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+  F  L   + L    C     A+  I+I GSST+FP ++ +A++F +          
Sbjct: 1   MKLSFQTLSPLLFLTTALCIAPAQAQTFIKIDGSSTVFPITEAVADDFQDMKSGTVKVTT 60

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLV 118
              G+  G K+FC+G      DI N+SR I + E+DEC K+GV  + E+ I  D + ++V
Sbjct: 61  GIAGTGGGFKKFCKG----ETDISNASRPILKKEMDECAKNGVKYV-ELPIAFDALTVVV 115

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           + ++     +TVE+L K         +      + +W+++ P +P+  I ++      GT
Sbjct: 116 NPKNKFLNKITVEELKKMW-------EPAAQGTITRWNQVNPTWPDAPIKLFGAGADSGT 168

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
                                    F Y  + +     S R D  + E D    + +AR 
Sbjct: 169 -------------------------FDYFTEAIMSKSKSSRTDYTSSEDDNVVVQGVAR- 202

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVK 291
           +VN    G+ G ++Y +N+  LK+VPI        + PS+ +++ G Y P++RPL  YV 
Sbjct: 203 DVN--AIGYFGYAYYVDNSKRLKVVPIVHKAGKPAVAPSLKSVMDGTYQPLARPLFIYVS 260

Query: 292 RQHFNSVLGLREYVSFSVSD-EMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            +       ++E+V F + + + +A + +      IP+++++ K    + +  K+G
Sbjct: 261 IKAIERS-EVKEFVEFYLKNAQKLAKEVK-----YIPLTDKDYKHAFTNFSNKKTG 310


>gi|229013491|ref|ZP_04170628.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides DSM 2048]
 gi|229135095|ref|ZP_04263898.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST196]
 gi|228648383|gb|EEL04415.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST196]
 gi|228747903|gb|EEL97769.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides DSM 2048]
          Length = 284

 Score = 97.1 bits (240), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 131/293 (44%), Gaps = 49/293 (16%)

Query: 22  TFARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
            FA N    +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G    
Sbjct: 4   AFATNEMGEVRVDGSSTVFPIIEAVAEEYTKAHPNVKIS-ISISGTGGGFNRFSKG---- 58

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKAL 137
            +DI N+SR +   E +  +K  +       + +DG+ +V +R    V+ +T+++L    
Sbjct: 59  EVDINNASRLMKPVEENAMQKKFI-QFTPFEVAYDGLTIVVNRQNTWVNNMTIDELR--- 114

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
              L+  +      LK+WS+I   +P  ++  Y P    GT +  +  VLQ   +     
Sbjct: 115 ---LLWSEN---GRLKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVVLQNNRL----- 163

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
                          V   S+ +D   I         +  +  +K+   FVG ++Y  N 
Sbjct: 164 ---------------VKTVSLSEDDQVI---------MQGVMNDKNAIAFVGYAYYMANR 199

Query: 258 DVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           D +K + +DG+ P+  TI SG Y P+SRPL  YV      + + +  YV F +
Sbjct: 200 DKVKAIQVDGVFPTKETIQSGTYKPLSRPLFTYVNHASIRNKINVANYVEFMI 252


>gi|87124426|ref|ZP_01080275.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. RS9917]
 gi|86167998|gb|EAQ69256.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. RS9917]
          Length = 355

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 74/302 (24%), Positives = 135/302 (44%), Gaps = 48/302 (15%)

Query: 13  VLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF-VESGGSSVGLKEF 71
           +L V       A+  IRI+GSST++P +    + F +        F ++  GSS G ++F
Sbjct: 28  LLAVAAQQPLLAQATIRISGSSTVYPITARAIQRFEKTSEGKNVKFDLKETGSSAGFRDF 87

Query: 72  CRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTV 130
           C G     + + N+SR I+  E+  CK  G+  I E+ I  D I ++V+ ++  + ++T 
Sbjct: 88  CSG----KVPMANASRPISSKEIKACKAKGIQFI-ELPIAFDAITVVVNPKNTWATTVTP 142

Query: 131 EDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEG 190
           ++L +       +  K     + +W+++  DFP+  I +  P    GT ++  K +    
Sbjct: 143 KELSR-------LWRKQAQGTVTRWNQVNHDFPDQPIRLCGPGNDSGTYDIFNKAI---- 191

Query: 191 CVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGL 250
                                + + T+ R D  A E D    + +A    + +  G+ G 
Sbjct: 192 ---------------------NKSTTNTRTDYTASEDDNVLVKCVA---TDPNALGYFGF 227

Query: 251 SFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREY 304
            +YK N+  LK + +     + I PS+  +   LY P+SRPL  Y+  +  N     R +
Sbjct: 228 GYYKKNSQRLKALKVVNPKGNSIAPSVANVQKELYQPLSRPLFLYINDKTLNQNKAFRSF 287

Query: 305 VS 306
           V+
Sbjct: 288 VT 289


>gi|37519581|ref|NP_922958.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
 gi|35210572|dbj|BAC87953.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
          Length = 337

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 144/326 (44%), Gaps = 50/326 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPF-VESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           ++I GSST++P ++   + F     +F+    V   G+  G ++FC G      DI ++S
Sbjct: 32  VKIDGSSTVYPITRAAVKAFEAEHKQFQGKIAVNFSGTGGGFRKFCSG----ETDISDAS 87

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           R I Q E+DEC++  V+   E+ +  D + ++V  ++  +  +TV +L K       + +
Sbjct: 88  RPILQREMDECRRANVA-FMELPVAFDALTVVVHPKNTWASEITVAELKK-------IWE 139

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
           +     + +WS++RP FP+  + +Y P    GT +   + +                   
Sbjct: 140 RASQGKITRWSQVRPGFPDRPLRLYGPGRDSGTYDYFAEAI------------------- 180

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                L  A T  R D  A E D    E +A    + +  G+ G ++Y+ N + LK + +
Sbjct: 181 -----LGSADTDTRSDYEASEDDDVLVEGVA---ADPNALGYFGYAYYEANLNRLKTLAV 232

Query: 266 DG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           D     + P+   +  G Y P+SRPL  YV          +RE+V F +  E  A  + L
Sbjct: 233 DSGKGPVAPTDKNVEKGTYAPLSRPLFIYVNIVSAQKKAEVREFVDFYL--ENGAKLASL 290

Query: 321 FQYGLIPISNEERKSVRDSIAVGKSG 346
             Y  +P+  E      +    GK G
Sbjct: 291 VGY--VPLPAEGYHIANNHFHRGKRG 314


>gi|229019493|ref|ZP_04176313.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1273]
 gi|229025736|ref|ZP_04182139.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1272]
 gi|228735566|gb|EEL86158.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1272]
 gi|228741804|gb|EEL91984.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1273]
          Length = 284

 Score = 96.7 bits (239), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 76/293 (25%), Positives = 132/293 (45%), Gaps = 49/293 (16%)

Query: 22  TFARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
            FA N    +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G    
Sbjct: 4   AFATNEMGEVRVDGSSTVFPIIEAVAEEYTKAHPNVKIS-ISISGTGGGFNRFSKG---- 58

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKAL 137
            +DI N+SR + + E +  KK+ +       + +DG+ +V +R    V+ +T+++L    
Sbjct: 59  EVDINNASRVMKRVEENAMKKNSIQ-FTPFEVAYDGLTIVVNRQNTWVNNITIDEL---- 113

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
              L  +D       K+WS+I   +P  +I  Y P    GT +  +  VLQ   +     
Sbjct: 114 -RLLWGED----GSSKRWSQIHSSWPREQIKFYAPGVDSGTYDYFQNIVLQNSRL----- 163

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
                          V   S+ +D   I         +  +  +K+   FVG ++Y  N 
Sbjct: 164 ---------------VKTVSLSEDDQVI---------MQGVMNDKNAIAFVGYAYYMANR 199

Query: 258 DVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           D +K + ++G+ P+  TI SG Y P++RPL  YV      + + +  YV F +
Sbjct: 200 DKVKAIKVNGVFPTKETIQSGAYKPLARPLFTYVNDASIRNKMNVANYVEFMI 252


>gi|319892604|ref|YP_004149479.1| Phosphate ABC transporter, periplasmic phosphate- binding protein
           PstS [Staphylococcus pseudintermedius HKU10-03]
 gi|317162300|gb|ADV05843.1| Phosphate ABC transporter, periplasmic phosphate- binding protein
           PstS [Staphylococcus pseudintermedius HKU10-03]
          Length = 319

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 77/306 (25%), Positives = 132/306 (43%), Gaps = 54/306 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           ++  GSST+ P  + + E+FS    +     V SG +  G K+F  G      D  N+SR
Sbjct: 43  VKGNGSSTVAPIIEKLNEDFSSSHDKATVENVTSG-TGDGFKQFIAG----KTDFSNASR 97

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146
            I   E ++ K  G+ D  E  +  DG+ +  ++D   +  +++EDL K           
Sbjct: 98  PIKDEEKEQLKDKGI-DYTEFKVARDGLTIAVNKDNDFLKEISLEDLKK----------- 145

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           +     KKWS++  D+P+  I  + P   HGT +   ++V+ +  +++            
Sbjct: 146 IYSGEAKKWSDVDSDYPDKPIKAFSPDQSHGTYDFFTEEVMDDVDIQAE----------- 194

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             Q   V   SV+                     NK+  GF   +FYK N + LK V + 
Sbjct: 195 KNQNTDVIVKSVQD--------------------NKEGIGFFAYNFYKENENSLKAVKVK 234

Query: 267 G-----IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           G     I P+  +I  G YP+SRPL  Y   +   S     E++ F++ ++  A +++  
Sbjct: 235 GDDGKAIGPNQKSIQDGSYPLSRPLFIYANNKKLKSNDVFAEFMKFTLENKGKAAEAKGV 294

Query: 322 QYGLIP 327
            Y  +P
Sbjct: 295 DYVALP 300


>gi|119485718|ref|ZP_01619993.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Lyngbya sp. PCC 8106]
 gi|119457043|gb|EAW38170.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Lyngbya sp. PCC 8106]
          Length = 313

 Score = 96.3 bits (238), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 68/264 (25%), Positives = 120/264 (45%), Gaps = 41/264 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +++ GSST++P ++ +AE F +         V   G+  G K+FC G      DI N+SR
Sbjct: 41  VKVDGSSTVYPITEAVAEEFQKAKQGAMRVTVGISGTGGGFKKFCSG----QTDISNASR 96

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            I  +E   CK  G++ I E+ + +D I +V        S++  +L K         +  
Sbjct: 97  PIKDSEAQACKSAGINYI-ELPVAYDAITVVVHPSNPLTSISTAELKKMW-------EPA 148

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
               + KW++I   +P+  + +Y P    GT                         F Y 
Sbjct: 149 AQGKIMKWNQINSAWPDKALKLYGPGADSGT-------------------------FDYF 183

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
            ++++    + R D    E D    + ++R   ++   G+ G ++Y+NN   LK + I+G
Sbjct: 184 TEEINGKSQASRTDYTPSEDDNVLVQGVSR---DQGALGYFGYAYYENNKGKLKSLAING 240

Query: 268 IVPSMGTIVSGLY-PISRPLLFYV 290
           + PS+ T+ +G Y P+SRP+  YV
Sbjct: 241 VKPSLDTVNNGSYKPLSRPIFIYV 264


>gi|269122666|ref|YP_003310843.1| phosphate binding protein [Sebaldella termitidis ATCC 33386]
 gi|268616544|gb|ACZ10912.1| phosphate binding protein [Sebaldella termitidis ATCC 33386]
          Length = 297

 Score = 96.3 bits (238), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 75/289 (25%), Positives = 136/289 (47%), Gaps = 64/289 (22%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG--------GSSVGLKEFCRGIGDDTID 81
           I GSST+ P ++ +AE F           VESG        G+  G K+F  G     +D
Sbjct: 34  IDGSSTVAPITEAVAEEFRN---------VESGVNVSVGISGTGGGFKKFTVG----ELD 80

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV-SVSLTVEDLYKALASY 140
           I N+SR++   E    +K+ + +  E+ +G DGI +V +++   +  LT ++L K  +  
Sbjct: 81  ISNASREMKPEEKALAEKNNI-EFTEIQVGKDGITMVVNKENTWAQDLTTDELKKIWSE- 138

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
                    + +K W ++RP++P+  I +Y P    GT +   + +L +  +R ++++  
Sbjct: 139 --------GSTIKTWKDVRPEWPDTPIKLYAPDEDSGTYDYFIEAILGKNKIR-KDYTPS 189

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIE-VDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
            D                  D + ++ V+GD           K   GF G ++Y+ NAD 
Sbjct: 190 SD------------------DNVLVQGVEGD-----------KGSLGFFGFAYYEENADK 220

Query: 260 LKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
           L  + I+GI P+  T+ +G Y P+SRP+  +V  + +     ++ +V F
Sbjct: 221 LTALKINGIEPTPETVQNGTYKPLSRPIFIFVNNKSYAEKPQVKAFVQF 269


>gi|75759757|ref|ZP_00739836.1| Phosphate-binding protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228902786|ref|ZP_04066932.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis IBL 4222]
 gi|74492755|gb|EAO55892.1| Phosphate-binding protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228856860|gb|EEN01374.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis IBL 4222]
          Length = 284

 Score = 95.9 bits (237), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 132/293 (45%), Gaps = 49/293 (16%)

Query: 22  TFARN---RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
            FA N    +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G    
Sbjct: 4   AFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGTGGGFNRFGKG---- 58

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKAL 137
            +DI N+SR + Q E +E KK+ +       + +DG+ +V +     V  ++V++L    
Sbjct: 59  EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVANDGLAIVVNWHNTWVDDMSVDEL---- 113

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
              L  +D       K+WS+I   +P  ++  Y P    GT +  +  +LQ   +     
Sbjct: 114 -RLLWSED----GSEKRWSQIHSTWPREQVNFYAPGVDSGTYDYFQNVILQNHRI----- 163

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
                          V   S+ +D   I         +  +  +K    FVG ++Y  N 
Sbjct: 164 ---------------VKKVSLSEDDQVI---------MQGVMNDKHAIAFVGYAYYMANR 199

Query: 258 DVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + +  YV F +
Sbjct: 200 DKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVANYVEFMI 252


>gi|228476002|ref|ZP_04060710.1| protein SphX [Staphylococcus hominis SK119]
 gi|314936465|ref|ZP_07843812.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus hominis subsp. hominis C80]
 gi|228269825|gb|EEK11305.1| protein SphX [Staphylococcus hominis SK119]
 gi|313655084|gb|EFS18829.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus hominis subsp. hominis C80]
          Length = 316

 Score = 95.9 bits (237), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 74/288 (25%), Positives = 123/288 (42%), Gaps = 56/288 (19%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESG--GSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           GSST+ P  + + E +++  P   +  + SG  G+  G ++F  G      D   +SR I
Sbjct: 45  GSSTVAPIVEKLNEKWAKDHP---SATISSGQAGTGAGFEKFIAG----ETDFSQASRPI 97

Query: 90  TQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVF 149
              E  + +   +   +E  I  DG+ +  ++D   V    +D  K          K+  
Sbjct: 98  KDEEKQKLEDKNIK-YKEFKIAQDGVTVAVNKDNDFVKELSKDQLK----------KIYS 146

Query: 150 NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQ 209
              K W ++   +P   I  + P+  HGT +  E++V+                      
Sbjct: 147 GEAKTWKDVDSSWPNKEIKAFSPNSSHGTYDFWEEEVMD--------------------- 185

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG-- 267
                    +QD I  + +GD    +  +E NK+  G+ G +FYK N D LK V I G  
Sbjct: 186 ---------KQD-IKAQKNGDTNVIVQSVEKNKESIGYFGYNFYKQNKDKLKEVKIKGDD 235

Query: 268 ---IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
              + P+  TI  G YP+SRPL  YVK +       +RE++ F++ D+
Sbjct: 236 GKSVEPTKKTIQDGSYPLSRPLFLYVKEKSLEDNDVMREFLKFTLDDK 283


>gi|254409461|ref|ZP_05023242.1| Bacterial extracellular solute-binding protein, putative
           [Microcoleus chthonoplastes PCC 7420]
 gi|196183458|gb|EDX78441.1| Bacterial extracellular solute-binding protein, putative
           [Microcoleus chthonoplastes PCC 7420]
          Length = 342

 Score = 95.9 bits (237), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 87/312 (27%), Positives = 140/312 (44%), Gaps = 54/312 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+I GSST++P +K +AE F+          V   G+  G K+FC G      DI ++SR
Sbjct: 39  IKIDGSSTVYPITKTVAETFNAMTKAPVNVTVGFSGTGGGFKKFCAG----ETDINDASR 94

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDD 145
            I  +E+  CK+ GV+ I E+ +  D I +V   + D V   LTV +L K       + +
Sbjct: 95  PIQTDEMAACKQAGVAYI-ELPVAFDAITVVVNPENDWVD-RLTVAELQK-------IWE 145

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                 + +W+++R  FP+  + +Y P    GT                         F 
Sbjct: 146 PEAQRQITQWNQVRESFPQKPLNLYGPGTDSGT-------------------------FD 180

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLAR-IEVNKDVFGFVGLSFYKNNADVLKLVP 264
           Y  + +     S R D  A E D    E LA+ +  + +  G+ GL++Y+   D LK + 
Sbjct: 181 YFTEAIVGEAGSSRSDYTASEDD----EILAQGVNQDPNALGYFGLAYYEAIPDKLKAIA 236

Query: 265 ID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           +D     + PS  T+ +  Y P++RPL  YV          L E+V+F + +   AP+  
Sbjct: 237 VDSGKGAVFPSRQTVENAEYQPLTRPLFIYVNAAAAQKNPALAEFVAFYLEN---APEI- 292

Query: 320 LFQYGLIPISNE 331
           +   G IP+  E
Sbjct: 293 VSSVGYIPLPEE 304


>gi|99035045|ref|ZP_01314839.1| hypothetical protein Wendoof_01000334 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 178

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/175 (33%), Positives = 94/175 (53%), Gaps = 7/175 (4%)

Query: 164 EVRIAIYVPSGKHGTREVLEKKVL--QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQD 221
           +  I IY P    GT E L   ++  Q  C+ SR F   ++ +K + ++   AC ++R D
Sbjct: 1   KTEIEIYGPHQNTGTYETLVNSIMLDQYSCMNSRIF---KENYK-DQEERKKACGNIRDD 56

Query: 222 GIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYP 281
           G  IEV  +    + +++ NK+  G    SF   N D ++   I G+ P+   I SG Y 
Sbjct: 57  GRYIEVGINENIIIQKLKSNKNALGIFSFSFLMRNQDKIQGSTIAGVEPTYENISSGKYI 116

Query: 282 ISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSV 336
           ++RPL  Y+KR+H ++V GLRE+V   + D +   D  L + GLIP+S+E+ K  
Sbjct: 117 LARPLYLYIKREHLDTVDGLREFVK-EIIDSIGIEDGYLSRLGLIPLSSEDIKKA 170


>gi|71908105|ref|YP_285692.1| phosphate binding protein [Dechloromonas aromatica RCB]
 gi|71847726|gb|AAZ47222.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Dechloromonas aromatica RCB]
          Length = 331

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 137/293 (46%), Gaps = 59/293 (20%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+I GSST++P ++ +AE F +         V   G+  G K+FCR    D +DI ++SR
Sbjct: 27  IKIDGSSTVYPITEAVAEEFQKAKKNVVKVTVGISGTGGGFKKFCR----DELDISDASR 82

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            IT++E++ CK  GV  I E+ +  D + ++V+ ++      T+E++            K
Sbjct: 83  PITKSEMELCKAAGVQYI-EMPVAFDALTVVVNPKNTFLKQATIEEM------------K 129

Query: 147 VVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
           V++ P     + KW+++ P +P+  + ++      GT                       
Sbjct: 130 VLWEPAAQGKITKWNQVNPAWPDAPVKLFGAGADSGT----------------------- 166

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
             F+Y  + +     S R D  A E D    + ++R +VN    G+ G ++Y  N+  L+
Sbjct: 167 --FEYFTEAMVGKAKSSRGDYTASEDDNVLVQGVSR-DVN--AIGYFGYAYYAENSSKLR 221

Query: 262 LVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
            +PI        + PS   + +G Y P+SRP+  YVK +  +    ++E++ F
Sbjct: 222 ALPIVNPKTGKAVEPSAANVENGTYAPLSRPIFIYVKAKSLDKPE-VKEFIEF 273


>gi|283780576|ref|YP_003371331.1| phosphate binding protein [Pirellula staleyi DSM 6068]
 gi|283439029|gb|ADB17471.1| phosphate binding protein [Pirellula staleyi DSM 6068]
          Length = 352

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 88/343 (25%), Positives = 153/343 (44%), Gaps = 57/343 (16%)

Query: 15  EVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRG 74
           E   G  T     + I GSST+FP ++ +AE F+          V   G+  G K+F RG
Sbjct: 34  ETGSGEATKLTGAVAIDGSSTVFPVTEAVAEEFNSQVSSDVQVTVGISGTGGGFKKFIRG 93

Query: 75  IGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD--RDMVSVSLTVED 132
                ID+ ++SR I   E+  CK++G+  I E+ +  D + +  +   D V  ++T+++
Sbjct: 94  ----EIDVADASRPILAEEIAACKENGIEFI-EIPVCFDALTVAVNPANDWVE-NITIDE 147

Query: 133 LYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCV 192
           L K       + +      + KW++IRP++P+ ++ +Y      GT              
Sbjct: 148 LKK-------IWEPSAEGKITKWNQIRPEWPDEKLVLYGAGTDSGT-------------- 186

Query: 193 RSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSF 252
                      F Y  + ++    S R D I  E D    + +      K   GF+  ++
Sbjct: 187 -----------FDYFTEAVNGKAKSCRSDFIPSEDDNTLVQGIVG---EKYSMGFIPFAY 232

Query: 253 YKNNADVLKLVPID--------GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLRE 303
           Y+ N D +K + ID         I PS+ T+V G Y P+SRPL  YV ++       +++
Sbjct: 233 YEPNKDKMKALKIDWKSDDELGAIEPSLETVVGGTYNPLSRPLFIYVSKKAAERPE-VKK 291

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +V F + +  +A  SQ  +Y  +P+ +      +D  A  K+G
Sbjct: 292 FVEFYLDN--VAELSQEVKY--MPLPDAAYTMAKDRFAALKTG 330


>gi|218439749|ref|YP_002378078.1| phosphate binding protein [Cyanothece sp. PCC 7424]
 gi|218172477|gb|ACK71210.1| phosphate binding protein [Cyanothece sp. PCC 7424]
          Length = 341

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 81/312 (25%), Positives = 143/312 (45%), Gaps = 53/312 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES-GGSSVGLKEFCRGIGDDTIDIVNSS 86
           I+I GSST++P ++ I E +++          ES  G++ G  +FC G      DI  +S
Sbjct: 37  IKIDGSSTVYPITQKIVEKYNQGNASDPVEIQESVSGTTGGFNKFCAG----ETDINAAS 92

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           R I++ E+ +C    V  I E+ I  D I ++V+ ++  +  ++VEDL K        + 
Sbjct: 93  RPISEQEMQDCASKEVRYI-ELPIAFDAITVVVNQQNDWAEDISVEDLRKMWQPE--AEG 149

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
           K+       W+++ PD+P+  + ++ P    GT                         F 
Sbjct: 150 KIT-----NWNQVNPDWPDRPLNLFAPGKDSGT-------------------------FD 179

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLAR-IEVNKDVFGFVGLSFYKNNADVLKLVP 264
           Y  + ++    S R D +A E D    ET+   +  + +  G+ G ++Y+ N D LK + 
Sbjct: 180 YFTEAITGTTDSSRTDYVASEDD----ETIVTGVSQDPNALGYFGYAYYERNQDKLKPLG 235

Query: 265 ID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           ID     ++PS  T+ +  Y P++RPL  YV  +   +   L E+V F + +   A    
Sbjct: 236 IDNGQGAVLPSPETVENAQYQPLARPLFIYVNAKTAQNKPALEEFVKFYLKNAPTA---- 291

Query: 320 LFQYGLIPISNE 331
           + + G IP+  E
Sbjct: 292 VSEVGYIPLPEE 303


>gi|239617109|ref|YP_002940431.1| phosphate binding protein [Kosmotoga olearia TBF 19.5.1]
 gi|239505940|gb|ACR79427.1| phosphate binding protein [Kosmotoga olearia TBF 19.5.1]
          Length = 274

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 130/286 (45%), Gaps = 49/286 (17%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           I GS+T++P +++ AE F +  P+     +E  GSS G+K       +   DI N+SR +
Sbjct: 23  IKGSNTVYPVAQLWAEEFKKLHPDVDIS-IEGAGSSTGIKALF----NRQTDIANASRWL 77

Query: 90  TQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVF 149
             +E+ +    G   I  + + +DGI ++ ++ +   S+T++ LYK      I   K+  
Sbjct: 78  KSSEIKKMNAEGRYFIPFI-VAYDGIAIIVNKSLGIDSITIDQLYK------IYSGKIT- 129

Query: 150 NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQ 209
               KW++I P  P+ RI +Y      GT E   + V++            ++ F   VQ
Sbjct: 130 ----KWNQIDPSLPKKRIVVYSRDNASGTFEYFVEHVMK------------KEKFAPYVQ 173

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV 269
            L      V                  R++ NK   G++G+ +  +    LK   ++GI 
Sbjct: 174 MLPSTNAEVE-----------------RVKQNKYAIGYIGMGYVTDEVKALK---VEGIE 213

Query: 270 PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           P++  + SG YPISRPL  +V          + +++ F++S E  A
Sbjct: 214 PTVENVNSGKYPISRPLFMFVDATEGLPTGLVMDFIRFALSPEGQA 259


>gi|228967339|ref|ZP_04128374.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228792374|gb|EEM39941.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar sotto str. T04001]
          Length = 284

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 131/293 (44%), Gaps = 49/293 (16%)

Query: 22  TFARN---RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
            FA N    +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G    
Sbjct: 4   AFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGTGGGFNRFGKG---- 58

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKAL 137
            +DI N+SR + Q E +E KK+ +       +  DG+ +V +     V  ++V++L    
Sbjct: 59  EVDINNASRVMKQVEKNEMKKNSIQ-FTPFEVAKDGLTIVVNWHNTWVDDMSVDEL---- 113

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
              L  +D       K+WS+I   +P  ++  Y P    GT +  +  +LQ   +     
Sbjct: 114 -RLLWSED----GSEKRWSQIHSTWPREQVNFYAPGVDSGTYDYFQNVILQNHRI----- 163

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
                          V   S+ +D   I         +  +  +K    FVG ++Y  N 
Sbjct: 164 ---------------VKKVSLSEDDQVI---------MQGVMNDKHAIAFVGYAYYMANR 199

Query: 258 DVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + +  YV F +
Sbjct: 200 DKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVANYVEFMI 252


>gi|318041763|ref|ZP_07973719.1| ABC transporter substrate-binding protein [Synechococcus sp.
           CB0101]
          Length = 357

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 82/343 (23%), Positives = 141/343 (41%), Gaps = 50/343 (14%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
            F V +  V        G      I I+GSST++P+S     N     P+  T    S G
Sbjct: 23  LFAVSVVAVTGTALAQQGASPNKTIWISGSSTVYPFSVAAIANTKGQIPKGVTFKARSVG 82

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRD 122
           +S G +EFC G     + I  +SR I  +EL  C   GV  I E+ +  D I ++V+ ++
Sbjct: 83  TSAGFREFCSG----KLSIAAASRPINSDELKRCAAAGVRFI-ELPVAFDAITVVVNPKN 137

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
             +  ++   L         + ++     +++W+++ P +P   I +  P    GT +  
Sbjct: 138 SFAKEISTAQLR-------TLWNRKAQGKIQRWNQVNPAWPNTPIKLCGPGTDSGTYDTF 190

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            K +                         + + T  RQD  A E D      +A      
Sbjct: 191 NKAI-------------------------NGSTTDSRQDYTASEDDNVLVNCVAS---QP 222

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNS 297
              G+ G  +Y+ N   L+ + + G    ++PS+ ++ S  Y P+SRPL FYV  Q   S
Sbjct: 223 GALGYFGYDYYQANRSQLRALAVQGTRGTVLPSVESVQSSRYLPLSRPLFFYVNDQALKS 282

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
              +R  VS ++   +        Q G+IP+ +   + V + +
Sbjct: 283 NTAIRSMVSGTLQRGVKIAQ----QAGVIPLQDSTYRLVTNKL 321


>gi|296121744|ref|YP_003629522.1| phosphate binding protein [Planctomyces limnophilus DSM 3776]
 gi|296014084|gb|ADG67323.1| phosphate binding protein [Planctomyces limnophilus DSM 3776]
          Length = 338

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 85/293 (29%), Positives = 132/293 (45%), Gaps = 52/293 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I + GSST+FP S+ +AE F   FPE K     S G+  G K+F      + ID+  +SR
Sbjct: 60  IAVDGSSTVFPISQAVAEEFEGKFPEVKLTVAMS-GTGGGFKKFIA----EEIDVTGASR 114

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            IT+ E  ECK  G+ D  E  +  DG+ ++++  +  +  +TV +L K  A+    D K
Sbjct: 115 PITEKEAAECKAKGI-DYVEFQVAIDGLTVVINPANTFAECMTVAELNKIWAA----DSK 169

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           V      KWSE+R  +P+  I ++      GT                         F Y
Sbjct: 170 V-----SKWSEVREGWPDEPIQLFGADTASGT-------------------------FDY 199

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI- 265
             + ++    S R D  A   D    + +     +K   G+ G +++  NA  LK V I 
Sbjct: 200 FTEVINGKAKSSRSDYTANSNDNILVQGVVD---SKGALGYFGYAYFAENASKLKAVKIS 256

Query: 266 DG-----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           DG     + P+  TI SG Y P+SRPL  Y  +        + E++ F +S++
Sbjct: 257 DGKKAVCVEPTPATIESGEYTPLSRPLFIYTTKAKLKRPE-VAEFIKFLLSEK 308


>gi|323464357|gb|ADX76510.1| phosphate binding protein [Staphylococcus pseudintermedius ED99]
          Length = 319

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/306 (24%), Positives = 132/306 (43%), Gaps = 54/306 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           ++  GSST+ P  + + E+FS    +     V SG +  G K+F  G      D  N+SR
Sbjct: 43  VKGNGSSTVAPIIEKLNEDFSSSHDKATVENVTSG-TGDGFKQFIAG----KTDFSNASR 97

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146
            I   E ++ +  G+ D  E  +  DG+ +  ++D   +  +++EDL K           
Sbjct: 98  PIKDEEKEQLEDKGI-DYTEFKVARDGLTIAVNKDNDFLKEISLEDLKK----------- 145

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           +     KKWS++  D+P+  I  + P   HGT +   ++V+ +  +++            
Sbjct: 146 IYSGEAKKWSDVDSDYPDKPIKAFSPDQSHGTYDFFTEEVMDDVDIQAE----------- 194

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             Q   V   SV+                     NK+  GF   +FYK N + LK V + 
Sbjct: 195 KNQNTDVIVKSVQD--------------------NKEGIGFFAYNFYKENENSLKAVKVK 234

Query: 267 G-----IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           G     I P+  +I  G YP+SRPL  Y   +   S     E++ F++ ++  A +++  
Sbjct: 235 GDDGKAIGPNQKSIQDGSYPLSRPLFIYANNKKLKSNDVFAEFMKFTLENKGKAAEAKGV 294

Query: 322 QYGLIP 327
            Y  +P
Sbjct: 295 DYVALP 300


>gi|298505213|gb|ADI83936.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Geobacter sulfurreducens KN400]
          Length = 342

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/332 (24%), Positives = 152/332 (45%), Gaps = 55/332 (16%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           A   ++I GSST++P ++ +AE F +         V   G+  G K+FCRG     ID+ 
Sbjct: 34  ADKLVKIDGSSTVYPITEAVAEEFQKAKRGAVKVTVGISGTGGGFKKFCRG----EIDLS 89

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLI 142
            +SR I + E++ CK+ G+  I E+ + +D + +V +     V S+TV++L K       
Sbjct: 90  GASRPILKKEMEACKQAGIQYI-ELPVAYDALTVVVNPQNTWVKSMTVDELKK------- 141

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           + +      +  W+++ P +P   + ++ P    GT                        
Sbjct: 142 IWEPAAQGKITSWNQVNPAWPNQPLKLFGPGADSGT------------------------ 177

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
            F Y  + +     S R D  A E D    + ++R   ++   G+ G ++Y  N+  LK 
Sbjct: 178 -FDYFTEAVVGKAKSSRGDFTASEDDNVLVQGVSR---DRGGLGYFGYAYYAENSKKLKA 233

Query: 263 VPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           VPI        + PS+ T+ +G Y P+SRP+  YV  +  +    ++E+V F ++    A
Sbjct: 234 VPIVEKAGKPAVSPSIDTVKNGSYQPLSRPIFIYVNAKSVDKPE-VKEFVDFYLN---QA 289

Query: 316 PD-SQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           P  ++  +Y  +P+ ++     + + A  K+G
Sbjct: 290 PKLTKAVKY--VPLPDKAYALAKSNFAKKKTG 319


>gi|311030800|ref|ZP_07708890.1| phosphate ABC transporter (phosphate-binding protein) [Bacillus sp.
           m3-13]
          Length = 328

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 78/317 (24%), Positives = 141/317 (44%), Gaps = 63/317 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + I GS T+FP+  ++AE +     E  +  V   G+S G K+F     +D  D  ++SR
Sbjct: 51  VVIDGSGTVFPFMSVMAEKYMTEAQEGVSVEVSRAGTSAGFKKFLV---EDGTDFNDASR 107

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            I   E  + ++ G+ D++E+ +  DG+ +V +++         D    L    I+D  +
Sbjct: 108 AIKDEEKAQAEELGI-DVKELKVALDGLTIVINKE--------NDWATELTEQEIIDIFL 158

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE-----VLEKKVLQEGCVRSRNFSKMRD 202
                K WS++RP+FP+  I  Y P+  HGT E     +LE+K L EG    + +S + D
Sbjct: 159 AEGGKKNWSDVRPEFPDEPIKTYGPNENHGTYEFFWEVILEEKDLAEGTNLQQEYSTLVD 218

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
           +                                  +  +K+  GF G  +Y++N D L  
Sbjct: 219 L----------------------------------VSKDKNAIGFFGYGYYESNQDKLTA 244

Query: 263 VPID----GIVPSMGTIVS-GLYP-ISRPLLFYVKRQHFNSVLGLREYVSFSVSD-EMMA 315
           V +D     + PS+ TI   G Y   +RP+  Y+          + +Y  +++ + + +A
Sbjct: 245 VNVDFGNGPVAPSLDTIAEDGDYAGFTRPVFTYLNTNMAKEKPQVLDYAIYTMKNAQAVA 304

Query: 316 PDSQLFQYGLIPISNEE 332
            D+     G  P+++E+
Sbjct: 305 ADT-----GFAPLTDEQ 316


>gi|218245884|ref|YP_002371255.1| phosphate-binding protein [Cyanothece sp. PCC 8801]
 gi|257058932|ref|YP_003136820.1| phosphate binding protein [Cyanothece sp. PCC 8802]
 gi|218166362|gb|ACK65099.1| phosphate binding protein [Cyanothece sp. PCC 8801]
 gi|256589098|gb|ACU99984.1| phosphate binding protein [Cyanothece sp. PCC 8802]
          Length = 318

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/324 (25%), Positives = 153/324 (47%), Gaps = 48/324 (14%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R  I I GSST++P ++ +AE F +         V   G+  G K+FC G       I N
Sbjct: 33  RATISIDGSSTVYPVTEAVAEEFQKMKKGAVRVTVGVSGTGGGFKKFCNG----ETHISN 88

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIV 143
           +SR I ++E D CK  G++ I E+ + +D + +V +    +VS LT  +L K   +    
Sbjct: 89  ASRPIKKSEQDACKAKGINYI-ELPVAYDALTVVVNPQNKAVSDLTTAELKKMWQASSQG 147

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           +       +  W++IR  +P+ +  +Y P    GT +  ++++L +  +R ++F+   D 
Sbjct: 148 N-------VSSWNQIRASWPKDKFKLYGPGADSGTFDYFKEEILGDAGIR-KDFTPSED- 198

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                            D + ++           +  +K+  G+ G ++Y  N   LK V
Sbjct: 199 -----------------DNVLVQ----------GVSRDKNALGYFGFAYYDENKSRLKAV 231

Query: 264 PIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
            I+G++PS  T+ +G Y P+SRP+  YV  +   +   ++E+V++ +++   A  S+   
Sbjct: 232 KINGVMPSAQTVNNGKYKPLSRPIYIYVSSK-VAAKPEIKEFVNYYLTN--AAKFSKEVA 288

Query: 323 YGLIPISNEERKSVRDSIAVGKSG 346
           Y  IP+   +    +   A G+ G
Sbjct: 289 Y--IPLPAADYTKAKQRFANGQMG 310


>gi|313201600|ref|YP_004040258.1| phosphate-binding protein [Methylovorus sp. MP688]
 gi|312440916|gb|ADQ85022.1| phosphate binding protein [Methylovorus sp. MP688]
          Length = 334

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 151/337 (44%), Gaps = 55/337 (16%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T   A   ++I GSST++P ++ +AE F +         V   G+  G K+FCRG     
Sbjct: 23  TAHAAEKIVKIDGSSTVYPITEAVAEEFQKAKKGAIKVTVGISGTGGGFKKFCRG----E 78

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALA 138
            DI  +SR I + E+D CK+ G+  I E+ + +D + ++V+ ++    S+TVE+L K  A
Sbjct: 79  TDISEASRPILKKEMDACKEAGIQYI-ELPVAYDALTVVVNPKNDWIKSITVEELNKMWA 137

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                        +K W ++   +P+  + ++ P    GT +   + V+ +      +F+
Sbjct: 138 P-------AAQGSVKTWKQVNATWPDKPLKLFGPGADSGTFDYFTEAVVGKAKSSRGDFT 190

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
              D              +V   G++ ++ G                G+ G +++  N D
Sbjct: 191 ASED-------------DNVLVQGVSSDIGG---------------LGYFGYAYFDENRD 222

Query: 259 VLKLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
            L+ VPI        + PS  T+++G Y P+SRPL  YV          ++E+++F +++
Sbjct: 223 KLRAVPIVAKTGAPAVSPSPETVMNGTYQPLSRPLFIYVNATAGAFKPEVKEFINFYLAN 282

Query: 312 EMMAPDSQLFQYGLIPISN-----EERKSVRDSIAVG 343
              A  ++  +Y  +P S      E  KS++     G
Sbjct: 283 --AAALTKEVKYVPLPASEYAAVVEHWKSLKPGTGFG 317


>gi|253999565|ref|YP_003051628.1| phosphate-binding protein [Methylovorus sp. SIP3-4]
 gi|253986244|gb|ACT51101.1| phosphate binding protein [Methylovorus sp. SIP3-4]
          Length = 334

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 151/337 (44%), Gaps = 55/337 (16%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T   A   ++I GSST++P ++ +AE F +         V   G+  G K+FCRG     
Sbjct: 23  TAHAAEKIVKIDGSSTVYPITEAVAEEFQKAKKGAIKVTVGISGTGGGFKKFCRG----E 78

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALA 138
            DI  +SR I + E+D CK+ G+  I E+ + +D + ++V+ ++    S+TVE+L K  A
Sbjct: 79  TDISEASRPILKKEMDACKEAGIQYI-ELPVAYDALTVVVNPKNDWIKSITVEELNKMWA 137

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                        +K W ++   +P+  + ++ P    GT +   + V+ +      +F+
Sbjct: 138 P-------AAQGSVKTWKQVNATWPDKPLKLFGPGADSGTFDYFTEAVVGKAKSSRGDFT 190

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
              D              +V   G++ ++ G                G+ G +++  N D
Sbjct: 191 ASED-------------DNVLVQGVSSDIGG---------------LGYFGYAYFDENRD 222

Query: 259 VLKLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
            L+ VPI        + PS  T+++G Y P+SRPL  YV          ++E+++F +++
Sbjct: 223 KLRAVPIVAKTGAPAVSPSPETVMNGTYQPLSRPLFIYVNATAGAFKPEVKEFINFYLAN 282

Query: 312 EMMAPDSQLFQYGLIPISN-----EERKSVRDSIAVG 343
              A  ++  +Y  +P S      E  KS++     G
Sbjct: 283 --AAALTKEVKYVPLPASEYAAVVEHWKSLKPGTGFG 317


>gi|158341427|ref|YP_001522592.1| phosphate transporter binding protein [Acaryochloris marina
           MBIC11017]
 gi|158311668|gb|ABW33278.1| phosphate transporter binding protein [Acaryochloris marina
           MBIC11017]
          Length = 754

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 89/329 (27%), Positives = 149/329 (45%), Gaps = 54/329 (16%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           +  I I GSS++FP S++IAE F     + K   V   G+  G K+FC G      +I +
Sbjct: 456 KGSIAIDGSSSVFPISEVIAEEFQSVNKDVKIT-VGISGTGGGFKKFCSG----ETEISD 510

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKALASYLIV 143
           +SR I Q E+  C K+ +  I E+ + +D + +V  +D   +  +T  +L  A +     
Sbjct: 511 ASRPIKQREIALCAKNNIEYI-ELPVAYDVLSVVVHKDNDWADCMTTNELKTAWS----- 564

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
             K     + KW+++ P++P+V + +Y P    GT +   + +  E   R  +F+     
Sbjct: 565 --KSAQGNISKWNQVNPNYPDVPLTLYGPGTDSGTFDYFNEAITGEEGSRG-DFA----- 616

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                       TS   + I   V GD           K+  G++G  +Y+ N D LK V
Sbjct: 617 ------------TSEDNNTIVRGVSGD-----------KNAMGYLGYVYYEENKDSLKAV 653

Query: 264 PIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
            ID     I PS  TI  G Y P++RP+  YV +   +    ++ ++ F ++ +    + 
Sbjct: 654 QIDDGDGCIAPSDETISKGTYSPLARPMFIYVSKVAIDRP-EVKSFIEFYLNPK----NR 708

Query: 319 QLF-QYGLIPISNEERKSVRDSIAVGKSG 346
           QL    G IP+S+E           GK+G
Sbjct: 709 QLVANVGYIPLSDEIYAKALARFQEGKTG 737


>gi|172036774|ref|YP_001803275.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
 gi|171698228|gb|ACB51209.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
          Length = 340

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 82/342 (23%), Positives = 155/342 (45%), Gaps = 61/342 (17%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           V C +   +++ I I GSST++P +K + E++ +         V+  G+  G ++FC G 
Sbjct: 26  VSCASPELSKS-ITIDGSSTVYPITKAVVESYQQTVENPVEVMVDFSGTGGGFRKFCEG- 83

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLY 134
                DI N+SR I ++E+  C ++ V  I E+ I  D + +V +     V SLT E+L 
Sbjct: 84  ---KTDINNASRPILKDEMALCNRNNVRYI-ELPIAFDALTIVVNPQNTWVESLTTEELR 139

Query: 135 KALASYLIVDDKVVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQE 189
           K            ++ P     + +W+++RP+FP+  + +Y P    GT +   + ++  
Sbjct: 140 K------------IWQPEAEKTITRWNQVRPEFPDQPLTLYGPGTDSGTYDYFTEAIMGT 187

Query: 190 GCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVG 249
                 ++                    VR +   I V G        ++ + +  G+ G
Sbjct: 188 EDSSRTDY--------------------VRSENDEILVQG--------VKQDPNALGYFG 219

Query: 250 LSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREY 304
           L++Y+ +   LK + ID     ++PS  ++    Y P++RPL  YV      +   LRE+
Sbjct: 220 LAYYEAHPTELKAIAIDSGKGAVLPSSESVKDSQYQPLARPLFIYVNLASAQNNPSLREF 279

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           + F ++    AP + + + G IP+  E     + +   G++G
Sbjct: 280 IDFYLA---QAP-TLVEKVGYIPLPIEAYDLDKVTFHKGEAG 317


>gi|229075976|ref|ZP_04208952.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock4-18]
 gi|229117768|ref|ZP_04247137.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock1-3]
 gi|228665745|gb|EEL21218.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock1-3]
 gi|228707291|gb|EEL59488.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock4-18]
          Length = 305

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 133/307 (43%), Gaps = 46/307 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F++   F+   +           +R+ GSST+FP  + +AE +++  P  K   +   G+
Sbjct: 11  FILSTWFLCFGISTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKEHPNVKIS-ISVSGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E K + +       + +DG+ +V +R   
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEENEMKNNSIQ-FTPFEVAYDGLTIVVNRHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V ++TV++L       L  +D       K+WS++   +P  ++  Y P    GT +  +
Sbjct: 125 WVDNMTVDEL-----RLLWSED----GREKRWSQVHSTWPRAQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K+
Sbjct: 176 NVILQNRRI--------------------VKKVSLSEDDQVI---------MQGVMHDKN 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SR L  YV        + + 
Sbjct: 207 AIAFVGYAYYMANRDRVKAIKVNGVFPTKETIQSGDYKPLSRSLFTYVNDASIRQKINVA 266

Query: 303 EYVSFSV 309
            YV F +
Sbjct: 267 NYVEFMI 273


>gi|288931341|ref|YP_003435401.1| phosphate binding protein [Ferroglobus placidus DSM 10642]
 gi|288893589|gb|ADC65126.1| phosphate binding protein [Ferroglobus placidus DSM 10642]
          Length = 317

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 138/293 (47%), Gaps = 51/293 (17%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEF-CRGIGDDTIDIVNS 85
            +++AGSST++P +  +AE F++ +P      V+S G+  G K F   G  D    I ++
Sbjct: 32  EVKVAGSSTVYPITIAMAEEFNKLYPNVVVS-VQSTGTGGGFKNFFIPGYAD----INDA 86

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIV 143
           SR I   EL+  KK+GV  I E  + +D + ++   + D V   L+ E+L K      I 
Sbjct: 87  SRPIKPEELEAAKKNGVEPI-EFLVAYDALTVIVNPENDWVDC-LSFEELRK------IW 138

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
             +   N + KWS++ P++P+  + +Y P+   GT +   + V+ +     +++      
Sbjct: 139 GPEATGN-ITKWSDVNPEWPDEEMHLYGPTSASGTFDFFTEVVIGKEDAHRKDYH----- 192

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                           +D   I+           +E ++   G++GL++Y  N D +K V
Sbjct: 193 -------------GTEEDNTIIQA----------VERDRYAMGYLGLAYYLENKDKVKAV 229

Query: 264 PIDG-----IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
            I       + PS+ T  SG YP++RPL  YV ++       +RE+V F + +
Sbjct: 230 KIKNEKGVCVEPSIETARSGEYPLTRPLYIYVNKESLKKP-AVREFVRFYLEN 281


>gi|22299707|ref|NP_682954.1| periplasmic phosphate-binding protein of phosphate ABC transporter
           [Thermosynechococcus elongatus BP-1]
 gi|22295891|dbj|BAC09716.1| periplasmic phosphate-binding protein of phosphate ABC transporter
           [Thermosynechococcus elongatus BP-1]
          Length = 374

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 122/272 (44%), Gaps = 54/272 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           IRI GSST++P ++  AE F +         V   G+  G K+FCRG      DI N+SR
Sbjct: 74  IRIDGSSTVYPLTEAAAEAFQKAEGGKIRVTVGISGTGGGFKKFCRG----ETDISNASR 129

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I   E+  CK  G+  I E+ + +D + ++V+ ++  + SLTV +L            K
Sbjct: 130 PILAKEMAACKAAGIQYI-ELPVAYDALTVVVNPQNTWAKSLTVAEL------------K 176

Query: 147 VVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            ++ P   +  WS++R  FP + + ++      GT                         
Sbjct: 177 RIWEPNSKINNWSQVRQGFPNIPLKLFGAGADSGT------------------------- 211

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           F Y  + ++      R+D  A E D    + ++R    +   G+ G ++Y  N + LK V
Sbjct: 212 FDYFTEAINGKSKVSRKDYTASEDDNVLVQGVSR---ERGALGYFGYAYYAENKNKLKAV 268

Query: 264 PIDG----IVPSMGTIVSGLY-PISRPLLFYV 290
            ID     + PS  T++ G Y P+SRP+  YV
Sbjct: 269 SIDNGKGPVAPSEKTVIDGTYQPLSRPIFIYV 300


>gi|160903361|ref|YP_001568942.1| phosphate binding protein [Petrotoga mobilis SJ95]
 gi|160361005|gb|ABX32619.1| phosphate binding protein [Petrotoga mobilis SJ95]
          Length = 274

 Score = 94.0 bits (232), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 148/305 (48%), Gaps = 53/305 (17%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           VL+ FV++ +     +FA   + + GS+T+FP +++  E   + +P+  T  +E  GSS 
Sbjct: 4   VLLTFVLVGI--ALFSFAETLV-LKGSNTIFPVAQLWIEELKDMYPDL-TITLEGAGSST 59

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G+     G    T DI NSSR +  +EL++  + G   I  V +G+DGI ++ + ++   
Sbjct: 60  GIAALFNG----TTDIANSSRWLKDSELEQMHEEGKYFI-PVVLGYDGIAVIVNPNLGID 114

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
            +T+E+L            K+    + +W+++ P+ P  RI +Y  +   GT E   +KV
Sbjct: 115 DITIEEL-----------AKIYTGEITRWNQLSPNLPGQRIVVYSRNTASGTYETFVEKV 163

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           L EG  R     +M +  +  +Q       +V Q+  AI   G                G
Sbjct: 164 L-EGK-RMTPTVQMLESTQAEIQ-------AVAQNMYAIAYTG---------------VG 199

Query: 247 FVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG-LREYV 305
           +V         D +K++ ++G+ P+   I++ +YPISRPL  +V   +     G +++Y+
Sbjct: 200 YV--------TDDVKVLSVEGVQPTKLNILNSVYPISRPLYMFVDATNGYPETGPVKQYL 251

Query: 306 SFSVS 310
           +F +S
Sbjct: 252 TFGLS 256


>gi|156744215|ref|YP_001434344.1| phosphate binding protein [Roseiflexus castenholzii DSM 13941]
 gi|156235543|gb|ABU60326.1| phosphate binding protein [Roseiflexus castenholzii DSM 13941]
          Length = 369

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 124/275 (45%), Gaps = 47/275 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST++P +++  + F+   P        SG +  G K+FC GI     DI N+SR
Sbjct: 69  IIIDGSSTVYPITELAMQQFAAVAPRVTIQLGVSG-TGGGFKKFCAGI----TDISNASR 123

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV-SVSLTVEDLYKALASYLIVDDK 146
            I  +E D C+ +G++ + E+ +  DGI ++ +RD   +  +TV+DL +  A        
Sbjct: 124 PIKPDESDTCRANGIAFV-EIPVAFDGISVIINRDNTWAQCMTVDDLKRMWAPE------ 176

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W +IR D+P+    +Y P    GT +     ++ +                 
Sbjct: 177 -SEGSVTTWRQIRSDWPDQPFKLYAPGVDSGTHDYFTAAIVGKE---------------- 219

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                     + R D I  E   DY   + R+  +     +VG ++Y+  AD + +V +D
Sbjct: 220 ---------DASRNDYIGSE--DDYV-LMQRVIEDAQGIAYVGYAYYQEYADKVGVVAVD 267

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
                + PS+ TI  G Y P+SRPL  YV+    +
Sbjct: 268 AGQGCVSPSLTTITEGTYTPLSRPLFIYVRADRLD 302


>gi|257093589|ref|YP_003167230.1| phosphate-binding protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257046113|gb|ACV35301.1| phosphate binding protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 334

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/286 (26%), Positives = 127/286 (44%), Gaps = 47/286 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           ++I GSST+FP ++ +AE F +         V   G+  G K+FCRG      D+ N+SR
Sbjct: 32  VKIDGSSTVFPITEAVAEEFQKAKRGAVNVTVGISGTGGGFKKFCRG----ETDVANASR 87

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I + E+D+C K G+    E+ I +D + ++V+ ++    S++V +L K       + + 
Sbjct: 88  PILKKEMDDCAKAGIR-YYEMPIAYDALTVMVNPQNAFIKSMSVAELKK-------IWEP 139

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W ++ P +P+ +I +Y      GT                         F Y
Sbjct: 140 GAQGKINSWKDVNPAWPDQKIKLYGAGSDSGT-------------------------FDY 174

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             + +     S R D  A E D    +    I  +K   G+ G ++Y  N   LK V ID
Sbjct: 175 FTEAIVGKAKSSRGDYTASEDDNVLVQG---ISGDKGALGYFGFAYYIENQKKLKAVAID 231

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
           G    + P+   + +G Y P+SRP+  YV  +       ++E+V F
Sbjct: 232 GGKGPVAPTPENVDNGSYQPLSRPIFIYVSEKSLEKPE-VKEFVEF 276


>gi|218248788|ref|YP_002374159.1| phosphate-binding protein [Cyanothece sp. PCC 8801]
 gi|257061847|ref|YP_003139735.1| phosphate binding protein [Cyanothece sp. PCC 8802]
 gi|218169266|gb|ACK68003.1| phosphate binding protein [Cyanothece sp. PCC 8801]
 gi|256592013|gb|ACV02900.1| phosphate binding protein [Cyanothece sp. PCC 8802]
          Length = 340

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 83/342 (24%), Positives = 157/342 (45%), Gaps = 61/342 (17%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           V CG+     + I I GSST++P ++ + E++ +      T  +   G+  G +EFC G 
Sbjct: 26  VSCGSPELPES-ITIDGSSTVYPITQAVVESYKQTAKNPVTITLSVSGTGGGFREFCEG- 83

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLY 134
                DI N+SR I + E+  C ++ V  I E+ I  D + ++V+ ++    ++T E+L 
Sbjct: 84  ---KTDISNASRPILREEMTLCNRNNVRYI-ELPIAFDALTVVVNPQNTWLDTITTEEL- 138

Query: 135 KALASYLIVDDKVVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQE 189
                      K ++ P     + +W++IR + P   + +Y P    GT +   + ++  
Sbjct: 139 -----------KRIWQPEAGDTITRWNQIRQELPNQPLNLYGPGIDSGTYDYFTEAIV-- 185

Query: 190 GCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVG 249
                +  S   D F+    ++ VA  +V+QD                     +  G+ G
Sbjct: 186 ----GKAHSSRLDYFQSENDEIIVA--AVKQD--------------------PNALGYFG 219

Query: 250 LSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREY 304
           L++Y+ +A  LK + ID     + PS  ++ +  Y P++RPL  YV      +   LRE+
Sbjct: 220 LAYYEAHAKELKALAIDNGKGAVAPSRESVETAQYQPLARPLFIYVNLASAQNNTSLREF 279

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           + F ++    AP + + + G IP+  E  +  + +   G++G
Sbjct: 280 IDFYLA---QAP-TLVPKVGYIPLPQEAYQLDKITFHKGEAG 317


>gi|229104901|ref|ZP_04235560.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-28]
 gi|228678531|gb|EEL32749.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-28]
          Length = 305

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 74/307 (24%), Positives = 133/307 (43%), Gaps = 46/307 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F++   F+   +           +R+ GSST+FP  + +AE +++  P  K   +   G+
Sbjct: 11  FILSTWFLCFGMSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKEHPNVKIS-ISVSGT 69

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G   F +G     +DI N+SR + Q E +E K + +       + +DG+ +V +R   
Sbjct: 70  GGGFNRFSKG----EVDINNASRVMKQVEENEMKNNSIQ-FTPFEVAYDGLTIVVNRHNT 124

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            V ++TV++L       L  +D       K+WS++   +P  ++  Y P    GT +  +
Sbjct: 125 WVDNMTVDEL-----RLLWSED----GREKRWSQVHSTWPRAQVKFYAPGVDSGTYDYFQ 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +LQ   +                    V   S+ +D   I         +  +  +K+
Sbjct: 176 NVILQNRRI--------------------VKKVSLSEDDQVI---------MQGVMHDKN 206

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
              FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SR L  YV        + + 
Sbjct: 207 AIAFVGYAYYMANRDRVKAIKVNGVFPTKETIQSGDYKPLSRSLFTYVNDASIRQKINVA 266

Query: 303 EYVSFSV 309
            YV F +
Sbjct: 267 NYVEFMI 273


>gi|309790668|ref|ZP_07685219.1| phosphate binding protein [Oscillochloris trichoides DG6]
 gi|308227262|gb|EFO80939.1| phosphate binding protein [Oscillochloris trichoides DG6]
          Length = 367

 Score = 93.6 bits (231), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 83/296 (28%), Positives = 139/296 (46%), Gaps = 56/296 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSE--YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
           I  AGSST+FP S+ +AE F++  Y  +     ++S GS  G + FC  +  +T DI N+
Sbjct: 96  IIAAGSSTVFPLSERMAEIFNDDGYTGQIT---IDSIGSGAGFERFC--VAAET-DIANA 149

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIV 143
           SR I   E++ CK +G + I E  +G D + +V  S+ D ++  LT+E L          
Sbjct: 150 SRAIKAEEIEACKGNGRTPI-EFRVGTDALAVVVSSENDFLT-GLTMEQLA--------- 198

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQ--EGCVRSRNFSKMR 201
              V     K W+++ P +P   I ++ P    GT +   + VL+  E  + + N     
Sbjct: 199 --AVFSGEAKTWADVDPSYPAEAIQLFSPGTDSGTFDYFVEAVLEKDEAKILAAN----- 251

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                   QLS        D + ++           IE +    G+ G ++Y  N  +LK
Sbjct: 252 -------PQLS------EDDNVLVQ----------GIEGSPYAIGYFGYAYYLENKGMLK 288

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSF---SVSDEMM 314
           ++ IDG+ P+  T   G YP+SRPL  Y      +    +  +++F   +V+DE++
Sbjct: 289 ILDIDGVTPTEVTAEDGTYPLSRPLYIYSDATIMSEKPQVAAFINFYLTNVNDEVV 344


>gi|327439645|dbj|BAK16010.1| ABC-type phosphate transport system, periplasmic component
           [Solibacillus silvestris StLB046]
          Length = 323

 Score = 93.2 bits (230), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 129/283 (45%), Gaps = 48/283 (16%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P ++ + E ++    + +   V   G+  G ++F  G      D  N+SR I  
Sbjct: 57  GSSTVAPITEALVEEYAGVQKDVRVA-VGVSGTGGGFEKFING----ETDFSNASRPIKD 111

Query: 92  NELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFN 150
            E++E K  GV +  E  + +DG+ ++V   +  +  LTV+ L K     + ++D     
Sbjct: 112 TEMEELKNAGV-EYTEFELAYDGLSVVVHPENTWAKDLTVDQLKK-----IWIED----G 161

Query: 151 PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQ-EGCVRSRNFSKMRDMFKYNVQ 209
             KKWS+I P +P+  I  Y P    GT +  ++ +L  E  V++   S+  ++      
Sbjct: 162 STKKWSDIDPSWPDEEIVFYSPGSDSGTYDYFDEVILDGEDIVKTATLSEDDNVL----- 216

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV 269
                                    +  +  +K+  G+ G ++Y  N D L++V +DG+ 
Sbjct: 217 -------------------------VQGVTADKNAIGYFGYAYYLENKDKLQVVTVDGVE 251

Query: 270 PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           P+  TI SG Y P+SRPL  YVK           +++ F++ +
Sbjct: 252 PTNETIESGEYSPLSRPLFVYVKNSALKDNEATYDFMKFTLEN 294


>gi|284165750|ref|YP_003404029.1| phosphate binding protein [Haloterrigena turkmenica DSM 5511]
 gi|284015405|gb|ADB61356.1| phosphate binding protein [Haloterrigena turkmenica DSM 5511]
          Length = 324

 Score = 93.2 bits (230), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 91/323 (28%), Positives = 145/323 (44%), Gaps = 57/323 (17%)

Query: 20  TGTFARN--RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
           +G FA    ++ +AGSST+FP ++ IA  FSE  P       ++G        FC G   
Sbjct: 34  SGVFAAEGKQVNVAGSSTVFPVTEAIASAFSEKNPTVNISLSKTGTGGGFGNFFCAG--- 90

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKA 136
              DI N+SR+I   E+++C  + V+ I E  I  D + +V + +   V  LTVE L + 
Sbjct: 91  -RTDINNASREIADAEIEQCGNNDVTPI-EFQIATDALTVVVNPEADWVDCLTVEQLQEI 148

Query: 137 LASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL-QEGCVRSR 195
             +          +  ++WS++  ++P+  I +Y  +   GT +   + VL +E   RS 
Sbjct: 149 WRT----------DGAQRWSDLNDEWPDEEIELYGAATTSGTFDYFNEAVLGEELNHRSD 198

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
            ++  RD                    I   V G  T             G+ G S+Y  
Sbjct: 199 YYATERDRT------------------IVQGVRGSET-----------AMGYFGFSYYSE 229

Query: 256 NADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVS 310
           N D +K V ID     + PS+ T +SG Y P+SRPL  YV ++       +R +V F + 
Sbjct: 230 NPDSIKAVSIDSGDGCVEPSIETAMSGKYTPLSRPLFIYVAKESLTKP-AVRNFVRFYM- 287

Query: 311 DEMMAPDSQLFQYGLIPISNEER 333
            E  A D  +   G +PI+ ++R
Sbjct: 288 -EQAATD-LVSDVGYVPITEDKR 308


>gi|254467856|ref|ZP_05081262.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [beta proteobacterium KB13]
 gi|207086666|gb|EDZ63949.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [beta proteobacterium KB13]
          Length = 329

 Score = 93.2 bits (230), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 90/350 (25%), Positives = 155/350 (44%), Gaps = 69/350 (19%)

Query: 12  VVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG--------G 63
            V      T  FA + ++I GSST++P ++ +AE F +          E+G        G
Sbjct: 12  TVASTVISTSVFAADIVKIDGSSTVYPITEAVAEEFQK----------ETGIKVTVGVSG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           +  G K+FCRG   +T+ I ++SR I   E+ +C + G+S I E+ +  D + +V ++D 
Sbjct: 62  TGGGFKKFCRG---ETV-ISDASRPIKAKEIAKCNEAGISFI-EIPVAFDALTVVINKDN 116

Query: 124 -VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
             +  +T E+L KA         KV+      W+++R  FP+  + +Y P    GT    
Sbjct: 117 DWAAEMTPEELKKAWGP--DAQGKVM-----NWNQVREGFPDQPLKLYGPGADSGT---- 165

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
                                F Y  + +     S+R D  A E D    + +A    +K
Sbjct: 166 ---------------------FDYFTEAIIKKSKSIRGDFTASEDDNVLVQGVAG---DK 201

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDG-----IVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
              G+ GL++Y  N D L  V +       + PS+ T++ G Y P+SRPL  Y+      
Sbjct: 202 GGMGYFGLAYYVENKDKLGAVKVKNKEGKFVEPSLETVMDGSYNPLSRPLFIYLNATKAA 261

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
               ++++V F + +          + G +P SNEE  ++++     K+G
Sbjct: 262 FDPKVKKFVEFYLENAGKLSK----EVGYVPFSNEEYTAIKNHYKSLKTG 307


>gi|217968822|ref|YP_002354056.1| phosphate binding protein [Thauera sp. MZ1T]
 gi|217506149|gb|ACK53160.1| phosphate binding protein [Thauera sp. MZ1T]
          Length = 326

 Score = 92.8 bits (229), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 72/294 (24%), Positives = 132/294 (44%), Gaps = 47/294 (15%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T   A + +++ GSST++P ++ +AE+F +         V   G+  G K+FCRG     
Sbjct: 16  TSVQAESLVKVDGSSTVYPVTEAVAEDFQKSVKGEIKVTVGISGTGGGFKKFCRG----E 71

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
           ID+ N+SR I + E+++C K G++   E+ +  D + +V + +     L+V  L K    
Sbjct: 72  IDVANASRPILKKEMEDCAKEGIT-YYELPVAFDALTVVVNPNSKITQLSVAQLKKMW-- 128

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
                +      +  W+++ P FP+  + ++      GT                     
Sbjct: 129 -----EPDAQGKVSNWNQVDPSFPDAPLNLFGAGSDSGT--------------------- 162

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
               F Y  + ++    + R D  A E D    + ++R +VN    G+ G ++Y  N   
Sbjct: 163 ----FDYFTEAINGKSKASRGDYTASEDDNVLVQGVSR-DVN--AIGYFGYAYYAENQGK 215

Query: 260 LKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
           LK V I     D ++PS  +++ G Y P++RP+  YV  +       +R++V F
Sbjct: 216 LKAVAIVNAKGDAVLPSEKSVIDGSYNPLARPIFIYVSAKALERAE-VRQFVDF 268


>gi|219847437|ref|YP_002461870.1| phosphate binding protein [Chloroflexus aggregans DSM 9485]
 gi|219541696|gb|ACL23434.1| phosphate binding protein [Chloroflexus aggregans DSM 9485]
          Length = 361

 Score = 92.8 bits (229), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 129/276 (46%), Gaps = 59/276 (21%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+I GSST+FP ++ +A  F+E  P+       SG +  G   FC G      DI N+SR
Sbjct: 61  IKIDGSSTVFPITERVALAFNELSPQVTIRLGVSG-TGGGFSRFCAG----ETDISNASR 115

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDD 145
            I Q+E++ C  +G++ + E+ +  DG+ +V     D V   LTV +L            
Sbjct: 116 PIKQSEMETCTANGITFV-ELPVAFDGLSVVVHPQNDWVQC-LTVAEL------------ 161

Query: 146 KVVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
           K +++P     + +W++IR D+P+  + +Y      GT +     ++ +  +  R+++  
Sbjct: 162 KRMWSPEAETVITRWNQIRADWPDAPLHLYGAGTDSGTYDYFTSAIVGQEGISRRDYTAS 221

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
            D +                  +A +V GD           +   GF G ++Y   AD L
Sbjct: 222 EDDYL-----------------LAQDVAGD-----------QFGLGFFGYAYYAEYADRL 253

Query: 261 KLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVK 291
           + V ID     + PS+ TI +G Y P++RP+  YV+
Sbjct: 254 RAVAIDNGNGCVAPSIETISNGQYQPLARPIFIYVR 289


>gi|16331544|ref|NP_442272.1| SphX protein precursor [Synechocystis sp. PCC 6803]
 gi|2498946|sp|Q55200|SPHX_SYNY3 RecName: Full=Protein sphX; Flags: Precursor
 gi|1001198|dbj|BAA10342.1| SphX protein precursor [Synechocystis sp. PCC 6803]
          Length = 336

 Score = 92.8 bits (229), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 89/334 (26%), Positives = 147/334 (44%), Gaps = 55/334 (16%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           +V M  ++L +   T +     I I GSST++P ++ I  +FS          VE  G+ 
Sbjct: 11  IVPMALLLLGISACTPSQTSQSIAINGSSTVYPITEAIVADFSGGKKGVDID-VEFSGTG 69

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD-RDMV 124
            G K FC G      DI ++SR I + E+  C  + V  + E+ I  D I +VS+ ++  
Sbjct: 70  GGFKLFCEG----KTDIADASRPINKQEMKLCNDNQVRYV-ELPIAFDAITVVSNPKNDW 124

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
             SLTVE+L +       + +      L +W+++RP+FP+  I +Y P    GT      
Sbjct: 125 LKSLTVEELKR-------IWEPAAEKTLTRWNQVRPEFPDQPINLYSPGEDSGT------ 171

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
                              F Y  + +     + R D +  E D    E L +  V +D+
Sbjct: 172 -------------------FDYFTEAIVGQAGASRLDTLKSEDD----EILVQ-GVVQDL 207

Query: 245 F--GFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNS 297
           +  G+ G ++Y+     LK + +D     ++PS  T+    Y P+SRPL  YV       
Sbjct: 208 YSLGYFGFAYYEGRIADLKAIGVDNGRGPVLPSRETVEKSEYQPLSRPLFIYVNATKAQD 267

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNE 331
              LRE+V F +++      +   + G IP+  E
Sbjct: 268 NPALREFVDFYLANA----SATATKVGYIPLPEE 297


>gi|205373989|ref|ZP_03226789.1| phosphate-binding protein [Bacillus coahuilensis m4-4]
          Length = 323

 Score = 92.8 bits (229), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 84/292 (28%), Positives = 129/292 (44%), Gaps = 55/292 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST++P  + +AE F    P      V   G+  G ++F  G       I ++SR
Sbjct: 50  ITIDGSSTVYPIMEAVAEEFMMANPNVNVT-VGLSGTGGGFEKFTAG----ETQISDASR 104

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDD 145
            I   E+      G+ +  E  + +DG+ +V  ++ D V   LTVE+L     + +  +D
Sbjct: 105 PIKDEEVQALADAGI-EWTEFKVANDGLSVVVNTENDWVDY-LTVEEL-----AMMWKED 157

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  KKWS+IR  +PE  I  Y P    GT +   +++L+E                
Sbjct: 158 GTA----KKWSDIREGWPEEEIKFYSPGTDSGTFDYFNEEILEE---------------- 197

Query: 206 YNVQQLSVACTSVRQDGIAIE-VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
              + +  A T    D + ++ V GD           K+  GF G ++Y  N D LK+VP
Sbjct: 198 ---EPMVEAATLSEDDNVLVQGVTGD-----------KNAIGFFGYAYYIENQDSLKVVP 243

Query: 265 IDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           ID     + P+  T+  G Y P+SRPL FYV          + EYV F + +
Sbjct: 244 IDNGEGPVEPTAETVEDGSYAPLSRPLFFYVDNAAVKDAH-VYEYVKFVIEN 294


>gi|149178900|ref|ZP_01857478.1| Phosphate binding protein [Planctomyces maris DSM 8797]
 gi|148842239|gb|EDL56624.1| Phosphate binding protein [Planctomyces maris DSM 8797]
          Length = 333

 Score = 92.8 bits (229), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 130/277 (46%), Gaps = 55/277 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           ++I GSST++P S+ +AE F    P+ +   V   G+  G+K+F  G     +DI ++SR
Sbjct: 57  VKIDGSSTVYPVSEAVAEEFRAVQPKVRVT-VGFSGTGGGMKKFIAG----EVDICDASR 111

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            + + E + CK+ G+  I E+++  DG+ ++V+ ++     LTV  L            K
Sbjct: 112 AMKEKEANACKEQGIEFI-ELSVSFDGLAVIVNPKNTWCDCLTVGQL------------K 158

Query: 147 VVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            ++ P   +K+W ++ P +P   I +Y P    GT +   + ++ E      +++   D 
Sbjct: 159 ELWRPESGVKQWKDLDPKWPAEDIKLYGPGTDSGTFDYFTEAIVGESKASRADYTASEDD 218

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                   +V  T V +D                    K+  G+ G ++Y+ N + LKL+
Sbjct: 219 --------NVLVTGVSED--------------------KNSLGYFGFAYYEENKEKLKLL 250

Query: 264 PIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
            +DG      PS+ T+    Y P+SRPL  YV++   
Sbjct: 251 GVDGGKGCKKPSLETVRDNSYAPLSRPLFIYVRKSSL 287


>gi|304407968|ref|ZP_07389618.1| phosphate binding protein [Paenibacillus curdlanolyticus YK9]
 gi|304342987|gb|EFM08831.1| phosphate binding protein [Paenibacillus curdlanolyticus YK9]
          Length = 308

 Score = 92.4 bits (228), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 92/339 (27%), Positives = 152/339 (44%), Gaps = 56/339 (16%)

Query: 6   VVLMCF-VVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           VV  C  +++    G  +  +  I I GSST++P ++ +AE F +   + +     SG  
Sbjct: 11  VVAACLSLMVSAQAGAASNLKGTIEIDGSSTVYPITEAVAEEFGKVHKDVRVTVGVSGTG 70

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
               K FC G     I I ++SR I+ +E D CK  G++   ++T+ +DGI +V +++  
Sbjct: 71  GG-FKRFCNG----EIAISDASRPISSSEKDACKAKGIT-YTDLTVAYDGITVVINKNNT 124

Query: 125 SVS-LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
             S LT  +L     S    D KV     K W+++R  FP+ +I IY P    GT +   
Sbjct: 125 WASKLTTAEL----KSIFQKDSKV-----KTWADVRKGFPDEKINIYSPGADSGTFDFFT 175

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV   G  +     K                T    D + +E           +  +K 
Sbjct: 176 EKV--NGKAKESRSDKQ--------------ITFSEDDNVLVE----------GVTKDKY 209

Query: 244 VFGFVGLSFYKNNADVLKLVPI---DG---IVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
             G+ G ++Y  N   LK V I   +G   + P+  TI +G Y +SRP+  YV ++   +
Sbjct: 210 AIGYFGYAYYVENKAKLKSVAIYMANGKTPVGPTPTTIATGKYFLSRPIFIYVSKKEL-A 268

Query: 298 VLGLREYVSFSVSDEMMAPDSQLF-QYGLIPISNEERKS 335
              ++E+  F      MA  ++L  + G IP+S+   KS
Sbjct: 269 RPEVKEFAKF-----YMAHGAELSKEVGYIPLSSGWYKS 302


>gi|315186297|gb|EFU20058.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Spirochaeta thermophila DSM 6578]
          Length = 310

 Score = 92.0 bits (227), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/306 (27%), Positives = 145/306 (47%), Gaps = 49/306 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           IRIAGSST++P +  +AE F+   P  +   V+S G+  G K F   I   T +I ++SR
Sbjct: 33  IRIAGSSTVYPITVAMAEEFNRVQPGVQIA-VQSTGTGGGFKNFF--IPGKT-EINDASR 88

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIVDDK 146
            I ++EL++ +  G  D  E  +  D + +V +     V  +T+E L          DD 
Sbjct: 89  PIKESELEQVRAQG-DDALEFQVAIDAVTVVVNPQADWVDDVTIEQLRHIWRP----DD- 142

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
               P +KWS++ P +P+    +Y P+   GT +   +KV+ E                 
Sbjct: 143 ----PAQKWSDVDPSWPDEPFELYGPTSASGTFDFFTEKVMGE----------------- 181

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             + LS      R D    E D    + ++    +K   G+ G+++Y  N + +K + ++
Sbjct: 182 --EDLS------RSDYQGTEEDNTIVQAVSG---SKYALGYFGMAYYLENTNRVKALKVN 230

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF-QYGL 325
           G+ PS+ T  +  YP+SRP+  YV++    S L   E  +F V   +   +S L  + G 
Sbjct: 231 GVAPSLETARTYEYPLSRPIFIYVRK----SALARPEVAAF-VRFYIERTNSDLISEIGY 285

Query: 326 IPISNE 331
           +P+++E
Sbjct: 286 VPVTDE 291


>gi|325971510|ref|YP_004247701.1| phosphate binding protein [Spirochaeta sp. Buddy]
 gi|324026748|gb|ADY13507.1| phosphate binding protein [Spirochaeta sp. Buddy]
          Length = 333

 Score = 92.0 bits (227), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 84/315 (26%), Positives = 144/315 (45%), Gaps = 49/315 (15%)

Query: 27  RIRIAGSSTLFPYSKIIAENF-SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
            I  AGSST++P S+ +AE F  E +    T  ++S GS  G + F   +  +T DI N+
Sbjct: 57  NIITAGSSTVYPLSERMAERFKQEGYSGVIT--IDSIGSGAGFERFT--VAGET-DIANA 111

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SR I   E++  K  G S I E  +G D + ++VS+++  + ++T E+L K         
Sbjct: 112 SRAIKAKEIEAAKLIGRSPI-EFRVGTDALAVVVSNQNTFAKNVTKEELAK--------- 161

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
              +F+  K WS++ P +P   I  ++P    GT +   ++V                 F
Sbjct: 162 ---LFSTAKNWSDVNPAWPNEPIQRFIPGTDSGTFDYFSEEV-----------------F 201

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           K N + +  A      +   I V G        I+ +    GF G ++Y  NAD L ++ 
Sbjct: 202 KNNPEPMLSAQNLQLSEDDNILVQG--------IKGSPYAVGFFGYAYYAENADSLSILS 253

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           I+ +  S   + +G YP++RPL  Y   Q   S   +  ++ F +S      + ++   G
Sbjct: 254 INSVQASKANVDNGTYPLARPLFIYSDAQIMRSKSQVAAFIDFYLS----YVNEEVIGVG 309

Query: 325 LIPISNEERKSVRDS 339
             P ++EE +  R +
Sbjct: 310 YFPANDEELEKGRQT 324


>gi|327540736|gb|EGF27305.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodopirellula baltica WH47]
          Length = 352

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 87/282 (30%), Positives = 120/282 (42%), Gaps = 60/282 (21%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I++ GSST+ P S  I E F +  P      V   G+  G K F     D   DI ++SR
Sbjct: 47  IKVDGSSTVQPISNAIREGFIKQHPNVDI-IVSGNGTGNGFKSFY----DKGTDISDASR 101

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSD--RDMVSVSLTVEDLYKALASYLIVDD 145
            I   E + CK +GV +  E+ + +DG+ +V +   D V   LTV+ L     S  + DD
Sbjct: 102 PIKSGEFENCKTNGV-EFVELPVAYDGLTIVVNPQNDWVK-ELTVDQL----KSMFVGDD 155

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT----REVLEKKVLQEGCVRSRNFSKMR 201
                  K WS++ P +PE  I IY P    GT     EVL KK  +E          +R
Sbjct: 156 AA-----KNWSDVDPSWPEEAIQIYAPGTGSGTYDYFHEVLAKKSKKE----------LR 200

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                N             D I ++   D          NK   GF G+++Y+ N D L+
Sbjct: 201 GDMNLN-----------EDDNILVKGVSD----------NKFSIGFFGVAYYEENKDKLR 239

Query: 262 LVPI----DGIV--PSMGTIVSGLY-PISRPLLFYVKRQHFN 296
            VP+    D +   P+   I S  Y P SRPL  YV     N
Sbjct: 240 AVPVVNPKDEVAYEPTTENIASNKYAPFSRPLFIYVNTDSLN 281


>gi|146309091|ref|YP_001189556.1| phosphate binding protein [Pseudomonas mendocina ymp]
 gi|145577292|gb|ABP86824.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Pseudomonas mendocina ymp]
          Length = 313

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/273 (27%), Positives = 123/273 (45%), Gaps = 49/273 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +RI GSST+FP ++  A  F       +   V+  G++ G + FC G      DI N+SR
Sbjct: 36  LRIDGSSTVFPLTREAARRFERTAGGSRIA-VDFSGTAAGFRRFCAG----ETDISNASR 90

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146
           +I   EL +C+ +G+ D + V +  D I +V +     V +++VE+L K  +        
Sbjct: 91  EINAEELAQCQANGI-DFRVVPLAMDAIAVVVNPANTWVDAISVEELKKLWS-------P 142

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                L  W ++RPD+P+  I ++      GT +V  + ++                   
Sbjct: 143 AAEKKLNSWRDLRPDWPDEPIVLFGRGQDSGTYDVFTQAIVG------------------ 184

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLAR-IEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                     S RQD  A E +    E LA+ I    +  GF G+  Y  + D LKLV +
Sbjct: 185 -------TTHSSRQDYQASEDE----EFLAKSIAAEPNALGFFGIGAYHRHWDELKLVAV 233

Query: 266 D----GIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           D     + P++ T+    Y P++RPL  YV ++
Sbjct: 234 DAGNGAVFPTLETVAQNRYQPLTRPLFLYVSQR 266


>gi|325982887|ref|YP_004295289.1| phosphate binding protein [Nitrosomonas sp. AL212]
 gi|325532406|gb|ADZ27127.1| phosphate binding protein [Nitrosomonas sp. AL212]
          Length = 338

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 72/299 (24%), Positives = 134/299 (44%), Gaps = 49/299 (16%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           A++ I+  GSST++P +K +A+ F           V   GS  G K+FCRG     IDIV
Sbjct: 25  AQSIIQTDGSSTVYPITKAVADKFQIVKKNTVNVTVSISGSGGGFKKFCRG----EIDIV 80

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILL-VSDRDMVSVSLTVEDLYKALASYLI 142
           N+SR I +NE+ +CK   +  + E+ +  D + + V+  +    ++T+ +L K       
Sbjct: 81  NASRPILKNEMQDCKNSRIQYV-EIPVAFDALTVAVNPENHWGTAMTLAELKK------- 132

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           + +      + +W +I P +P+  I +Y      GT +   K ++ +      ++++   
Sbjct: 133 IWEPAAQGTMTRWKQINPTWPDETIKLYGADPDSGTYDYFTKAIVGKAKSSRSDYTQ--- 189

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                      D  E +  +  +K+  GF G S+Y  N + +  
Sbjct: 190 -------------------------SPDDNELVNGVASDKNGLGFFGFSYYIENQNKVTA 224

Query: 263 VPID------GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           V ID       I P++ T+ +G Y P+SRP+  YV  +       ++E+V F + + ++
Sbjct: 225 VAIDNGKGQGAIPPAVETVENGSYQPLSRPVFIYVNVKAIEKP-EVKEFVEFYLKNALL 282


>gi|56751671|ref|YP_172372.1| phosphate transport system substrate-binding protein [Synechococcus
           elongatus PCC 6301]
 gi|81301253|ref|YP_401461.1| phosphate binding protein [Synechococcus elongatus PCC 7942]
 gi|56686630|dbj|BAD79852.1| phosphate transport system substrate-binding protein [Synechococcus
           elongatus PCC 6301]
 gi|81170134|gb|ABB58474.1| Phosphate binding protein [Synechococcus elongatus PCC 7942]
          Length = 337

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/307 (25%), Positives = 139/307 (45%), Gaps = 51/307 (16%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
            G G+     +++ GSST+FP  + +AE F +   + +   V   G+  G K+FC G   
Sbjct: 31  AGGGSALSGDVKVDGSSTVFPIGEAMAEEFQKSNGDVRV-TVGVSGTGGGFKKFCAG--- 86

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKA 136
              DI N+SR I  +E++ C+K+G+  + E+ + +D + ++V++ +  +  LT   L  A
Sbjct: 87  -ETDISNASRPIKSSEMELCQKNGIEYV-ELPVAYDALSVVVNNENNFATCLTPAQLKTA 144

Query: 137 LASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
                   D+     +  W++I P FP+  + +Y P    GT +  ++ V+ E   R  +
Sbjct: 145 W-------DEAAEGKISNWNQIDPSFPDTPLVLYGPGTDSGTYDYFKEAVIGEDGTRG-D 196

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
           F+   D                  D I ++           +E +    GF GL++ + N
Sbjct: 197 FTASED------------------DNIIVQ----------GVERSPGAMGFFGLAYLEEN 228

Query: 257 ADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN--SVLGLREYVSFS 308
           A  LK + I     D + PS+ T   G Y P+SRPL  Y+ +       V    EY+   
Sbjct: 229 AGKLKALNIQNSKGDCVAPSVETTRDGSYEPLSRPLFVYIAKSALEKPQVQAFAEYLVNP 288

Query: 309 VSDEMMA 315
            + +++A
Sbjct: 289 ANGKLVA 295


>gi|15789694|ref|NP_279518.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Halobacterium sp. NRC-1]
 gi|169235408|ref|YP_001688608.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Halobacterium salinarum R1]
 gi|10580062|gb|AAG18998.1| phosphate ABC transporter periplasmic phosphate-binding
           [Halobacterium sp. NRC-1]
 gi|167726474|emb|CAP13259.1| ABC-type transport system periplasmic substrate-binding protein
           (probable substrate phosphate) [Halobacterium salinarum
           R1]
          Length = 344

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 75/327 (22%), Positives = 142/327 (43%), Gaps = 56/327 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENF-----SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
           +  AGSST+FP +  ++E F      E  P+       +G        FC G      D+
Sbjct: 48  VDFAGSSTVFPLATTMSEAFRGGDTGEAHPDVNFNPKSTGTGGGFANHFCTG----NADL 103

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI 142
            N+SR++   E  +C  + +  + E T+  D + ++ + D+   S+TV++L    ++   
Sbjct: 104 NNASREVRDAEAQQCTDNDIEPV-EFTVATDALTVIVNTDLDIDSITVDELRSIWSAE-- 160

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
                     ++WS++ PD+P+  + +Y PS   GT +   + +L  G     + S    
Sbjct: 161 -------RDTEQWSDVNPDWPDEPLELYGPSSASGTYDYFIESILHGGDTELTHISGG-- 211

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                      + T   QD   I+           +E + +  G++G ++Y  + D +K 
Sbjct: 212 -----------SYTGTEQDRTIIQ----------GVEGSTNAMGYLGYAYYSKSDDRVKA 250

Query: 263 VPIDG-----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNS---VLGLREYVSFSVSDEM 313
           + +D      + PS+ T  SG Y P+SRPL  Y  +           LR ++  + S+ +
Sbjct: 251 LAVDDGDGEPVKPSLETARSGAYTPLSRPLFTYAAKSSLAEPAVAAFLRFWLEHATSEAI 310

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSI 340
           +A      Q G +P+S E ++   D++
Sbjct: 311 VAD-----QVGYVPLSQEAQREQLDAL 332


>gi|300711670|ref|YP_003737484.1| phosphate ABC transporter phosphate-binding protein
           [Halalkalicoccus jeotgali B3]
 gi|299125353|gb|ADJ15692.1| phosphate ABC transporter phosphate-binding protein
           [Halalkalicoccus jeotgali B3]
          Length = 368

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 74/292 (25%), Positives = 134/292 (45%), Gaps = 51/292 (17%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKE-FCRGIGDDTIDIVNS 85
           ++ IAGSST++P S+ +AE F    P+     V+S G+  G +  F  G      DI  +
Sbjct: 62  QVIIAGSSTVYPISQAMAEEFQRENPDVNIS-VDSTGTGGGFENAFIPG----DSDINGA 116

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIVD 144
           SR+I++ E    +++ ++ I E+ +G D +    + +   V  +T E+L +         
Sbjct: 117 SREISEEEQQAAEENDITPI-EMQVGSDALTFAVNNNADWVDCVTFEELAQIWGP----- 170

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                N  ++WS++R D+P+    +Y P+   GT +   + V+ EG     ++       
Sbjct: 171 -----NGAQQWSDVRDDWPDQPFELYGPATTSGTFDFFTETVIGEGGSHRSDYE------ 219

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                       S  QD I ++           IE +++  G+ G ++Y  N D +K + 
Sbjct: 220 ------------STEQDNIIVQ----------GIEGSENAMGYFGYAYYDENQDRIKGLS 257

Query: 265 IDG-----IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           IDG     + PS+ T  +G YP++RPL  YV          + E+V F +++
Sbjct: 258 IDGGNGSCVEPSLETAQAGDYPLARPLFIYVSESSLQENQAVEEFVRFYINN 309


>gi|300868504|ref|ZP_07113123.1| Protein sphX [Oscillatoria sp. PCC 6506]
 gi|300333493|emb|CBN58311.1| Protein sphX [Oscillatoria sp. PCC 6506]
          Length = 341

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 121/269 (44%), Gaps = 47/269 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+I GSST++P ++ +AE F +     +   V   G+  G K+FCRG      DI N+SR
Sbjct: 41  IKIDGSSTVYPVTEAVAEEFQKANRGVQV-TVGVSGTGGGFKKFCRG----ETDISNASR 95

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146
            I + E+ EC   G+  + E+ + +D + +V +     V SLTV +L K         + 
Sbjct: 96  PILKAEMQECASKGIKYM-ELPVAYDALTVVINPQNTWVKSLTVAELKKMW-------EP 147

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  WS+IR  FP   + ++ P    GT                         F Y
Sbjct: 148 GAQGKINNWSQIRSGFPNAPLKLFGPGTASGT-------------------------FDY 182

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             + +     S R D  A E D    + + R   +K+  G+ G ++Y+ N   LK VPI+
Sbjct: 183 FTEAIVGKSKSSRGDYTASEDDNVLVQGVTR---DKNAIGYFGFAYYEENKGKLKAVPIN 239

Query: 267 ----GIVPSMGTIVSGLY-PISRPLLFYV 290
                ++PS   + +G Y P+SRPL  YV
Sbjct: 240 SGKGAVLPSYQAVQNGTYTPLSRPLFIYV 268


>gi|163849117|ref|YP_001637161.1| phosphate binding protein [Chloroflexus aurantiacus J-10-fl]
 gi|222527090|ref|YP_002571561.1| phosphate binding protein [Chloroflexus sp. Y-400-fl]
 gi|163670406|gb|ABY36772.1| phosphate binding protein [Chloroflexus aurantiacus J-10-fl]
 gi|222450969|gb|ACM55235.1| phosphate binding protein [Chloroflexus sp. Y-400-fl]
          Length = 362

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 78/302 (25%), Positives = 131/302 (43%), Gaps = 48/302 (15%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             I+I GSST+FP ++ +A  F +  P+       SG +  G   FC G      DI N+
Sbjct: 60  GEIKIDGSSTVFPITERVAVAFGDLAPDVTIRLGVSG-TGGGFTRFCAG----ETDISNA 114

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SR I Q E+D C   G++ I E+ +  DG+ ++V  ++     LTV +L    A      
Sbjct: 115 SRPIKQKEIDACAASGITFI-ELPVAFDGLSVVVHPQNTWVDCLTVAELNLMWA------ 167

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                N + +W++IR ++P   + +Y      GT +     ++    V   +++   D +
Sbjct: 168 -PEATNRITRWNQIRAEWPAEPLHLYGAGVDSGTYDYFTSAIVGAEGVSRSDYTASEDDY 226

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                        + QD                +  ++   GF G ++Y   AD L+ V 
Sbjct: 227 L------------LAQD----------------VAADRLGLGFFGYAYYAEYADQLRAVA 258

Query: 265 IDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           ID     + P++ TIV G Y P+SRP+  YV+    N    +  +V F V +  M  +  
Sbjct: 259 IDNGQGCVAPTVKTIVDGSYQPLSRPIFIYVRADSLNRP-EIAAFVRFYVQNGAMFAEQA 317

Query: 320 LF 321
           L+
Sbjct: 318 LY 319


>gi|171058337|ref|YP_001790686.1| phosphate-binding protein [Leptothrix cholodnii SP-6]
 gi|170775782|gb|ACB33921.1| phosphate binding protein [Leptothrix cholodnii SP-6]
          Length = 334

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 75/293 (25%), Positives = 135/293 (46%), Gaps = 59/293 (20%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           ++I GSST+FP ++ +AE+F +         V   G+  G K+FCR    D IDI  +SR
Sbjct: 30  VKIDGSSTVFPITEGVAEDFQKSKKGAVKVTVGISGTGGGFKKFCR----DEIDISGASR 85

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSD-RDMVSVSLTVEDLYKALASYLIVDDK 146
            I + E+ +CK  GV +  E+ +  D + +V + ++     +TV +L            K
Sbjct: 86  PILKKEMADCKAAGV-EYFELPVAFDALTVVMNPKNAFLKQITVAEL------------K 132

Query: 147 VVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
            ++ P     + KW+++ P +P+  I ++      GT                       
Sbjct: 133 AIWEPAAQGKIMKWNQVNPAWPDAPIKLFGAGADSGT----------------------- 169

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
             F Y  + ++    + R D  A E D    + +++ +VN    G+ G ++Y  N   LK
Sbjct: 170 --FDYFTEAINGKSKASRGDFTASEDDNVLVQGVSQ-DVN--AIGYFGFAYYAENMARLK 224

Query: 262 LVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
            VPI        ++PSM T+++G Y P++RP+  YV  +   +   ++E++ F
Sbjct: 225 AVPIVEKAGKPAVLPSMETVLAGTYQPLARPIFIYVNAKSM-AKPEVKEFIDF 276


>gi|71909174|ref|YP_286761.1| phosphate binding protein [Dechloromonas aromatica RCB]
 gi|71848795|gb|AAZ48291.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Dechloromonas aromatica RCB]
          Length = 333

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/293 (26%), Positives = 131/293 (44%), Gaps = 59/293 (20%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+I GSST++P ++ +AE F +         V   G+  G K+FCR    D  DI ++SR
Sbjct: 29  IKIDGSSTVYPITEAVAEEFQKAKKNVVKVTVGISGTGGGFKKFCR----DETDISDASR 84

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            IT++E+D CK  GV  I E+ +  D + ++V+ ++      TV +L            K
Sbjct: 85  PITKSEMDICKAAGVEYI-EMPVAFDALTVVVNPKNTFLKQATVAEL------------K 131

Query: 147 VVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
            ++ P     + KW++I P +P+  I ++      GT                       
Sbjct: 132 TMWEPAAQGKITKWNQINPAWPDAPIKLFGAGADSGT----------------------- 168

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
             F+Y  +       S R D  A E D    + ++R +VN    G+ G ++Y  N   LK
Sbjct: 169 --FEYFTEATVGKAKSSRGDYTASEDDNVLVQGVSR-DVN--AIGYFGYAYYAENKARLK 223

Query: 262 LVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
            +PI        + PS  +++   Y P+SRP+  YVK +       ++E+V F
Sbjct: 224 ALPIVNPKTNVAVEPSEESVIKATYQPLSRPIFIYVKAKSLEKPE-IKEFVEF 275


>gi|229098743|ref|ZP_04229683.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-29]
 gi|228684822|gb|EEL38760.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-29]
          Length = 284

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/284 (25%), Positives = 126/284 (44%), Gaps = 46/284 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+SR
Sbjct: 13  VRVDGSSTVFPIIEAVAEEYTKEHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNASR 67

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146
            + Q E +E K + +       + +DG+ +V +R    V ++TV++L       L  +D 
Sbjct: 68  VMKQVEENEMKNNSIQ-FTPFEVAYDGLTIVVNRHNTWVDNMTVDEL-----RLLWSED- 120

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K+WS++   +P  ++  Y P    GT +  +  +LQ   +              
Sbjct: 121 ---GREKRWSQVHSIWPRAQVKFYAPGVDSGTYDYFQNVILQNRRI-------------- 163

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                 V   S+ +D   I         +  +  +K+   FVG ++Y  N D +K + ++
Sbjct: 164 ------VKKVSLSEDDQVI---------MQGVMHDKNAIAFVGYAYYMANRDRVKAIKVN 208

Query: 267 GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           G+ P+  TI SG Y P+SR L  YV        + +  Y  F +
Sbjct: 209 GVFPTKETIQSGDYKPLSRSLFTYVNDASIRQKINVANYAEFMI 252


>gi|220906108|ref|YP_002481419.1| phosphate-binding protein [Cyanothece sp. PCC 7425]
 gi|219862719|gb|ACL43058.1| phosphate binding protein [Cyanothece sp. PCC 7425]
          Length = 333

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 146/331 (44%), Gaps = 55/331 (16%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF---VESGGSSVGLKEFCRGIGDDTID 81
           RN +RI GSST++P S  I + F +   E   P     +  G+S G ++FC G      D
Sbjct: 26  RNIVRIDGSSTVYPISDAILKQFRQT--EAGKPVEVAAKFSGTSGGFRKFCAG----ETD 79

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASY 140
           I  +SR I   E++ C+K+ +  I E+ I  D + + V+ ++  + S+TV +L K     
Sbjct: 80  INGASRPINAKEMEACRKNVIPYI-ELPIAFDALTVAVNPQNTWATSMTVAELRKMW--- 135

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
               +      + +W+++R  +P   + ++      GT +   + ++ +  V   +F+  
Sbjct: 136 ----EPAAQGKITRWNQVRSTWPNRPLKLFGAGKDSGTFDYFTEAIMGKADVSRSDFTAS 191

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
            D         +V    V QD                     +  GF G ++++ N+  L
Sbjct: 192 EDD--------AVLVRGVSQD--------------------TNALGFFGFAYFEANSGKL 223

Query: 261 KLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           K V ID     ++PS  T++   Y P++RPL  YV  +   +  GLR +V + + +    
Sbjct: 224 KAVAIDSGKGPVLPSQQTVLRNQYQPLARPLFIYVNARAAQTKPGLRAFVEYYLKNA--- 280

Query: 316 PDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            +  + + G IP+  +  +  +     GK G
Sbjct: 281 -ERVVGKVGYIPLPADGYRLAQLHFTRGKVG 310


>gi|325108979|ref|YP_004270047.1| phosphate binding protein [Planctomyces brasiliensis DSM 5305]
 gi|324969247|gb|ADY60025.1| phosphate binding protein [Planctomyces brasiliensis DSM 5305]
          Length = 336

 Score = 90.9 bits (224), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 83/327 (25%), Positives = 148/327 (45%), Gaps = 51/327 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           ++IAGSST+ P S  +AE          T  VE+ G+  G+++  R       DI  +SR
Sbjct: 42  VQIAGSSTVSPVSSAVAEEADNALGIKAT--VETTGTGPGMEKLSR----KECDISGASR 95

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            I  +E+++C+ +GV  I E  I  DG+ +V + +         D  K L  Y       
Sbjct: 96  PIKDSEVEKCQANGVEPI-EFEICIDGLSVVVNPENDWCECLSVDQLKKLWEYE------ 148

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
             + +KKWS++ P++PE  I ++ P  + GT +   + ++ +        S  R  +  +
Sbjct: 149 --SGVKKWSDLNPEWPEEEIKLFGPDHESGTFDYFNEVIIGD---VPEGQSPCRTDYTQS 203

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-- 265
           V   ++             VDG        ++ +K   G+ G ++Y  N D LK++ I  
Sbjct: 204 VNDTTL-------------VDG--------VKGSKYALGYFGYAYYVMNKDQLKVIGIAN 242

Query: 266 -----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
                D + PS  TI  G Y P+SRPL  YV ++   +   ++++V + ++D      +Q
Sbjct: 243 KDDKSDCVAPSETTIGDGSYAPLSRPLFIYVNKEALQTKPEVKQFVEYYLNDGQ----AQ 298

Query: 320 LFQYGLIPISNEERKSVRDSIAVGKSG 346
           +   G I +  +  ++ R  +A    G
Sbjct: 299 VGDVGYIELPADRLEASRKKLAENAEG 325


>gi|32474706|ref|NP_867700.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodopirellula baltica SH 1]
 gi|32445245|emb|CAD75247.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodopirellula baltica SH 1]
          Length = 310

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 87/282 (30%), Positives = 120/282 (42%), Gaps = 60/282 (21%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I++ GSST+ P S  I E F +  P      V   G+  G K F     D   DI ++SR
Sbjct: 5   IKVDGSSTVQPISNAIREGFIKQHPNVDI-IVSGNGTGNGFKSFY----DKGTDISDASR 59

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSD--RDMVSVSLTVEDLYKALASYLIVDD 145
            I   E + CK +GV +  E+ + +DG+ +V +   D V   LTV+     L S  + DD
Sbjct: 60  PIKSGEFENCKTNGV-EFVELPVAYDGLTIVVNPQNDWVK-ELTVD----QLKSMFVGDD 113

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT----REVLEKKVLQEGCVRSRNFSKMR 201
                  K WS++ P +PE  I IY P    GT     EVL KK  +E          +R
Sbjct: 114 AA-----KNWSDVDPSWPEEAIQIYAPGTGSGTYDYFHEVLAKKSKKE----------LR 158

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                N             D I ++   D          NK   GF G+++Y+ N D L+
Sbjct: 159 GDMNLN-----------EDDNILVKGVSD----------NKFSIGFFGVAYYEENKDKLR 197

Query: 262 LVPI----DGIV--PSMGTIVSGLY-PISRPLLFYVKRQHFN 296
            VP+    D +   P+   I S  Y P SRPL  YV     N
Sbjct: 198 AVPVVNPKDEVAYEPTTENIASNKYAPFSRPLFIYVNTDSLN 239


>gi|91775148|ref|YP_544904.1| phosphate binding protein [Methylobacillus flagellatus KT]
 gi|91709135|gb|ABE49063.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methylobacillus flagellatus KT]
          Length = 340

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 131/294 (44%), Gaps = 54/294 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG--GSSVGLKEFCRGIGDDTIDIVNS 85
           IRI GSST++P ++ +AE F +     K   V  G  G+  G K+FCRG      DI  +
Sbjct: 39  IRIDGSSTVYPITEAVAEEFQKA----KRIKVTVGISGTGGGFKKFCRG----ETDISEA 90

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SR I   E++ CK  G+  I E+ + +D + ++V+ ++      TVE+L K         
Sbjct: 91  SRPILAKEMEACKAAGIEFI-ELPVAYDALTVVVNPKNTFVKHFTVEELKKLW------- 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
           +      +K W ++ P +P+  + ++      GT                         F
Sbjct: 143 EPEAQGKIKTWKQVNPSWPDTPVKLFGAGSDSGT-------------------------F 177

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
            Y  + +     S R D  A E D    + +A    +    G+ G ++Y+ N+  +K VP
Sbjct: 178 DYFTEAIVGKAKSSRGDFTASEDDNVLVQGVAS---DIAATGYFGFAYYEENSKRVKAVP 234

Query: 265 I------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           I        ++PS  T+++G Y P+SRPL  Y+      S   ++ ++ F +++
Sbjct: 235 IVAKPGAPAVLPSRETVMNGTYQPLSRPLFIYISANAAKSNPNVKAFIDFYLAN 288


>gi|307718240|ref|YP_003873772.1| phosphate ABC transporter phosphate-binding protein [Spirochaeta
           thermophila DSM 6192]
 gi|306531965|gb|ADN01499.1| phosphate ABC transporter, phosphate-binding protein [Spirochaeta
           thermophila DSM 6192]
          Length = 310

 Score = 90.1 bits (222), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 81/305 (26%), Positives = 141/305 (46%), Gaps = 47/305 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           IRIAGSST++P +  +AE F+   P  +   V+S G+  G   F   I   T +I ++SR
Sbjct: 33  IRIAGSSTVYPITVAMAEEFNRIQPGVQIA-VQSTGTGGGFTNFF--IPGKT-EINDASR 88

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIVDDK 146
            I ++EL++ +  G  D  E  +  D + +V +     V  +T+E L          DD 
Sbjct: 89  PIKESELEQVRAQG-DDALEFQVAIDAVTVVVNPHADWVDDVTIEQLRHIWRP----DD- 142

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
               P +KWS++ P +P+    +Y P+   GT +   +KV+ E                 
Sbjct: 143 ----PAQKWSDVDPSWPDEPFELYGPTSASGTFDFFTEKVMGE----------------- 181

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             + LS      R D    E D    + ++    +K   G+ G+++Y  N + +K + ++
Sbjct: 182 --EDLS------RSDYQGTEEDNTIVQAVSG---SKYALGYFGMAYYLENTNRVKALKVN 230

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLI 326
           G+ PS+ T  +  YP+SRP+  YV++    S L   E  +F          S + + G +
Sbjct: 231 GVAPSLETARTYEYPLSRPIFIYVRK----SALARPEVAAFVRFYIERTNSSLISEIGYV 286

Query: 327 PISNE 331
           P+++E
Sbjct: 287 PVTDE 291


>gi|37519577|ref|NP_922954.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
 gi|35210568|dbj|BAC87949.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
          Length = 340

 Score = 90.1 bits (222), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 74/286 (25%), Positives = 131/286 (45%), Gaps = 47/286 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I++ GSST+FP ++ +AE F +         V   G+  G K+FCRG      DI ++SR
Sbjct: 38  IKVDGSSTVFPITEAVAEEFQKSKKGAVRVTVGVSGTGGGFKKFCRG----ETDISDASR 93

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I + E+D CK+  +  + E+ + +D + ++V+  +  + ++TV +L K       + + 
Sbjct: 94  PILKKEMDACKEAAIQYV-ELPVAYDALTVMVNPSNTWASTMTVAELKK-------IWEP 145

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W+++R  FP   + +Y P    GT                         F Y
Sbjct: 146 EAQGKVTNWNQVRSSFPNAPLKLYGPGADSGT-------------------------FDY 180

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             + +     + R D  A E D    + +A    +K+  G+ G ++Y  N   LK V +D
Sbjct: 181 FTEAVVGKSKASRGDFTASEDDNVLVQGIAN---DKNALGYFGYAYYAENKSKLKAVGVD 237

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
           G    ++PS  T+  G Y P+SRP+  YV  +   +   ++E+V F
Sbjct: 238 GGKGPVLPSDKTVEDGTYNPLSRPIFIYVSNKAM-ARPEVKEFVEF 282


>gi|67921474|ref|ZP_00514992.1| extracellular solute-binding protein, family 1 [Crocosphaera
           watsonii WH 8501]
 gi|67856586|gb|EAM51827.1| extracellular solute-binding protein, family 1 [Crocosphaera
           watsonii WH 8501]
          Length = 345

 Score = 90.1 bits (222), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 91/325 (28%), Positives = 146/325 (44%), Gaps = 61/325 (18%)

Query: 18  CGT-GTFARNRIRIAGSSTLFPYSKIIAENF-----SEYFPEFKTPFVESGGSSVGLKEF 71
           CG+    A   I+I GSST+FP ++I+ E +     ++   E K    E  G+  G ++F
Sbjct: 27  CGSVPESAVKPIKIDGSSTVFPITEIVLETYKSEAANQSIKELKIEG-EFSGTGGGFQKF 85

Query: 72  CRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTV 130
           C G      DI  +SR I+Q E+  CK + +S I E+ I  D I ++V+  +  S +LTV
Sbjct: 86  CAG----ETDISAASRPISQEEMATCKNNEISYI-ELPIAFDAITVVVNPNNNWSETLTV 140

Query: 131 EDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEG 190
           E L K L       +    N + +W+++   +P+  + +Y P    GT +   K ++ E 
Sbjct: 141 EQL-KTLW------EPAAENQVGQWNQVDSSYPDRPLTLYGPDQLSGTYDYFTKAIVGET 193

Query: 191 CVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGL 250
               +++ K  D          V  T   QD  AI                     + G 
Sbjct: 194 GASRQDYVKSMDD--------EVLVTRFSQDPNAI--------------------AYFGY 225

Query: 251 SFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYV--KRQHFNSVLGLRE 303
            +Y+ + D LK V ID    G++PS  T+ +  Y P+SRPL  YV  KR   N  L +  
Sbjct: 226 GYYQQHQDKLKAVAIDNGNGGVLPSPDTVENEEYAPLSRPLFLYVNAKRAQENPALEIFV 285

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPI 328
               + + E++A      + G IP+
Sbjct: 286 EYYLNKAPELVA------EAGYIPL 304


>gi|300869540|ref|ZP_07114122.1| periplasmic phosphate-binding protein of ABC transporter
           [Oscillatoria sp. PCC 6506]
 gi|300332513|emb|CBN59320.1| periplasmic phosphate-binding protein of ABC transporter
           [Oscillatoria sp. PCC 6506]
          Length = 342

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 82/325 (25%), Positives = 140/325 (43%), Gaps = 50/325 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+I GSST++P +  IA++F +         VE  G+  G K+FC G     IDI N+SR
Sbjct: 39  IKIDGSSTVYPITDAIAKDFQKTQGAKVAITVEFSGTGGGFKKFCAG----EIDISNASR 94

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I   E++ C K G+    E+ I  D + ++V+ ++  +  +TV +L K         + 
Sbjct: 95  PIRPEEMEACNKAGIR-YYELPIAFDALTVVVNPKNSWAKDITVAELKKLW-------EP 146

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                + KW++IR  +P   I +Y      GT                         F Y
Sbjct: 147 AAQGKITKWNQIRTSWPNQPINLYGAGKDSGT-------------------------FDY 181

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             +       + R D  A E D    + + +   + +  G+ GLS+Y+ N   LK + ID
Sbjct: 182 FTEATVGEAKASRTDYTASEDDNVLVQGVTK---DPNALGYFGLSYYEANPTQLKALGID 238

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
                ++P+  T+    Y P++RPL  YV      +   +R++V F     M    + + 
Sbjct: 239 NGQGSVMPTRETVEKAQYKPLTRPLFIYVSYSAAQTKSEVRDFVEFY----MEKAPTLVN 294

Query: 322 QYGLIPISNEERKSVRDSIAVGKSG 346
             G IP+  +  + + ++   GK G
Sbjct: 295 SVGYIPLPKDGYQLIYNNFYNGKVG 319


>gi|254421481|ref|ZP_05035199.1| phosphate binding protein [Synechococcus sp. PCC 7335]
 gi|196188970|gb|EDX83934.1| phosphate binding protein [Synechococcus sp. PCC 7335]
          Length = 304

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 84/329 (25%), Positives = 145/329 (44%), Gaps = 58/329 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + I GSST++P +  +AE F +  P+     V   G+  G ++FC G      DI ++SR
Sbjct: 1   MNIDGSSTVYPITLEMAERFKQAKPDSPAISVNFSGTGGGFEKFCAG----ETDISDASR 56

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV---SVSLT-VEDLYKALASYLIV 143
            I+  E+  CK +GV  I E+ +  D + +V + +      ++L  ++ L++A A     
Sbjct: 57  PISPEEMAACKANGVEYI-ELPVAFDALTVVVNAENTWAEEITLAELQTLWQAEAE---- 111

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL-QEGCVRSRNFSKMRD 202
                   + +WS+IR D+P+  I +Y P  + GT +   + V+ +EG  R+        
Sbjct: 112 ------GEITRWSQIRADWPDEPITLYGPGEESGTFDYFTEVVVGEEGASRT-------- 157

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                             D  A E D +  + + R EVN     + G ++Y++    LK 
Sbjct: 158 ------------------DYTASEDDDELVQGV-RSEVN--ALSYFGFAYYRDAEKSLKA 196

Query: 263 VPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           + +D     + P+  T+ SG Y P+SRPL  YV+         L  +V + +++     D
Sbjct: 197 LAVDSGDGPVEPTGETLRSGEYQPLSRPLFIYVRADGLEENSALSSFVEYYLANARTVVD 256

Query: 318 SQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                 G  P+ NE      D +   K G
Sbjct: 257 ----DVGYEPLPNEAYAIALDHLTERKVG 281


>gi|119512464|ref|ZP_01631545.1| periplasmic phosphate-binding protein of ABC transporter [Nodularia
           spumigena CCY9414]
 gi|119462868|gb|EAW43824.1| periplasmic phosphate-binding protein of ABC transporter [Nodularia
           spumigena CCY9414]
          Length = 353

 Score = 89.7 bits (221), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 79/314 (25%), Positives = 142/314 (45%), Gaps = 53/314 (16%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF-VESGGSSVGLKEFCRGIGDDTIDIVN 84
           ++IRI GSST++P +  IAE F +   + K    V   G+  G ++FC G      DI N
Sbjct: 47  SQIRIDGSSTVYPITVAIAEAFQQTKQQNKAQITVNFSGTGGGFEKFCAG----ETDISN 102

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILL-VSDRDMVSVSLTVEDLYKALASYLIV 143
           +SR I Q E+  C K+GV    E+ + +D + + V  ++  +  +T+ +L K       +
Sbjct: 103 ASRPILQPEMVACDKNGVRYF-ELPVAYDALTVAVHPQNDWAKDITIAELKK-------I 154

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            +      + +W+++R  +P   + +Y    + GT                         
Sbjct: 155 WEPAAEGKITRWNQVRASWPNRPLNLYGAGEQSGT------------------------- 189

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETL-ARIEVNKDVFGFVGLSFYKNNADVLKL 262
           F Y  + +     + R+D  A E D    ETL A I  + +  G+ G ++Y+ N D LK 
Sbjct: 190 FDYFTEAIVGKARASRKDYTASEDD----ETLVAGINNDPNALGYFGYAYYEQNQDKLKA 245

Query: 263 VPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           + +D     ++PS  T+    Y P+SRPL  Y   +       +++++ F + +   AP 
Sbjct: 246 LAVDSGQGAVLPSRETVEKSQYQPLSRPLFIYANFELAQKKPAVKDFLEFYLKN---APQ 302

Query: 318 SQLFQYGLIPISNE 331
           + +   G  P+ +E
Sbjct: 303 TAI-SVGYAPLPDE 315


>gi|309390012|gb|ADO77892.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Halanaerobium praevalens DSM 2228]
          Length = 300

 Score = 89.4 bits (220), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 77/297 (25%), Positives = 137/297 (46%), Gaps = 57/297 (19%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
           FF + ++  +VL V           I+I GSST++P ++ +AE FS   P  +     + 
Sbjct: 8   FFVITILAILVLPVSAAEQL--EGTIKIDGSSTVYPVTQAMAEEFSYVNPRVRV----TV 61

Query: 63  GSSVGLKEFCR-GIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL-VSD 120
           G S     F +  +G+   D+ N+SR+I  +E     ++G+ +  +  +G+DGI + V  
Sbjct: 62  GVSGSGGGFAKFNVGE--TDLSNASREIKDSEAKIAAENGI-EFTQFIVGYDGITVAVHP 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHG 177
            +  +  +TV +L            K ++ P   ++KWS++R ++P+  I +Y P    G
Sbjct: 119 ENDWANDMTVGEL------------KQIWEPNSSVEKWSDLRAEWPDEEIDLYGPGADSG 166

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T                         F Y  + ++    + R D  A E D      L R
Sbjct: 167 T-------------------------FDYFTEAINGKSGASRSDFTASEDDN----VLVR 197

Query: 238 -IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKR 292
            +  NK   G+ G ++Y+ N++ LK V ++G++P+  TI +  Y P++RPL  Y K 
Sbjct: 198 GVSGNKYALGYFGYAYYEENSEKLKAVAVNGVLPNPETIAAKEYKPLARPLFVYAKN 254


>gi|332705975|ref|ZP_08426048.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1,
           substrate-binding protein [Lyngbya majuscula 3L]
 gi|332355235|gb|EGJ34702.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1,
           substrate-binding protein [Lyngbya majuscula 3L]
          Length = 283

 Score = 89.4 bits (220), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 84/311 (27%), Positives = 132/311 (42%), Gaps = 53/311 (17%)

Query: 43  IAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV 102
           +AE F +  P  K   V   G+  G K+FC        DI N SR I  +E++ CKK G+
Sbjct: 1   MAEEFQKANPGIKVT-VGISGTGGGFKKFCA----RETDISNGSRPIKASEIELCKKGGI 55

Query: 103 SDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPD 161
             I E+ I  DG+ ++V+  +  +  L   +L K         DKV       W +IRP 
Sbjct: 56  EYI-ELPIAFDGLSVVVNKENNFASCLKTAELKKIWEP--AAQDKV-----NNWKQIRPG 107

Query: 162 FPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQD 221
           FP+ ++ +Y P    GT +   +  + +      +++   D        L V   S  + 
Sbjct: 108 FPDTKLGLYGPGTDSGTYDYFMENTVGKDAGSRGDYTASED------DNLLVQGVSTDKG 161

Query: 222 GIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVS 277
           G+A                      F G ++Y+ N D LKL+ I+G    + P+  TI  
Sbjct: 162 GLA----------------------FFGYAYYEENKDKLKLLEINGGSGCVAPNKATIAD 199

Query: 278 GLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF-QYGLIPISNEERKS 335
           G Y P+SRP   YV ++  N     R  V   V   + A +S+L  + G +P+  +    
Sbjct: 200 GSYKPLSRPEFIYVNKEAAN-----RPEVKAFVEYHLAAENSKLISEVGYVPMPEDIMML 254

Query: 336 VRDSIAVGKSG 346
           VR   + G  G
Sbjct: 255 VRKRFSEGTVG 265


>gi|70726523|ref|YP_253437.1| thioredoxine reductase [Staphylococcus haemolyticus JCSC1435]
 gi|123660170|sp|Q4L694|PSTS_STAHJ RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|68447247|dbj|BAE04831.1| thioredoxine reductase [Staphylococcus haemolyticus JCSC1435]
          Length = 316

 Score = 89.4 bits (220), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 71/296 (23%), Positives = 125/296 (42%), Gaps = 58/296 (19%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG--GSSVGLKEFCRGIGDDTIDI 82
           +   +  GSST+ P  + + E +++  P      + SG  G+  G ++F  G      D 
Sbjct: 38  KGEAKGEGSSTVAPIVEKLNEKWAKDHP---NATISSGQAGTGAGFEKFIAG----ETDF 90

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI 142
             +SR I   E  + +   +   +E  I  DG+ +  ++D         D  K L+   +
Sbjct: 91  SQASRPIKDEEKQKLEDKDIK-YKEFKIAQDGVTVAVNKD--------NDFVKELSKDQL 141

Query: 143 VDDKVVFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
              K ++N   K W ++   +P+ +I  + P+  HGT +  E++V+              
Sbjct: 142 ---KKIYNGEAKTWKDVNSSWPDKKIKAFSPNSSHGTYDFFEEEVMD------------- 185

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                             ++ I  E +GD    +  +E NK+  G+ G +FY+ N D LK
Sbjct: 186 ------------------KEDIKAEKNGDTNVIVQSVEKNKEGIGYFGYNFYEQNKDKLK 227

Query: 262 LVPIDG-----IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
            V I         P+  TI  G Y +SRPL  YVK +       +RE++ F++ D+
Sbjct: 228 EVKIKDDKGKTTEPTKKTIKDGSYALSRPLFLYVKEKSLKDNDVMREFIKFTLEDK 283


>gi|157364553|ref|YP_001471320.1| phosphate binding protein [Thermotoga lettingae TMO]
 gi|157315157|gb|ABV34256.1| phosphate binding protein [Thermotoga lettingae TMO]
          Length = 278

 Score = 89.0 bits (219), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 80/319 (25%), Positives = 141/319 (44%), Gaps = 66/319 (20%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   V L+  V + +   T       + I GS+T++P +++  E F + +P+     +E
Sbjct: 1   MKKISVFLLVLVAIAILGET-------LVIKGSNTIYPIAQLWIEEFQKMYPDV-VATLE 52

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELD---ECKKHGVSDIQEVTIGHDGILL 117
             GSS G+K       + T DI N+SR +  +E++   E KK+ V     + IG+DGI +
Sbjct: 53  GAGSSTGIKALM----NQTADIANASRFLKSSEIEAMHEQKKYFVP----LVIGYDGIAV 104

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           + + D+   S++++ LYK           +    + +WS+I    P+  I  Y  +   G
Sbjct: 105 IVNPDLGIDSISIDTLYK-----------IYTGQITEWSQIDSKLPKKTIVAYSRNTASG 153

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T EV  +KVL+   +  R            +Q +      +              E++AR
Sbjct: 154 TFEVWLEKVLKGDKLSPR------------IQMVESTQAEI--------------ESVAR 187

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
              N     + G+ +  +    LK   IDGI PS+  +++G YP+SRPL  +     F +
Sbjct: 188 ---NPYAIAYTGMGYVTDQVKALK---IDGIEPSVQNVLAGKYPLSRPLFVFFDLSRFGN 241

Query: 298 VLG----LREYVSFSVSDE 312
                  +  Y+ F +S E
Sbjct: 242 AWPEKGIVASYIRFILSPE 260


>gi|219850474|ref|YP_002464907.1| phosphate binding protein [Chloroflexus aggregans DSM 9485]
 gi|219544733|gb|ACL26471.1| phosphate binding protein [Chloroflexus aggregans DSM 9485]
          Length = 692

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 81/315 (25%), Positives = 141/315 (44%), Gaps = 49/315 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST++P +   AE FS+  P  +   V   G+  G K+FC G      DI N+SR
Sbjct: 74  ILIDGSSTVYPVTAAAAEEFSKKAPNVRVS-VGISGTGGGFKKFCNG----ETDISNASR 128

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I + E   C ++G+  I E+ + +DG+ ++V+ ++  +  LTV +L K         + 
Sbjct: 129 PIREEEQAICAQNGIEFI-ELPVAYDGLSVVVNPQNDWATCLTVAELKKMW-------EP 180

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W++IR  FP   + +       GT                         F Y
Sbjct: 181 DAQGKITNWNQIRDGFPNRPLVLLGAGTDSGT-------------------------FDY 215

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             + +     + R D  A E D     T+  +  + +  G++G ++   N   +K + ID
Sbjct: 216 FTEAIMGKAKASRGDYQATEDD---NVTITGVSGDLNALGYLGYAYVVENPGKIKPIAID 272

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           G    + PS  TI +G Y P+SRPL  YV+++       ++ +++F + +E   P  Q  
Sbjct: 273 GGKGCVEPSFETIANGTYVPLSRPLFIYVRKEAAERPE-VQAFINFYLGEEFT-PLIQTP 330

Query: 322 QYGLIPISNEERKSV 336
           Q G + +S E  +++
Sbjct: 331 QVGYVALSQELYRAI 345



 Score = 88.6 bits (218), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/315 (25%), Positives = 141/315 (44%), Gaps = 49/315 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST++P +   AE F++  P  +   V   G+  G K+FC G      DI N+SR
Sbjct: 392 ILIDGSSTVYPVTAAAAEEFAQKAPNVRVS-VGISGTGGGFKKFCNG----ETDISNASR 446

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I + E   C ++G+  I E+ + +DG+ ++V+ ++  +  LTV +L K         + 
Sbjct: 447 PIREEEQAICAQNGIEFI-ELPVAYDGLSVVVNPQNDWATCLTVAELKKMW-------EP 498

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W++IR  FP   + +       GT                         F Y
Sbjct: 499 DAQGKITNWNQIRDGFPNRPLVLLGAGTDSGT-------------------------FDY 533

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             + +     + R D  A E D     T+  +  + +  G++G ++   N   +K + ID
Sbjct: 534 FTEAIMGKAKASRGDYQATEDD---NVTITGVSGDLNALGYLGYAYVVENPGKIKPIAID 590

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           G    + PS  TI +G Y P+SRPL  YV+++       ++ +++F + +E   P  Q  
Sbjct: 591 GGKGCVEPSFETIANGTYVPLSRPLFIYVRKEAAERPE-VQAFINFYLGEEFT-PLIQTP 648

Query: 322 QYGLIPISNEERKSV 336
           Q G + +S E  +++
Sbjct: 649 QVGYVALSQELYRAI 663


>gi|309791213|ref|ZP_07685745.1| phosphate binding protein [Oscillochloris trichoides DG6]
 gi|308226775|gb|EFO80471.1| phosphate binding protein [Oscillochloris trichoides DG6]
          Length = 354

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 79/278 (28%), Positives = 125/278 (44%), Gaps = 53/278 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST+FP ++  A  F  + P+ +     SG +  G K+FC G     I I ++SR
Sbjct: 53  ISIDGSSTVFPITEAAAITFRRFVPQVEISLGVSG-TGGGFKKFCAG----EIVIADASR 107

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD-MVSVSLTVEDL---YKALASYLIV 143
            I   E   C + G+  I E+ I  DGI +V   D   +  +TVE+L   ++  +  +IV
Sbjct: 108 PIKAEESATCAEAGIEYI-ELPIAFDGISVVVHPDNQWATCMTVEELRRLWQPQSGGVIV 166

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
                     +WS+IR  +PE  I +Y   G  GT +   + ++  G  R+         
Sbjct: 167 ----------RWSQIRAGWPENAIHLYGAGGDSGTYDYFTEAIV--GSARAS-------- 206

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                          RQD  A E D    + L+    + D  GF G ++Y  +A+ L+ +
Sbjct: 207 ---------------RQDYTASEDDYLLAQDLS---ADPDGLGFFGYAYYVEHAENLRAI 248

Query: 264 PIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
            ID     + PS+ +I  G Y P++RP+  YV     +
Sbjct: 249 GIDNGAGCVAPSVTSIADGSYQPLARPIFLYVNAAALD 286


>gi|307298068|ref|ZP_07577872.1| phosphate binding protein [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916154|gb|EFN46537.1| phosphate binding protein [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 274

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 75/311 (24%), Positives = 139/311 (44%), Gaps = 54/311 (17%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F VL+  ++L      GT   + + I GS+T++P +++ AE F    P+ +   +E  GS
Sbjct: 4   FGVLIVILLL-----AGTMLGSTLVIKGSNTVYPVAQLWAEGFKAMNPDVEIS-IEGAGS 57

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
           S G+K    G      DI NSSR I  +E+++    G   I  V + +DGI ++ ++ + 
Sbjct: 58  STGIKALFNG----QTDIANSSRWIKASEIEQMNSDGKYFIPYV-VAYDGIAIIVNKSLG 112

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
             ++T++ L+       I   K+       W++I    P+ RI         GT E   +
Sbjct: 113 ISNITIQQLFD------IYSGKIT-----SWNQIDSSLPKARIVPLSRDNASGTFEYFVE 161

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
            V++             + F   VQQL+     V Q                 +  N+  
Sbjct: 162 HVMK------------GEKFAPQVQQLASTRAEVEQ-----------------VMQNQYA 192

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G++G+ +     + +K + ++G+ P++  + +G YPISRPL  +V   +      + E+
Sbjct: 193 IGYIGMGYI---TEEVKALTVEGVEPTVANVNAGSYPISRPLFMFVDATNGLPTGVIGEF 249

Query: 305 VSFSVSDEMMA 315
           + +++S E  A
Sbjct: 250 LRYALSPEGQA 260


>gi|253997057|ref|YP_003049121.1| phosphate-binding protein [Methylotenera mobilis JLW8]
 gi|253983736|gb|ACT48594.1| phosphate binding protein [Methylotenera mobilis JLW8]
          Length = 333

 Score = 88.6 bits (218), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 120/271 (44%), Gaps = 50/271 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+I GSST++P ++ +AE F +      T  V   G+  G K+FCRG      D+ N+SR
Sbjct: 32  IKIDGSSTVYPITEAVAEEFQKSTKTKVT--VGISGTGGGFKKFCRG----ETDVQNASR 85

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I Q E+D CK+ GV  I E+ + +D + ++++  +  +  +T  +L K         + 
Sbjct: 86  PILQKEIDACKEAGVQFI-ELPVAYDALTVVINPANDFAKKMTTAELKKLW-------EP 137

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +K W+++ P +P   + ++ P    GT                         F Y
Sbjct: 138 AAQGKVKTWNQVNPAWPNTPVKLFGPGADSGT-------------------------FDY 172

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI- 265
             + +     S R D  A E D    + +     +K    + G ++Y+ N D L  V I 
Sbjct: 173 FTEAIVGKAKSSRGDFTASEDDNVLVKGVVG---DKGGLAYFGYAYYEENQDKLTAVSII 229

Query: 266 -----DGIVPSMGTIVSGLY-PISRPLLFYV 290
                 G++PS  TI  G Y P++RP+  YV
Sbjct: 230 EKAGKPGVLPSKATIEDGTYQPLARPIFIYV 260


>gi|159901417|ref|YP_001547664.1| phosphate binding protein [Herpetosiphon aurantiacus ATCC 23779]
 gi|159894456|gb|ABX07536.1| phosphate binding protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 357

 Score = 88.6 bits (218), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 80/294 (27%), Positives = 131/294 (44%), Gaps = 50/294 (17%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R  I I GSST+FP ++ +A  F+   P  +     S G+  G K+FC G   +T+ I +
Sbjct: 54  RGTIVIDGSSTVFPITEAVAREFALTAPNVQVQLGVS-GTGGGFKKFCAG---ETV-ISD 108

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIV 143
           +SR I Q+E  EC  + + D  E+ +  DG+ LV++     +  +TV +L     + L  
Sbjct: 109 ASRPIKQSEAAECAANQI-DFVEIPVAFDGLSLVANPSNTWLECMTVAEL-----NTLWQ 162

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL-QEGCVRSRNFSKMRD 202
            D    N +  W  +RP +P   + +Y      GT +     ++  EG  RS   S   D
Sbjct: 163 PDAT--NIITNWRMLRPIWPTSTLQLYGAGQDSGTFDYFTSAIVGTEGSSRSDVISSEDD 220

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                               IA ++ GD            +  G+ G ++Y+   + LKL
Sbjct: 221 YL------------------IAQDIAGD-----------PNALGYFGYAYYREYQERLKL 251

Query: 263 VPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           + +D     ++PS  TI  G Y P+SRP+  YV+    +    +  +V F +SD
Sbjct: 252 IAVDAGNGCVLPSEQTIADGSYQPLSRPIFIYVRADALDRA-EVAAFVDFYLSD 304


>gi|119485723|ref|ZP_01619998.1| Phosphate binding protein [Lyngbya sp. PCC 8106]
 gi|119457048|gb|EAW38175.1| Phosphate binding protein [Lyngbya sp. PCC 8106]
          Length = 343

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 76/295 (25%), Positives = 133/295 (45%), Gaps = 62/295 (21%)

Query: 12  VVLEVYCGTGTFARNR-IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKE 70
            VL   CG+    +N  I+I GSST++P ++ I E F+    +         G+  G ++
Sbjct: 22  TVLLSGCGSNQAQQNEPIKIDGSSTVYPITEKIVEQFNSESTKNVDVTANFSGTGGGFQK 81

Query: 71  FCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLT 129
           FC G      DI N+SR I+++E++ CK++ ++ I E+ +  D + ++V  ++  +  ++
Sbjct: 82  FCAG----ETDINNASRPISRSEMEVCKQNNIAYI-ELPVAFDALSVVVHPQNTWASDIS 136

Query: 130 VEDLYKALASYLIVDDKVVFNP-----LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           VE+L            K ++ P     +  W+++RP +P   + +Y P    GT +   +
Sbjct: 137 VEEL------------KKIWEPGAQGRITTWNQVRPSWPNRPLVLYGPGTDSGTYDYFTE 184

Query: 185 KVL-QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR-IEVNK 242
            ++ Q G  RS                          D  A E D    E LA+ +  N 
Sbjct: 185 AIVGQPGASRS--------------------------DFTASEDD----EILAQGVSRNP 214

Query: 243 DVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLY-PISRPLLFYVK 291
           +  G+ G ++Y  N D LK + ID      ++PS        Y P++RPL  YV 
Sbjct: 215 NALGYFGYAYYNKNQDKLKPLAIDNGTGSAVMPSEENARQNQYRPLARPLFIYVN 269


>gi|300710212|ref|YP_003736026.1| phosphate binding protein [Halalkalicoccus jeotgali B3]
 gi|299123895|gb|ADJ14234.1| phosphate binding protein [Halalkalicoccus jeotgali B3]
          Length = 306

 Score = 87.4 bits (215), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 76/321 (23%), Positives = 143/321 (44%), Gaps = 54/321 (16%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            + IAGSST+FP ++ +A +F +  P+      ++G        FC G+     D+ N+S
Sbjct: 25  EVNIAGSSTVFPIAEAVASDFVQENPDINVSVSQTGSGGGFSNFFCPGM----TDLNNAS 80

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIVDD 145
           R I ++E  +C  +G+  I E T+G D + +V + +   V  +T+++L +   +      
Sbjct: 81  RSIAEDEQTQCSDNGIEPI-EFTVGTDALTVVVNPEADWVDCVTIDELRQIWQT------ 133

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  ++WS++R D+P+     Y  +   GT +   + V+ E      ++S       
Sbjct: 134 ----GGAERWSDVREDWPDEPFEFYGAATVSGTFDYFRETVIGEDANHRNDYSA------ 183

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
              ++       VR    AI                    G+ G ++Y  N D +K + I
Sbjct: 184 --TEKDRTIVRGVRGSPYAI--------------------GYFGFAYYSENPDSIKALAI 221

Query: 266 DG-----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           D      + PS+ T  SG Y P+SR L  Y  ++   +   + ++V + +  E  A D  
Sbjct: 222 DDGDGTCVEPSLETAKSGRYQPLSRSLFTYAAKEAL-ADPAVEKFVRYFI--EKSATD-L 277

Query: 320 LFQYGLIPISNEERKSVRDSI 340
           + + G +PI+ EE+++  D +
Sbjct: 278 VSEVGYVPITEEEKQANLDRL 298


>gi|138896034|ref|YP_001126487.1| phosphate-binding protein [Geobacillus thermodenitrificans NG80-2]
 gi|134267547|gb|ABO67742.1| Phosphate-binding protein [Geobacillus thermodenitrificans NG80-2]
          Length = 320

 Score = 87.4 bits (215), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 85/320 (26%), Positives = 139/320 (43%), Gaps = 63/320 (19%)

Query: 7   VLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFSEYFPE 53
           VL   +V    CG G  A                + + GSST++P ++  AE +    P 
Sbjct: 12  VLSGMMVFVAACGGGNKAGGNDAEGESASELSGEVIMDGSSTVYPIAEAAAEEYMTEQPN 71

Query: 54  FKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHD 113
            K   V   G+  G ++F +G      D  N+SR I + E      + + + QE  + +D
Sbjct: 72  VKVS-VGMSGTGGGFEKFSKG----ESDFSNASRPIKEEEKQAAAANDI-EFQEFQLAYD 125

Query: 114 GILLVSDRDMVSVS-LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVP 172
           G+ +V +++   V  LTV++L K     +  +D       KKWS+IR  +P+  I  + P
Sbjct: 126 GLSVVVNKENDWVDYLTVDELKK-----MWTED----GKEKKWSDIRSGWPDEEIQFFSP 176

Query: 173 SGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYT 232
               GT +  ++ +L+            ++M K    QLS        D I +       
Sbjct: 177 GHDSGTYDYFDEVILE-----------GKEMVK--TAQLS------EDDNILVR------ 211

Query: 233 ETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLL 287
                +E ++   G+ G ++Y  N D LK+VPID     I P+  TI +G Y P+SRPL 
Sbjct: 212 ----GVEGDRYAIGYFGYAYYLENKDKLKIVPIDAGNGPIEPTNETIETGKYTPLSRPLF 267

Query: 288 FYVKRQHFNSVLGLREYVSF 307
            YV  +       + +Y+ F
Sbjct: 268 TYVNVKSLKEKPQVYDYMEF 287


>gi|172035803|ref|YP_001802304.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
 gi|171697257|gb|ACB50238.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
          Length = 345

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 81/304 (26%), Positives = 134/304 (44%), Gaps = 55/304 (18%)

Query: 11  FVVLEVYCGTGTFARN---RIRIAGSSTLFPYSKIIAENF-SEYF-PEFKTPFVES--GG 63
           F+ L +    G+   +    I+I GSST+FP ++ + E++ SE   P  K   +E    G
Sbjct: 18  FISLSLLSACGSVPESVIEPIKIDGSSTVFPITERVLESYKSEAVNPSIKELKIEGEFSG 77

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRD 122
           ++ G ++FC G      DI  +SR I+  E+  C  + +  I E+ I  D I ++V+  +
Sbjct: 78  TTQGFEKFCTG----KTDINAASRPISTEEMTACSGNEIRYI-ELPIAFDAITVVVNPNN 132

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
             + +LTVE L K         +    N + +W+++   +P   + +Y P    GT +  
Sbjct: 133 DWTQTLTVEQLRKMW-------EPTAENQVSQWNQVDQTYPNRPLTLYGPGELSGTYDYF 185

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            K ++ E     +++ K  D          V  T V QD                     
Sbjct: 186 TKAIVGETGASRQDYVKSEDD--------EVLVTGVAQD--------------------P 217

Query: 243 DVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYV--KRQHF 295
           +   + G  +Y+ N D LK V +D    G++PS+ T+    Y P+SRPL  YV  KR   
Sbjct: 218 NALSYFGFGYYQQNQDKLKAVAVDNGKGGVIPSIETVKDEAYQPLSRPLFIYVNAKRAQE 277

Query: 296 NSVL 299
           N  L
Sbjct: 278 NPAL 281


>gi|257386428|ref|YP_003176201.1| phosphate binding protein [Halomicrobium mukohataei DSM 12286]
 gi|257168735|gb|ACV46494.1| phosphate binding protein [Halomicrobium mukohataei DSM 12286]
          Length = 376

 Score = 87.0 bits (214), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 82/333 (24%), Positives = 154/333 (46%), Gaps = 65/333 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKE-FCRGIGDDTIDIVNSS 86
           +RI+GSST++P ++ ++  ++E + +     +   GS  G +  F  G      DI N+S
Sbjct: 86  VRISGSSTVYPVAEEVSRLWNEEYGDGVGFNITPDGSGGGFENVFIPG----DSDINNAS 141

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIVDD 145
           R I   EL  C+ +G+  + E  +  D + +V + D   +  +++EDL            
Sbjct: 142 RPIKDEELQRCRDNGIEPV-EFYVAQDALTVVVNNDADFIDEISLEDL------------ 188

Query: 146 KVVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           K +++P    + WS++  D+P+  + +Y P+   GT +   + V+ E    + +   +R 
Sbjct: 189 KTIWSPDTAPEMWSDVNSDWPDEPLDLYGPASTSGTYDYFIEAVIGE----TESDQPIRS 244

Query: 203 MFKYNVQQLSVACTSVRQDG-IAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
            F+              +D  IA  V G           N+  FG++  ++Y NN D +K
Sbjct: 245 DFE-----------GTEEDNLIAQGVSG-----------NEYAFGYLPFAYYTNNPDSVK 282

Query: 262 LVPI-----DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS---DEM 313
            + +     D + PS+    SG YP++RPL FY           L+E++ F V+   ++ 
Sbjct: 283 ALGLVEGGNDPVEPSLEGAQSGNYPLARPLFFYANMNKLQEKTHLQEFIRFYVNEADEDY 342

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +A D      G +P S+   + V D++A  ++G
Sbjct: 343 IASD-----VGYVPSSD---QMVEDNLANLEAG 367


>gi|57866941|ref|YP_188538.1| phosphate ABC transporter phosphate-binding protein [Staphylococcus
           epidermidis RP62A]
 gi|81674679|sp|Q5HPF2|PSTS_STAEQ RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|57637599|gb|AAW54387.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus epidermidis RP62A]
          Length = 325

 Score = 86.7 bits (213), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 123/294 (41%), Gaps = 58/294 (19%)

Query: 32  GSSTLFPYSKIIAENFSE-YFPEFKTPFVESG--GSSVGLKEFCRGIGDDTIDIVNSSRK 88
           GSST+ P    I E  +E +  + K   + SG  G+  G ++F  G      D  ++SR 
Sbjct: 42  GSSTVAP----IVEKLNEKWAKDHKDAKISSGQAGTGAGFQKFIAG----ETDFSDASRP 93

Query: 89  ITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVV 148
           I   E  + +  G+    E  I  DG+ +  ++D         D  K L    + D  + 
Sbjct: 94  IKDEEKKKLEDKGIK-YHEFKIAQDGVTIAVNKD--------NDFVKELTKSQLKD--IY 142

Query: 149 FNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNV 208
               K W ++   +P+ +I    P+  HGT +  E++V+                     
Sbjct: 143 SGKAKTWKDVNSSWPDKKINAVSPNSSHGTYDFFEEEVMD-------------------- 182

Query: 209 QQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--- 265
                     +QD I  E + D    ++ +  NK+  G+ G +FY+ N D LK V I   
Sbjct: 183 ----------KQD-IKAEKNADTNAIVSSVTKNKEGIGYFGYNFYEQNKDKLKEVKIKDD 231

Query: 266 DGIV--PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           +G V  P+  TI +G Y +SRPL  Y K +       + E++ F + DE  A +
Sbjct: 232 NGKVTEPTKKTIQNGSYALSRPLFIYAKDKSLKDNKVMSEFMKFVLEDEGQAAE 285


>gi|242242667|ref|ZP_04797112.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis W23144]
 gi|242233803|gb|EES36115.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis W23144]
 gi|319401326|gb|EFV89537.1| phosphate binding family protein [Staphylococcus epidermidis
           FRI909]
          Length = 325

 Score = 86.7 bits (213), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 123/294 (41%), Gaps = 58/294 (19%)

Query: 32  GSSTLFPYSKIIAENFSE-YFPEFKTPFVESG--GSSVGLKEFCRGIGDDTIDIVNSSRK 88
           GSST+ P    I E  +E +  + K   + SG  G+  G ++F  G      D  ++SR 
Sbjct: 42  GSSTVAP----IVEKLNEKWAKDHKDAKISSGQAGTGAGFQKFIAG----ETDFSDASRP 93

Query: 89  ITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVV 148
           I   E  + +  G+    E  I  DG+ +  ++D         D  K L    + D  + 
Sbjct: 94  IKDEEKKKLEDKGIK-YHEFKIAQDGVTIAVNKD--------NDFVKELTKSQLKD--IY 142

Query: 149 FNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNV 208
               K W ++   +P+ +I    P+  HGT +  E++V+                     
Sbjct: 143 SGKAKTWKDVNSSWPDKKINAVSPNSSHGTYDFFEEEVMD-------------------- 182

Query: 209 QQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--- 265
                     +QD I  E + D    ++ +  NK+  G+ G +FY+ N D LK V I   
Sbjct: 183 ----------KQD-IKAEKNADTNAIVSSVTKNKEGIGYFGYNFYEQNKDKLKEVKIKDD 231

Query: 266 DGIV--PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           +G V  P+  TI +G Y +SRPL  Y K +       + E++ F + DE  A +
Sbjct: 232 NGKVTEPTKKTIQNGSYALSRPLFIYAKDKSLKDNKVMSEFMKFVLEDEGQAAE 285


>gi|166363669|ref|YP_001655942.1| ABC-transporter periplasmic phosphate-binding protein [Microcystis
           aeruginosa NIES-843]
 gi|166086042|dbj|BAG00750.1| ABC-transporter periplasmic phosphate-binding protein [Microcystis
           aeruginosa NIES-843]
          Length = 332

 Score = 86.7 bits (213), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 72/320 (22%), Positives = 140/320 (43%), Gaps = 52/320 (16%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           FF + L+    L   CG    +  +   + I G +  F  S  +AE +    P+ +   V
Sbjct: 7   FFLISLLMASNLIAGCGRPADSAEKQPPVSIDGGAVGFALSLAVAEEYQRIHPDARVS-V 65

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLV 118
            + G+  G  +FC G     +DI  +SR I + E+++C+++GV +  E+ +  DG+ ++V
Sbjct: 66  ATSGTGGGFSKFCAG----NLDIAGASRVIRKEEIEKCRENGV-EFLELPMAIDGLAVIV 120

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           + ++  +  LT+++L +   +    + ++       W +I P FP+ R+ ++ P    GT
Sbjct: 121 NKKNQFAKCLTIKELDRMWNTK--AEGRIT-----SWKQINPKFPDERLLLFAPPSDTGT 173

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
            +   + +  +      +F+  R+                 Q+ +   V G         
Sbjct: 174 FDYFTQAITGKRRNSRTDFTPNRN-----------------QNALVQGVIG--------- 207

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDG-------IVPSMGTIVSGLYPISRPLLFYVK 291
             N     ++G+SFY  N D L LV I+         VP    + +   P+SRPL  YV 
Sbjct: 208 --NPSALAYLGISFYMQNQDRLNLVAIENNEGKCVKPVPIDNVLRNVYNPLSRPLFIYVN 265

Query: 292 RQHFNSVLGLREYVSFSVSD 311
           + +  +   L ++V F + +
Sbjct: 266 KNNLKTNPSLEKFVRFYLEN 285


>gi|170078880|ref|YP_001735518.1| phosphate transport system substrate-binding protein [Synechococcus
           sp. PCC 7002]
 gi|169886549|gb|ACB00263.1| phosphate transport system substrate-binding protein [Synechococcus
           sp. PCC 7002]
          Length = 354

 Score = 86.3 bits (212), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 75/330 (22%), Positives = 145/330 (43%), Gaps = 57/330 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + I GSST+FP ++ +AE F    P+ +   V   G+  G  +FC G      DI N+SR
Sbjct: 54  VLIDGSSTVFPITEAMAEEFQIANPDTRV-TVGVSGTGGGFSKFCAG----ETDISNASR 108

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I+  E++ C++ G+  I E+ + +D I ++++  +  +  LT E+L    AS    D +
Sbjct: 109 PISTEEIEACEQAGIEYI-EIPVAYDAISVVINPENDWATCLTTEEL----ASIWSPDSQ 163

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           +       WS++R  FP+  + +Y P    GT +     +  E      +++   D    
Sbjct: 164 I-----NNWSQVREGFPDAPLTLYGPGTDSGTFDYFTDAINGEEGASRGDYTASED---- 214

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                         D + ++           +  + +  G+ GL++Y+ NAD L    ID
Sbjct: 215 --------------DNVVVQ----------GVVNDPNAMGYFGLAYYEENADNLNAAAID 250

Query: 267 G---------IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
                     + PS  T+    Y P++RP+  YV     +    ++ ++ F  ++E    
Sbjct: 251 DGDPSNGDGCVAPSTATVDDSTYQPLARPIFIYVSAASLDEKPQVQAFMDFYTAEEN--- 307

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            S + + G + +++E     ++ +A   +G
Sbjct: 308 SSLVSEVGYVALNSEIYAKAQERLAARTTG 337


>gi|159030672|emb|CAO88342.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 339

 Score = 86.3 bits (212), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 118/272 (43%), Gaps = 46/272 (16%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           +RN I+I GSST++P ++ +AE F +   + +   V   G+  G K+FC G      DI 
Sbjct: 35  SRNTIKIDGSSTVYPITEAVAEEFQKINRQTQVT-VGISGTGGGFKKFCAG----ETDIS 89

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I  +E   C K+GV  + E+ I  D + +V +R     S+ V +L K        
Sbjct: 90  NASRPIKDSERQLCAKNGVKFL-ELPIAFDALTVVVNRQNPLNSIKVSELKKMW------ 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            +      + KW+++   +P   + ++ P    GT                         
Sbjct: 143 -EPAAQGKITKWNQVNSKWPNANLKLFGPGADSGT------------------------- 176

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           F Y  + +       R D    E D    + + R   +++  G+ G ++Y+ N   LK +
Sbjct: 177 FDYFTEAIVGESKKSRTDFTPSEDDNVLVQGVIR---DRNALGYFGYAYYEANKGRLKAL 233

Query: 264 PID----GIVPSMGTIVSGLY-PISRPLLFYV 290
            ID     I PS   + +G Y P+SRP+  YV
Sbjct: 234 AIDNGKGAISPSAENVNNGKYNPLSRPVFIYV 265


>gi|305665601|ref|YP_003861888.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Maribacter sp. HTCC2170]
 gi|88710357|gb|EAR02589.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Maribacter sp. HTCC2170]
          Length = 319

 Score = 86.3 bits (212), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 86/319 (26%), Positives = 146/319 (45%), Gaps = 54/319 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I++ GSST+FP ++ +AE F    P+ K   V   G+  G K+F RG      ++ N+SR
Sbjct: 39  IKVDGSSTVFPITEAVAEEFRGVQPKVKV-TVGVSGTGGGFKKFSRG----ETNLSNASR 93

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I   E   CK++ +  + E+ + +DG+ ++V   +      TVE+L K       + + 
Sbjct: 94  PIKDKEKAACKENNIKYL-ELEVAYDGLAVIVHPENNWVDHFTVEELKK-------IWEP 145

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                + KW++IRP++P   I ++ P    GT +   + V+ +      +F+   D    
Sbjct: 146 AAQGKVMKWNQIRPEWPNEEIHLFGPGVASGTYDYFTEAVVGKSGSSRGDFTASED---- 201

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                      V   GIA    GD           K   GF GL++Y  N D L+L+ + 
Sbjct: 202 ---------DHVLVQGIA----GD-----------KYALGFFGLAYYAENKDRLQLIGVH 237

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDE-MMAPDSQL 320
                + PS+ T+ +G Y P+SRPL  YV      S   + E+V F + +   ++ D   
Sbjct: 238 NGESIVKPSLETVKNGTYKPLSRPLFIYVNSTSV-SAPEVIEFVDFYIDNAGELSKD--- 293

Query: 321 FQYGLIPISNEERKSVRDS 339
              G IP+ +E  K  +++
Sbjct: 294 --VGYIPLPDENYKVQKEN 310


>gi|37519582|ref|NP_922959.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
 gi|35210573|dbj|BAC87954.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
          Length = 343

 Score = 86.3 bits (212), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 79/324 (24%), Positives = 140/324 (43%), Gaps = 60/324 (18%)

Query: 1   MRFFFVVLMCFVVLE----VYCGTGTFAR-NRIRIAGSSTLFPYSKIIAENFSEYFPE-- 53
           M+   VV +   VL     V     T AR +++ I GSST+ P ++   E F    P+  
Sbjct: 5   MKKSVVVGISVAVLAAASMVLAAQNTTARPSQVSIDGSSTVHPITRTAVEEFLSRNPQIA 64

Query: 54  ---FKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
              F   F  +GG   GLK+ C G     IDI  +SR I++ E+  C+ + ++   E+ +
Sbjct: 65  KGAFAVGFSGTGG---GLKKLCTG----EIDIAGASRPISRQEIQSCRNNNIA-FMELPV 116

Query: 111 GHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI 169
             D + ++V  ++  +  +TV +L K       + ++     + +WS++RP +P+  + +
Sbjct: 117 AFDALTVVVHPKNTWASEITVAELKK-------IWERASQGKITRWSQVRPGWPDRPLKL 169

Query: 170 YVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDG 229
           Y P    GT +   + +L                          A T  R D     VD 
Sbjct: 170 YGPGRDSGTYDYFAEAILGS------------------------ANTDTRSD----YVDS 201

Query: 230 DYTETLAR-IEVNKDVFGFVGLSFYKNNADVLKLVPI----DGIVPSMGTIVSGLY-PIS 283
           +  + L R +  + D   + G ++Y+ +   LK + +      + PS   +   LY P++
Sbjct: 202 EDDDVLVRGVSEDPDALSYFGYAYYEASRGRLKALAVANGLGAVAPSRQAVEKNLYQPLA 261

Query: 284 RPLLFYVKRQHFNSVLGLREYVSF 307
           RPL  YV      +   +RE+V F
Sbjct: 262 RPLFLYVNMVSSQTKPPVREFVGF 285


>gi|17228589|ref|NP_485137.1| periplasmic phosphate-binding protein of ABC transporter [Nostoc
           sp. PCC 7120]
 gi|17130440|dbj|BAB73051.1| periplasmic phosphate-binding protein of ABC transporter [Nostoc
           sp. PCC 7120]
          Length = 352

 Score = 86.3 bits (212), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 77/326 (23%), Positives = 144/326 (44%), Gaps = 52/326 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + + GSST++P ++ IA+ F           V   G+  G  +FC G      DI N+SR
Sbjct: 49  VTVDGSSTVYPITQAIAQEFQANSKNNLQVQVNISGTGGGFAKFCAG----KTDINNASR 104

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILL-VSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            ITQ E+ +C ++G+  I E+ +  D + + V+ ++  +  +T+ +L K       + + 
Sbjct: 105 PITQAEMADCNRNGIRYI-ELPVAFDALTIAVNPQNDWAKDITIAELKK-------IWEP 156

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                + +W+++R  +P+  + +Y    + GT                         F Y
Sbjct: 157 GAEGKITRWNQVRASWPDRPLNLYGAGKQSGT-------------------------FDY 191

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETL-ARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
             + ++    + R D  A E D    E L A I  + +  G+ G ++Y+ N   LK++ +
Sbjct: 192 FTEAITGKAKASRNDYTASEDD----EVLVAGISKDPNALGYFGYAYYEENQKSLKVLAV 247

Query: 266 D----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           D     I+PS  T+    Y P+SRPL  YV      +   + ++  + +     AP +  
Sbjct: 248 DNGKGAIIPSRETVEKSKYQPLSRPLFIYVNPWSSQNKSAVYQFADYYIK---QAPKTAK 304

Query: 321 FQYGLIPISNEERKSVRDSIAVGKSG 346
              G +P+S+E  +     +  GK+G
Sbjct: 305 -AVGYVPLSSEAYQINYVHLNQGKAG 329


>gi|146281973|ref|YP_001172126.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas stutzeri A1501]
 gi|145570178|gb|ABP79284.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas stutzeri A1501]
          Length = 323

 Score = 86.3 bits (212), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 121/283 (42%), Gaps = 49/283 (17%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           I GSST++P ++     F    P        SG +S G + FC G      DI ++SR++
Sbjct: 37  IDGSSTVYPLTREAIRRFQRAQPGHPIEVAFSG-TSAGFRRFCAG----KTDINDASRRM 91

Query: 90  TQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDDKV 147
             NE   C ++G+   +EV +  D I +V     D  S  +TVE+L K        +DKV
Sbjct: 92  NSNEQALCAQNGIG-YREVPLAMDAITVVVHPSNDWAS-DITVEELKKLWTP--AAEDKV 147

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
                + WS IR  +P+  + ++      GT +V  ++++ E   RS             
Sbjct: 148 -----RHWSHIRAGWPDRPVKLFGRGQDSGTYDVFTRQIVGE-AHRS------------- 188

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                      RQD  A E   +  E  A I    D  GF G+  Y  + D LKL+ ID 
Sbjct: 189 -----------RQDYTASE---NEEELAAGIAAEPDALGFFGIGAYHRHWDELKLLAIDS 234

Query: 268 ----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYV 305
               + P++ T+    Y P++RPL  Y+  +        R +V
Sbjct: 235 GKGPVYPTLKTVSEAHYQPLTRPLFIYLSERSLQEKPTTRAFV 277


>gi|27467988|ref|NP_764625.1| thioredoxine reductase [Staphylococcus epidermidis ATCC 12228]
 gi|251810818|ref|ZP_04825291.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis BCM-HMP0060]
 gi|282876174|ref|ZP_06285041.1| phosphate binding protein [Staphylococcus epidermidis SK135]
 gi|293366647|ref|ZP_06613324.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|81842853|sp|Q8CP98|PSTS_STAES RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|27315533|gb|AAO04667.1|AE016747_164 thioredoxine reductase [Staphylococcus epidermidis ATCC 12228]
 gi|251805653|gb|EES58310.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis BCM-HMP0060]
 gi|281295199|gb|EFA87726.1| phosphate binding protein [Staphylococcus epidermidis SK135]
 gi|291319416|gb|EFE59785.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|329732932|gb|EGG69277.1| phosphate binding protein [Staphylococcus epidermidis VCU028]
 gi|329736947|gb|EGG73205.1| phosphate binding protein [Staphylococcus epidermidis VCU045]
          Length = 325

 Score = 86.3 bits (212), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 123/294 (41%), Gaps = 58/294 (19%)

Query: 32  GSSTLFPYSKIIAENFSE-YFPEFKTPFVESG--GSSVGLKEFCRGIGDDTIDIVNSSRK 88
           GSST+ P    I E  +E +  + K   + SG  G+  G ++F  G      D  ++SR 
Sbjct: 42  GSSTVAP----IVEKLNEKWAKDHKDAKISSGQAGTGAGFQKFIAG----ETDFSDASRP 93

Query: 89  ITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVV 148
           I   E  + +  G+    E  I  DG+ +  ++D         D  K L    + D  + 
Sbjct: 94  IKDEEKKKLEDKGIK-YHEFKIAQDGVTIAVNKD--------NDFVKELTKSQLKD--IY 142

Query: 149 FNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNV 208
               K W ++   +P+ +I    P+  HGT +  E++V+                     
Sbjct: 143 SGKAKTWKDVNSSWPDKKINAVSPNSSHGTYDFFEEEVMD-------------------- 182

Query: 209 QQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--- 265
                     +QD I  E + D    ++ +  NK+  G+ G +FY+ N D LK V I   
Sbjct: 183 ----------KQD-IKAEKNADTNAIVSSVTKNKEGIGYFGYNFYEQNKDKLKEVKIKDD 231

Query: 266 DGIV--PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           +G V  P+  TI +G Y +SRPL  Y K +       + E++ F + DE  A +
Sbjct: 232 NGKVTEPTKKTIQNGSYALSRPLFIYAKDKSLKDNKVMSEFMKFVLEDEGKAAE 285


>gi|89896864|ref|YP_520351.1| hypothetical protein DSY4118 [Desulfitobacterium hafniense Y51]
 gi|89336312|dbj|BAE85907.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 338

 Score = 85.9 bits (211), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 134/294 (45%), Gaps = 50/294 (17%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           I GS T++P    IAEN+           V   GSS G K+F  G     +D  ++SRKI
Sbjct: 54  IDGSGTVYPLMSHIAENYMTSVQPDVNVQVGRAGSSAGFKKFIPG----ELDFSDASRKI 109

Query: 90  TQNELDECKKHGV---SDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKALASYLIV-D 144
              E+DE K  G+   +++ E+ + +DG+ +V +++   +  +T +++ K   S  +  D
Sbjct: 110 KSEEVDELKAKGLEMGTNVLEIKLAYDGLTIVINKNNDWAKEMTDDEIIKMFTSKAVKGD 169

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
           DKV+      WS+IRP++P+  +  Y P+  HGT E   + +L +           +D+ 
Sbjct: 170 DKVL------WSDIRPEWPKEEVKFYGPNENHGTYEFFYETILGK-----------KDL- 211

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                   VA  +++Q         +Y   +  +  +K+   F G  +Y +N D L  V 
Sbjct: 212 --------VASVNLQQ---------EYPTLVDLVSKDKNAIAFFGYGYYASNTDKLTAVK 254

Query: 265 ID----GIVPSMGTIVSGL--YPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           +D     + P + TI   L     +R +  Y+   +      + +Y  + VS+E
Sbjct: 255 VDFGKGPVAPELKTIGEDLDYAGFTRLVYTYLNLNYAKEKPQVLDYAKYVVSNE 308


>gi|148657710|ref|YP_001277915.1| phosphate binding protein [Roseiflexus sp. RS-1]
 gi|148569820|gb|ABQ91965.1| phosphate binding protein [Roseiflexus sp. RS-1]
          Length = 376

 Score = 85.9 bits (211), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 73/275 (26%), Positives = 128/275 (46%), Gaps = 47/275 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST++P +++  + F+E  P  +     S G+  G K+FC GI     DI ++SR
Sbjct: 76  IVIDGSSTVYPITELAMQQFAEIAPNVRIQLGVS-GTGGGFKKFCAGI----TDISDASR 130

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I  +E + C+ +G+ +  E+ +  DGI ++V+  +     +TV++L +  A     + K
Sbjct: 131 PIKPDESEICRANGI-EFVEIPVAFDGISVIVNPENRWVQCMTVDELKQMWAPD--SEGK 187

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           VV      W +IR ++P+    +Y P    GT +     ++ +                 
Sbjct: 188 VV-----TWKQIRAEWPDQPFKLYAPGIDSGTHDYFTAAIVGKE---------------- 226

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                     + R D I  E   DY   + R+   K+   +VG ++Y+   D + +V ID
Sbjct: 227 ---------DASRNDYIGSE--DDYI-LMQRVIEEKNGIAYVGFAYYQEYTDKVGVVAID 274

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
                + PS+ TI +G Y P++RPL  YV+    +
Sbjct: 275 AGNGCVSPSIETITNGTYTPLARPLFIYVRNDRLD 309


>gi|56751670|ref|YP_172371.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Synechococcus elongatus PCC 6301]
 gi|81301254|ref|YP_401462.1| phosphate binding protein [Synechococcus elongatus PCC 7942]
 gi|730807|sp|P39665|SPHX_SYNE7 RecName: Full=Protein sphX; Flags: Precursor
 gi|2126519|pir||S54402 SphX protein - Synechococcus sp
 gi|496319|dbj|BAA05147.1| SphX [Synechococcus elongatus PCC 7942]
 gi|56686629|dbj|BAD79851.1| periplasmic phosphate-binding protein of ABC transporter
           [Synechococcus elongatus PCC 6301]
 gi|81170135|gb|ABB58475.1| Phosphate binding protein [Synechococcus elongatus PCC 7942]
          Length = 337

 Score = 85.9 bits (211), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 73/282 (25%), Positives = 124/282 (43%), Gaps = 49/282 (17%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+FP S+ +AE F +         V   G+  G K FC G     IDI N+SR I +
Sbjct: 41  GSSTVFPISEAVAEEFQKRNKNINV-TVGVSGTGGGFKRFCNG----EIDIANASRPIKK 95

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
            E++ C+K G+  I E+ +  D + +V ++     S+T  +L K         +K   N 
Sbjct: 96  EEVEACRKKGIRYI-ELPVAFDALTVVVNKSNPVNSITTAELAKIFGRDA---EKKTTN- 150

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
              W +++  FP + + +Y P    GT +   + +L +                      
Sbjct: 151 ---WRQVKSSFPNLPLRVYAPGTDSGTYDYFNEAILNK---------------------- 185

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----D 266
                  R D  A E D    + ++R   ++   GF G S+Y+ N   LK + +      
Sbjct: 186 ----KGTRGDLTASEDDNILVQGVSR---DRGGIGFFGFSYYEENKGKLKALAVVNSNGK 238

Query: 267 GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
            ++PS+  +++G Y P++RP+  YV  Q       +R +V+F
Sbjct: 239 AVMPSVQNVLNGTYDPLARPVFIYVSEQAAKKA-NVRSFVNF 279


>gi|257387841|ref|YP_003177614.1| phosphate binding protein [Halomicrobium mukohataei DSM 12286]
 gi|257170148|gb|ACV47907.1| phosphate binding protein [Halomicrobium mukohataei DSM 12286]
          Length = 332

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/316 (24%), Positives = 131/316 (41%), Gaps = 58/316 (18%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKE-FCRGIGDDTIDIVNS 85
           ++ + GSST+FP S  +AE F E         V+  GS  G +  FC G      DI  S
Sbjct: 54  QVIVKGSSTVFPISDTMAEEFMEEHGNVNVT-VDPTGSGGGFENWFCAG----DSDINGS 108

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIVD 144
           SR IT  E+D+C  + V  + E  +  D +    + D   V  ++ E+L +  +      
Sbjct: 109 SRPITDAEVDQCATNDVEPV-EFQVAGDALTAAVNNDAEWVECMSFEELRQIWSD----- 162

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                N + +WS++R D+P+ ++ +Y P+   GT +   + V+ E    + ++    +  
Sbjct: 163 -----NDVTRWSDVREDWPDRKLELYGPASTSGTFDWFNEHVVGEEIEHTTDYQPTEE-- 215

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR-IEVNKDVFGFVGLSFYKNNADVLKLV 263
                                       ET+ R I  N    G+ G ++Y +N++ +K +
Sbjct: 216 ---------------------------DETIVRGIRDNGGGMGYFGYAYYSSNSEAVKAI 248

Query: 264 PIDG------IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
            I          PS+     G YP++RPL  YV          + EYV + +     A  
Sbjct: 249 DIKAEAGDKCTPPSLPNAKDGSYPMARPLFLYVAESALQREE-VYEYVRYYLE---QAET 304

Query: 318 SQLFQYGLIPISNEER 333
             +   G +P S E+R
Sbjct: 305 DVVQDIGYVPSSAEQR 320


>gi|83816189|ref|YP_446397.1| phosphate ABC transporter, phosphate binding protein [Salinibacter
           ruber DSM 13855]
 gi|294508334|ref|YP_003572392.1| ABC-type phosphate transport system, periplasmic component
           [Salinibacter ruber M8]
 gi|83757583|gb|ABC45696.1| phosphate ABC transporter, phosphate binding protein [Salinibacter
           ruber DSM 13855]
 gi|294344662|emb|CBH25440.1| ABC-type phosphate transport system, periplasmic component
           [Salinibacter ruber M8]
          Length = 355

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/317 (24%), Positives = 141/317 (44%), Gaps = 72/317 (22%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG--GSSVGLKEFCRGI 75
           CG  +   + + I GSST+FP ++ +AE F E   + +   V  G  G+  G  +F RG 
Sbjct: 32  CGGSSV--DSVSIDGSSTVFPLTEAVAEEFME---DSQGARVNVGVSGTGGGFSKFLRG- 85

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDL 133
                 I ++SR I  NE+++ + +G+  I E+ + +DG+ +V   + D  S  LT  +L
Sbjct: 86  ---ETAINDASRPIAPNEIEKAEANGIEFI-EIPVAYDGLAVVVHPENDWASC-LTAGEL 140

Query: 134 YKALASYLIVDDKVVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEG 190
                       + ++ P   + +W +IR  +P+  I +Y P    GT +   + ++ E 
Sbjct: 141 ------------REIWKPDSSIDRWGQIRDSYPDRPIKLYGPGTASGTYDYFTEAIVGEA 188

Query: 191 CVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGL 250
                +F+   D                  D + ++           I   +   G+ GL
Sbjct: 189 EASRSDFTASED------------------DNVLVQ----------GITGTETALGYFGL 220

Query: 251 SFYKNNADVLKLVPIDG---------IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLG 300
           ++Y+NNAD LK + ID          + P   T+ +G Y P+SRPL  YV          
Sbjct: 221 AYYENNADKLKALSIDPDERDGGAPCVTPGAETVKNGRYRPLSRPLFIYVNPAKITPT-- 278

Query: 301 LREYVSFSV--SDEMMA 315
           + ++V+F +  +DE+ +
Sbjct: 279 VEKFVTFYLQNADELAS 295


>gi|154250104|ref|YP_001410929.1| phosphate binding protein [Fervidobacterium nodosum Rt17-B1]
 gi|154154040|gb|ABS61272.1| phosphate binding protein [Fervidobacterium nodosum Rt17-B1]
          Length = 278

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 134/291 (46%), Gaps = 56/291 (19%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           RF   +L+  + L ++       +N + I GS+TL   +++  E F++ +PE K   +E 
Sbjct: 3   RFLLGILVLVLALNIFA----VDKNTLVIKGSNTLLDVAQLWVEEFNKLYPEIKVT-LEG 57

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDEC--KKHGVSDIQEVTIGHDGILLVS 119
            GSS G+        ++T DI NSSR +  +E+     +K  ++ I    +  DGI +V 
Sbjct: 58  AGSSTGIAALF----NNTTDIANSSRWLKNSEVQNMFNQKKWLAPI---LVAWDGIAIVV 110

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            +D+   ++T++ L             +    + +W++I P+ P   I  +  +   GT 
Sbjct: 111 HKDIQMKNITIQQL-----------KDIYTGKITRWNQIDPNLPARDIVAFSRNTASGTF 159

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           EV ++KVL +  +  R            V+ L  +   +              ET+A+  
Sbjct: 160 EVFKEKVLGDEKMSPR------------VRMLESSMAEL--------------ETVAKTP 193

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYV 290
            +   FG VG      + + +K++ ++GI PS   I++G YP+SRPL  +V
Sbjct: 194 FSIAYFG-VGYV----DPNQVKVLTVNGISPSKQNILAGKYPLSRPLFVFV 239


>gi|75909920|ref|YP_324216.1| phosphate binding protein [Anabaena variabilis ATCC 29413]
 gi|75703645|gb|ABA23321.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Anabaena variabilis ATCC 29413]
          Length = 352

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/326 (23%), Positives = 143/326 (43%), Gaps = 52/326 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + + GSST++P ++ IA+ F           V   G+  G  +FC G      DI N+SR
Sbjct: 49  VTVDGSSTVYPITQAIAKEFQANSKNNLQVQVNISGTGGGFTKFCAG----QTDINNASR 104

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILL-VSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            ITQ E+ +C ++G+  I E+ +  D + + V+ ++  +  +TV +L K       + + 
Sbjct: 105 PITQAEMADCNRNGIRYI-ELPVAFDALTIAVNPQNDWAKDITVAELKK-------IWEP 156

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                + +W+++R  +P+  + +Y    + GT                         F Y
Sbjct: 157 GAEGKITRWNQVRASWPDRPLNLYGAGKQSGT-------------------------FDY 191

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETL-ARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
             + ++    + R D  A E D    E L A I  + +  G+ G ++Y+ N   LK++ +
Sbjct: 192 FTEAITGKAKASRNDYTASEDD----EVLVAGISKDPNALGYFGYAYYEENQKSLKVLAV 247

Query: 266 D----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           D     I PS  T+    Y P+SRPL  YV      +   + ++  + +     AP +  
Sbjct: 248 DNGKGAITPSRETVEKSKYQPLSRPLFIYVNPWSSQNKSAVYQFADYYIK---QAPKTAK 304

Query: 321 FQYGLIPISNEERKSVRDSIAVGKSG 346
              G +P+S+E  +     +  GK+G
Sbjct: 305 -AVGYVPLSSEAYQINYVHLNQGKAG 329


>gi|222151445|ref|YP_002560601.1| ABC-type phosphate transport system periplasmic component PstS
           [Macrococcus caseolyticus JCSC5402]
 gi|222120570|dbj|BAH17905.1| ABC-type phosphate transport system periplasmic component PstS
           [Macrococcus caseolyticus JCSC5402]
          Length = 320

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 79/323 (24%), Positives = 131/323 (40%), Gaps = 64/323 (19%)

Query: 19  GTGTFARN---RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           GT T A++    +   GS+T+ P  + I E F+  +P+  T  + + G+  G ++F  G 
Sbjct: 37  GTDTAAKDIKGEVNGDGSTTVAPVVEKINEQFATEYPDV-TVSIGTSGTGGGFEKFIAG- 94

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
                D  N+SR I   E    +   + +  E  I  DG+ +  ++D             
Sbjct: 95  ---ETDFSNASRDIKDEEKKALEDKKI-EYTEFKIASDGLTVAVNKD------------N 138

Query: 136 ALASYLIVDD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVR 193
               YL  D+  K+     K W ++R DFP   I  + P   HGT +   ++VL +G   
Sbjct: 139 DFVDYLTFDELKKIYSGEAKTWKDVRADFPAEEIKAFSPDQSHGTYDFFSEEVLDKGE-- 196

Query: 194 SRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFY 253
                                        I  E + D    +  ++ NK   GF G +FY
Sbjct: 197 -----------------------------ITAEKNADTNVIVKSVQDNKAGIGFFGYNFY 227

Query: 254 KNNADVLKLVPI------DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSF 307
           + N D LK V I      +G+  +  T+  G YP+SRPL  Y K     S      ++ F
Sbjct: 228 QENKDNLKAVKIQKEGKGEGVEATEETVKEGSYPLSRPLFIYAKNDSLKSNEAFNTFMKF 287

Query: 308 SVSDEMMAPDSQLFQYGLIPISN 330
           ++ +   A D+   + G +P+ +
Sbjct: 288 TLEN---AKDASK-ESGYVPLED 306


>gi|323490092|ref|ZP_08095313.1| protein sphX [Planococcus donghaensis MPA1U2]
 gi|323396388|gb|EGA89213.1| protein sphX [Planococcus donghaensis MPA1U2]
          Length = 314

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 74/282 (26%), Positives = 127/282 (45%), Gaps = 46/282 (16%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + I E ++   P+ +     SG      ++F +G      D  N+SR I +
Sbjct: 48  GSSTVAPIMEGIVEEYAGAQPDVQVTVGTSGTGGG-FEKFIQG----ETDFSNASRPIKE 102

Query: 92  NELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFN 150
            E    ++ G+ +  E  + +DG+ ++VS  +     LTVEDL K     L V+D     
Sbjct: 103 EEAASLEEAGI-EYTEFQLAYDGLSVVVSQENDWVEDLTVEDLKK-----LWVED----G 152

Query: 151 PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQ 210
             KKWS+I P++P+  +  Y P    GT +   + +L++                   + 
Sbjct: 153 STKKWSDINPEWPDEEVVFYAPGTDSGTFDYFNEVILED-------------------ED 193

Query: 211 LSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVP 270
           L  + T    D   ++           I+ + +  GF G ++Y  N D LK+V IDG+ P
Sbjct: 194 LVSSATLSEDDNTLVQ----------GIQADPNAIGFFGYAYYVANQDTLKVVSIDGVEP 243

Query: 271 SMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           +  TI SG Y P+SRPL  Y             +++++++ +
Sbjct: 244 NNETIESGEYAPLSRPLFTYANNASLTDNEAAYDFMTYAIEN 285


>gi|299537690|ref|ZP_07050979.1| protein sphX precursor [Lysinibacillus fusiformis ZC1]
 gi|298726669|gb|EFI67255.1| protein sphX precursor [Lysinibacillus fusiformis ZC1]
          Length = 324

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 78/283 (27%), Positives = 129/283 (45%), Gaps = 48/283 (16%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E ++   P+ K     SG      ++F  G      D  N+SR I  
Sbjct: 58  GSSTVAPIIEAVVEEYAGTQPDVKVSVGVSGTGGG-FEKFIAG----ETDFSNASRNIKD 112

Query: 92  NELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFN 150
            E  + ++ G+ D  E+ + +DG+ ++V+  +  +  LTVE L K     + ++D     
Sbjct: 113 EEKAKLEEAGI-DFTELALAYDGLSVVVNPENDWAKDLTVEQLQK-----IWIEDGTE-- 164

Query: 151 PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEG-CVRSRNFSKMRDMFKYNVQ 209
             KKWS+I P +P+ +I  Y P    GT +  ++ +L     V S   S+  +M    VQ
Sbjct: 165 --KKWSDIDPSWPDEKIVYYSPGTDSGTYDYFDEVILDGADLVSSATLSEDDNML---VQ 219

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV 269
                       G+A    GD           K+  GF G ++Y  N D L +V ++G+ 
Sbjct: 220 ------------GVA----GD-----------KNAIGFFGYAYYLENKDKLNIVKVNGVE 252

Query: 270 PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           P+  TI  G Y P+SRPL  YVK           +++ F++ +
Sbjct: 253 PTNETIEGGEYTPLSRPLFTYVKNSAMKDNEAAYDFIKFTLEN 295


>gi|218248054|ref|YP_002373425.1| phosphate-binding protein [Cyanothece sp. PCC 8801]
 gi|257060622|ref|YP_003138510.1| phosphate binding protein [Cyanothece sp. PCC 8802]
 gi|218168532|gb|ACK67269.1| phosphate binding protein [Cyanothece sp. PCC 8801]
 gi|256590788|gb|ACV01675.1| phosphate binding protein [Cyanothece sp. PCC 8802]
          Length = 347

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 77/314 (24%), Positives = 138/314 (43%), Gaps = 54/314 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEY--FPEFKTPFVESG--GSSVGLKEFCRGIGDDTIDIV 83
           I++ GSST++P ++ + + + +   + + K   +E    G+  G K+FC G      DI 
Sbjct: 39  IKVDGSSTVYPITQAVLKAYQQQPAWKQVKDLSIEDNFSGTGGGFKKFCDG----ETDIN 94

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLI 142
            +SR I   E+  C ++ V  I E+ I  D + ++V+ ++  + +LTV  L  A  +   
Sbjct: 95  AASRPIMIEEMAACNQNQVRYI-EIPIAFDALTVVVNPKNNWTNTLTVTQLQTAWEAK-- 151

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
            + K+      +W+++ P +P   + +Y P  K GT +   + VL               
Sbjct: 152 AEGKIT-----QWNQVDPTYPNNPLNLYGPDKKSGTYDYFREAVLGPN------------ 194

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                           RQD +      D    +  +  + +   + G ++Y+ N D LK 
Sbjct: 195 -------------QDTRQDYV---FSADDEALVNGVSQDPNALAYFGYAYYEQNQDKLKA 238

Query: 263 VPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           V ID    G++PS  T+ +  Y P++RPL  YV  +       L ++V F +     A  
Sbjct: 239 VGIDNGQGGVLPSRETVEANQYKPLTRPLFIYVNAKRAQENPALEDFVKFYLE----AVP 294

Query: 318 SQLFQYGLIPISNE 331
             + Q G IP+S E
Sbjct: 295 ELVTQVGYIPLSEE 308


>gi|212638722|ref|YP_002315242.1| phosphate ABC transporter periplasmic protein [Anoxybacillus
           flavithermus WK1]
 gi|212560202|gb|ACJ33257.1| ABC-type phosphate transport system, periplasmic component
           [Anoxybacillus flavithermus WK1]
          Length = 348

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 124/272 (45%), Gaps = 50/272 (18%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            + + GSST++P  +  AE ++   P+ K   V   G+  G ++F +G      D  N+S
Sbjct: 69  NVVVDGSSTVYPILEAAAEAYAGEQPDVKVS-VGLSGTGGGFEKFTKG----ETDFSNAS 123

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDG--ILLVSDRDMVSVSLTVEDLYKALASYLIV- 143
           R I   E    +++G+   +E  +  DG  +L+  D D V   LTV++L K   S  +  
Sbjct: 124 RPIKDEEKKAAEQNGIQ-FEEFQVAFDGLSVLINKDNDWVDY-LTVDELKKIFTSGAVNG 181

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           +DKV      KWS+IRP++P   I ++ P    GT +  ++ +L                
Sbjct: 182 NDKV------KWSDIRPEWPNEEIKLFSPGHDSGTFDYFDEVIL---------------- 219

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              + Q L+        D + ++           I  +K+  G+ G ++Y  N D LK V
Sbjct: 220 ---DGQPLNKTAQLSEDDNVLVQ----------GIAGDKNALGYFGFAYYIENKDKLKAV 266

Query: 264 PIDG----IVPSMGTIVSGLY-PISRPLLFYV 290
           PID     + P+  TI SG Y P+SRPL  Y 
Sbjct: 267 PIDNGNGPVEPTHETIQSGEYAPLSRPLFTYA 298


>gi|169829094|ref|YP_001699252.1| protein sphX [Lysinibacillus sphaericus C3-41]
 gi|168993582|gb|ACA41122.1| Protein sphX precursor [Lysinibacillus sphaericus C3-41]
          Length = 330

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 127/283 (44%), Gaps = 48/283 (16%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E ++   P+ K     SG      ++F  G      D  N+SR I  
Sbjct: 64  GSSTVAPIIEAVVEEYAGAQPDVKVSVGVSGTGGG-FEKFIAG----ETDFSNASRNIKD 118

Query: 92  NELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFN 150
            E  +  + G+ D  E+ + +DG+ ++V+  +  +  LTVE L K      I D K    
Sbjct: 119 EEKAKLGEAGI-DYTELALAYDGLSVVVNPENDWAKDLTVEQLQK----IWIEDGKE--- 170

Query: 151 PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEG-CVRSRNFSKMRDMFKYNVQ 209
             KKWS+I P +P+ +I  Y P    GT +  ++ +L     V S   S+  +M    VQ
Sbjct: 171 --KKWSDIDPSWPDEKIVYYSPGTDSGTYDYFDEIILDGADLVSSATLSEDDNML---VQ 225

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV 269
            +S                GD           K+  GF G ++Y  N D L +V ++G+ 
Sbjct: 226 GVS----------------GD-----------KNAIGFFGYAYYLENKDKLNIVKVNGVE 258

Query: 270 PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           P+  TI +G Y P+SRPL  YVK           +++ F++ +
Sbjct: 259 PNNETIEAGEYTPLSRPLFTYVKNSAMKDNEAAYDFIKFTLEN 301


>gi|309951514|gb|ADO95180.1| putative phosphate ABC transporter [Sinorhizobium sp. M14]
          Length = 376

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/292 (26%), Positives = 131/292 (44%), Gaps = 57/292 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + I GSST+FP S+ +AE F +         V S G+  G K+FCRG      DI  +SR
Sbjct: 71  VLIDGSSTVFPISEAMAEEFQKAQAGKTLVTVGSSGTGGGFKKFCRG----ETDITGASR 126

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I  +E++ CK++GV  I E+ +  D +  +V+  +  +  +TVE+L K       + + 
Sbjct: 127 PIKSDEIELCKQNGVEFI-ELPVAIDALATIVNPANDWATCMTVEELKK-------IWEP 178

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W+++R +FP+ ++ ++      GT                       D + +
Sbjct: 179 EAQGKVTNWNQVRGEFPDAKLGLFGAGTDSGT----------------------YDYYTF 216

Query: 207 NVQQLSVAC----TSVRQDGIAIE-VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
            +     A     T+   D I I+ V GD           K+  GF+GL++   NA  +K
Sbjct: 217 AINGKEHASRGDYTATEDDNITIQGVGGD-----------KNAIGFLGLAYLTENAGKVK 265

Query: 262 LVPI---DG--IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
            V I   DG  + PS+ T   G Y P++RPL +Y  ++       +R +  F
Sbjct: 266 AVEIKQADGSCVAPSIETATDGTYQPLTRPLFYYASKKSAEEKEHVRAFAEF 317


>gi|329729388|gb|EGG65794.1| phosphate binding protein [Staphylococcus epidermidis VCU144]
          Length = 325

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 123/294 (41%), Gaps = 58/294 (19%)

Query: 32  GSSTLFPYSKIIAENFSE-YFPEFKTPFVESG--GSSVGLKEFCRGIGDDTIDIVNSSRK 88
           GSST+ P    I E  +E +  + K   + SG  G+  G ++F  G      D  ++SR 
Sbjct: 42  GSSTVAP----IVEKLNEKWAKDHKDAKISSGQAGTGAGFQKFIAG----ETDFSDASRP 93

Query: 89  ITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVV 148
           I   E  + +  G+    E  I  DG+ +  ++D         D  K L    + D  + 
Sbjct: 94  IKDEEKKKLEDKGIK-YHEFKIAQDGVTIAVNKD--------NDFVKELTKSQLKD--IY 142

Query: 149 FNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNV 208
               K W ++   +P+ +I    P+  HGT +  E++V+                     
Sbjct: 143 SGKAKTWKDVNSSWPDKKINAVSPNSIHGTYDFFEEEVMD-------------------- 182

Query: 209 QQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--- 265
                     +QD I  E + D    ++ +  NK+  G+ G +FY+ N D LK V I   
Sbjct: 183 ----------KQD-IKAEKNADTNAIVSSVTKNKEGIGYFGYNFYEQNKDKLKEVKIKDD 231

Query: 266 DGIV--PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           +G V  P+  TI +G Y +SRPL  Y K +       + E++ F + DE  A +
Sbjct: 232 NGKVTEPTKKTIQNGSYALSRPLFIYAKDKSLKDNKVMSEFMKFVLEDEGKAAE 285


>gi|323500038|ref|ZP_08104992.1| phosphate binding protein [Vibrio sinaloensis DSM 21326]
 gi|323314894|gb|EGA67951.1| phosphate binding protein [Vibrio sinaloensis DSM 21326]
          Length = 333

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 82/348 (23%), Positives = 148/348 (42%), Gaps = 54/348 (15%)

Query: 8   LMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG--GSS 65
           + C  +      +   A++ I+I GSST++P +  +A+ +     E     V  G  G+ 
Sbjct: 10  ITCCAIALSATTSDVHAKDLIKIEGSSTVYPITYQLAKRY--MLSEGTGTQVAVGISGTG 67

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G ++FCRG      DI N+SR I Q E   C+ +G+  I E+ +  D I +V + +   
Sbjct: 68  GGFRKFCRG----RTDISNASRPIKQKERQLCQANGIEFI-ELPVAMDAITVVVNSENTW 122

Query: 126 V-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           + SL++  L +       +  +     L  WS+    FP   + ++ P    GT      
Sbjct: 123 LESLSLRQLNQ-------IWQREAEASLTSWSQFDAKFPNNPLQLHGPGPDSGT------ 169

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
                            D F     ++++A    RQD IA E D   +  +A +  + + 
Sbjct: 170 ----------------YDYFT----EVTLAGEPSRQDYIANEDD---SAMVAEVAADPNA 206

Query: 245 FGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
             F+G ++Y  N D LK + I       ++P++  ++ G Y  +SRPL  YV +      
Sbjct: 207 MAFLGFAYYLQNQDKLKAIAISEFGGPPMLPNVENVMEGGYSALSRPLFIYVNKASLEKR 266

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
             ++ ++      E +  D  +   G IP+S +     R  + + K+G
Sbjct: 267 GSVKRFLEMYFQPENI--DQTVALSGYIPLSAQMYDVARQVLQLKKTG 312


>gi|56478170|ref|YP_159759.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Aromatoleum aromaticum EbN1]
 gi|56314213|emb|CAI08858.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           [Aromatoleum aromaticum EbN1]
          Length = 330

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 135/312 (43%), Gaps = 50/312 (16%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
           F  V L   +VL  +      A++ +++ GSST+FP ++ +AE+  +         V   
Sbjct: 4   FKQVALATALVL--FGSHAVHAQSIVKVDGSSTVFPITEAVAEDIQKARKGSVKVTVGIS 61

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDR 121
           G+  G K+FCRG     ID+  +SR I + E++ C   G+    E+ +  D + ++V+ +
Sbjct: 62  GTGGGFKKFCRG----EIDVSGASRPILKKEMEACASAGIR-YYELPVAFDALTVIVNPK 116

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           +     LTVE L K         +      +  W +I   FP+V + ++      GT   
Sbjct: 117 NTFVKQLTVEQLKKMW-------EPDAQGKVTSWKQIDSSFPDVPLKLFGAGSDSGT--- 166

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
                                 F Y  + +     + R D  A E D    + ++R   +
Sbjct: 167 ----------------------FDYFTEAVVGKAKASRGDFTASEDDNVLVQGVSR---D 201

Query: 242 KDVFGFVGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
           ++  G+ G ++Y  N   LK VPI       + P   +++SG Y P+SRP+  YV  +  
Sbjct: 202 QNAIGYFGYAYYAENQGKLKAVPIVNKEGKAVSPGPDSVISGAYNPLSRPIFIYVSEKSL 261

Query: 296 NSVLGLREYVSF 307
                +R++V++
Sbjct: 262 EKPE-VRDFVAY 272


>gi|76801635|ref|YP_326643.1| ABC transporter periplasmic phosphate-binding protein [Natronomonas
           pharaonis DSM 2160]
 gi|76557500|emb|CAI49080.1| ABC-type transport system periplasmic phosphate-binding protein
           (probable substrate phosphate) 1 [Natronomonas pharaonis
           DSM 2160]
          Length = 353

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 74/280 (26%), Positives = 124/280 (44%), Gaps = 53/280 (18%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R  I + GS+T+ P+   +AE F         P V   G+  G ++FCRG      DI N
Sbjct: 48  RGEITMDGSNTVLPHGAAVAEEFLWRNNRVTIP-VRGSGTGAGFQQFCRG----ETDIQN 102

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIV 143
           +SR + ++E   C ++GV D  E+    DGI ++ D D      LTVE+L     S    
Sbjct: 103 ASRPVQESEEQLCTENGV-DYIELEALLDGIAIMVDADNDWCDCLTVEELRAMWES---- 157

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQE-GCVRSRNFSKMRD 202
                 + ++ WS++RP +P+  I  +      GT +   ++++ E G +R+ ++S   D
Sbjct: 158 -----GSDVETWSDVRPAWPDEEIDFFGRDTASGTFDSFTERLMGETGNIRN-DYSASSD 211

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR-IEVNKDVFGFVGLSFYKNNADVLK 261
                                        T  + R +  N++  GF G  FY  N D L+
Sbjct: 212 -----------------------------TNVIVRGVSGNRNAIGFGGAGFYYENEDQLR 242

Query: 262 LVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           LV +D     + P+  TI +  Y P++RP+  Y+  +  +
Sbjct: 243 LVGVDDGNGCVRPTRETIENEEYTPLTRPMYVYLSTERLD 282


>gi|126652197|ref|ZP_01724376.1| phosphate ABC transporter, phosphate-binding protein [Bacillus sp.
           B14905]
 gi|126590929|gb|EAZ85041.1| phosphate ABC transporter, phosphate-binding protein [Bacillus sp.
           B14905]
          Length = 387

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 79/283 (27%), Positives = 127/283 (44%), Gaps = 48/283 (16%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E ++   P+ K         S     F + I  +T D  N+SR I  
Sbjct: 121 GSSTVAPIIEAVVEEYAGAQPDVKVSVG----VSGTGGGFEKFIAGET-DFSNASRNIKD 175

Query: 92  NELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFN 150
            E  +  + G+ D  E+ + +DG+ ++V+  +  +  LTVE L K      I D K    
Sbjct: 176 EEKAKLGEAGI-DYTELALAYDGLSVVVNPENDWAKDLTVEQLQK----IWIEDGKE--- 227

Query: 151 PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEG-CVRSRNFSKMRDMFKYNVQ 209
             KKWS+I P +P+ +I  Y P    GT +  ++ +L     V S   S+  +M    VQ
Sbjct: 228 --KKWSDIDPSWPDEKIVYYSPGTDSGTYDYFDEIILDGADLVSSATLSEDDNML---VQ 282

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV 269
            +S                GD           K+  GF G ++Y  N D L +V ++G+ 
Sbjct: 283 GVS----------------GD-----------KNAIGFFGYAYYLENKDKLNIVKVNGVE 315

Query: 270 PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           P+  TI +G Y P+SRPL  YVK           +++ F++ +
Sbjct: 316 PNNETIEAGEYTPLSRPLFTYVKNSAMKDNEAAYDFIKFTLEN 358


>gi|159900510|ref|YP_001546757.1| phosphate binding protein [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893549|gb|ABX06629.1| phosphate binding protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 651

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 78/329 (23%), Positives = 138/329 (41%), Gaps = 59/329 (17%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSE--YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
           +  I  AGSST++P S+ +AE F+E  Y        ++S G+  G + FC        DI
Sbjct: 77  KGDIVSAGSSTVYPLSEAVAEIFTEDGYTGNIT---IDSIGTGAGFERFCTAA---ETDI 130

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLT---VEDLYKALA 138
            N+SR I   E   C   G  ++ E  +G D + ++VS ++    +LT   V D++    
Sbjct: 131 ANASRAIKDEEAKACADKG-REVVEFRVGTDALAVVVSSKNTFVSNLTEAQVADIFSGT- 188

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE-VLEKKVLQEGCVRSRNF 197
                         K W ++   +P   I +Y P    GT +  +E    +EG       
Sbjct: 189 -------------YKTWDQVDASYPAEAIKLYSPGTDSGTFDYFVEHFYAKEG------- 228

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
              + +   N  QLS        D + +            IE + +  G+ G ++Y  N 
Sbjct: 229 ---KFILGAN-PQLS------EDDNVLV----------TGIEGDANAIGYFGYAYYNENK 268

Query: 258 DVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
             LK + IDG+ P+  T   G YP++RPL  Y  +        +  ++++ +++     +
Sbjct: 269 AKLKALTIDGVEPTEATTEDGSYPLARPLYIYSAKNILTEKPQVAAFINYYLTN----VN 324

Query: 318 SQLFQYGLIPISNEERKSVRDSIAVGKSG 346
             + + G  P S+E     +D++    +G
Sbjct: 325 DVILEVGYFPASDEALGEAKDALVNALTG 353



 Score = 83.6 bits (205), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/325 (24%), Positives = 136/325 (41%), Gaps = 61/325 (18%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSE--YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
           +  I  AGSST++P S+ +AE F E  Y        ++S G+  G + FC        DI
Sbjct: 376 QGDIVSAGSSTVYPLSEAVAEIFGEDGYSGNIT---IDSIGTGAGFERFCTAA---ETDI 429

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLT---VEDLYKALA 138
            N+SR I   E   C   G  ++ E  +G D + ++VS ++    +LT   V D++    
Sbjct: 430 ANASRAIKDEEAKACADKG-REVVEFRVGTDALAVVVSSKNTFVTNLTEAQVADIFSGT- 487

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                         K W ++   +P   I +Y P    GT +      ++    +   F 
Sbjct: 488 -------------YKTWDQVDASYPAEAIKLYSPGTDSGTFDYF----VEHFYAKEEKF- 529

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
               M   N  QLS        D + +            IE + +  G+ G ++Y  N  
Sbjct: 530 ----MLGAN-PQLS------EDDNVLV----------TGIEGDANAIGYFGYAYYNENKS 568

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
            LK + IDG+ P+  T   G YP++RPL  Y  +    ++L  +  V+  ++  +   + 
Sbjct: 569 KLKALTIDGVEPTEATTEDGSYPLARPLYIYSAK----NILAEKAQVAAFINYYLTNVNE 624

Query: 319 QLFQYGLIPIS----NEERKSVRDS 339
            + + G  P S    NE ++++ D+
Sbjct: 625 VILEVGYFPASEEALNEAKQNLLDA 649


>gi|320162173|ref|YP_004175398.1| putative phosphate ABC transporter substrate binding protein
           precursor [Anaerolinea thermophila UNI-1]
 gi|319996027|dbj|BAJ64798.1| putative phosphate ABC transporter substrate binding protein
           precursor [Anaerolinea thermophila UNI-1]
          Length = 355

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 82/320 (25%), Positives = 138/320 (43%), Gaps = 59/320 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENF--SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
           I  AGSST+ P ++ I E F    +  + K   +   GS  G + FC+       DI N+
Sbjct: 72  IYTAGSSTVGPLTEAIIEMFVADGFTGQVKNDII---GSGAGFERFCK---TGETDISNA 125

Query: 86  SRKITQNELDECKK-HGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLI 142
           SRKI  +E++ C K +   +     +G D I +V     D V  ++T + L+K       
Sbjct: 126 SRKIKDSEVENCGKLNPARNPIGFLVGLDAIAVVVNPQNDWVE-NVTKDQLFK------- 177

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
                +F   +KWS++ P +P   I  Y P    GT +   +  +Q    ++    K+ +
Sbjct: 178 -----LFTSAEKWSDVDPSWPNEPILRYTPGTDSGTFDFFVEVAVQ----KTGKIEKLDE 228

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
             K  ++  ++  +    D + ++           +E NK   G+ G ++YK     LK+
Sbjct: 229 AKKLVLEAKNLNAS--EDDNVLVQ----------GVEGNKYAIGYFGYAYYKGEGSKLKV 276

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKR-----------------QHFNSVLGLREYV 305
           + I+GI PS+ T  +G Y +SRPL  Y                    +H N V  + E  
Sbjct: 277 LSIEGIKPSLETAENGTYLLSRPLFIYSDAGIMKSKPQVAAFIRYYLEHVNEV--IEEVG 334

Query: 306 SFSVSDEMMAPDSQLFQYGL 325
            F  S E M  + +LF+  +
Sbjct: 335 YFPASKEAMENNLKLFEEAM 354


>gi|224476521|ref|YP_002634127.1| putative phosphate transport system substrate-binding protein
           [Staphylococcus carnosus subsp. carnosus TM300]
 gi|222421128|emb|CAL27942.1| putative phosphate transport system substrate-binding protein
           [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 311

 Score = 84.0 bits (206), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 70/295 (23%), Positives = 119/295 (40%), Gaps = 54/295 (18%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           A+  ++  GSST+ P  +++ E F++ +P   T    + G+  G ++F  G      D  
Sbjct: 36  AKGEVKGDGSSTVGPIVEVLNEKFNKKYPNI-TVSSATSGTGGGFEKFIAG----ESDFS 90

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLI 142
           N+SR I   E  +     V    +  I  DG+ +  ++D   V  LT++DL         
Sbjct: 91  NASRPIKPEEKKKLDDKKVK-FSDFKIAQDGVTIAVNKDNDFVKELTIDDL--------- 140

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
              K+     K W ++ P +P  +I  + P   HGT +  E++V+               
Sbjct: 141 --KKIYSGQAKTWKDVNPKYPAKQIKAFSPDQSHGTYDFFEEEVM--------------- 183

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                            ++ I  E + D    +  +  NK+  G+ G +FY+ N D LK 
Sbjct: 184 ----------------NKEDIKAEKNADTNVIVQSVTNNKEGIGYFGYNFYEQNKDKLKE 227

Query: 263 VPIDG-----IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           V I G     I P+  TI    Y +SRPL  Y   +          ++ F + D+
Sbjct: 228 VKIKGKDGKAIAPTKKTIQDSSYALSRPLFIYTNDKKLKDNKAFGTFMKFVLEDK 282


>gi|42523158|ref|NP_968538.1| periplasmic phosphate-binding protein of ABC transporter
           [Bdellovibrio bacteriovorus HD100]
 gi|39575363|emb|CAE79531.1| Periplasmic phosphate-binding protein of ABC transporter
           [Bdellovibrio bacteriovorus HD100]
          Length = 333

 Score = 83.6 bits (205), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 77/296 (26%), Positives = 135/296 (45%), Gaps = 57/296 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+I GSST+FP ++ +AE F           V   G+  G K+FCRG      D+ N+SR
Sbjct: 25  IKIDGSSTVFPITEAMAEEFQTSQRGKVRVTVGISGTGGGFKKFCRG----ETDVQNASR 80

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I  +E++ C+K G+  + E+ + +D   ++V+ ++    S+TV DL K         + 
Sbjct: 81  PIQASEIEACRKAGIKFL-ELPVAYDATAVVVNPKNTWLKSITVADLKKMW-------EP 132

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W+++ P +P+ ++ +Y      GT                         F Y
Sbjct: 133 GAQGKINTWADVNPAWPKEKLKLYGAGSDSGT-------------------------FDY 167

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF--GFVGLSFYKNNADVLKLVP 264
             + +     S R D  A E D     TL    V+ D++  G+V L++Y+ N   LK+V 
Sbjct: 168 FTEAVVGKSKSSRGDYTASEDD----NTLV-TGVSNDLYALGYVPLAYYEENKGKLKVVA 222

Query: 265 IDG----------IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           I G          ++P   T+ +G Y P+SRP+  YV  +   +   ++E+++F +
Sbjct: 223 IVGGDKAPKKNEAVLPGRETVENGSYFPLSRPIFIYVSEKSM-AKPEVKEFINFYI 277


>gi|55378286|ref|YP_136136.1| phosphate ABC transporter phosphate-binding protein [Haloarcula
           marismortui ATCC 43049]
 gi|55231011|gb|AAV46430.1| phosphate ABC transporter phosphate-binding protein [Haloarcula
           marismortui ATCC 43049]
          Length = 337

 Score = 83.6 bits (205), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 79/316 (25%), Positives = 135/316 (42%), Gaps = 57/316 (18%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKE-FCRGIGDDTIDIVNS 85
           ++ I GSST+FP S  +AE F           V+S GS  G +  FC G      DI  +
Sbjct: 58  QVIIKGSSTVFPISDAMAEEFMAEHGNVNVT-VDSTGSGGGFENWFCPG----DSDINGA 112

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIVD 144
           SR IT  E+++C  + V  + E  I  D + +  + D   V  LT ++L +     +  D
Sbjct: 113 SRPITDAEIEQCSGNNVEPV-EFEIAGDALTVAVNNDADWVDCLTFDELRQ-----IWSD 166

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
           +  V N    WS++R ++P++ I  Y P+   GT +   + V+ E    +  +    +  
Sbjct: 167 ESDVTN----WSDVRDEWPDMEIERYGPASTSGTFDYFNENVVGEDTEHTTEYQPTEE-- 220

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR-IEVNKDVFGFVGLSFYKNNADVLKLV 263
                                       ET+ + I  N+   G+ G ++Y +N++ +K V
Sbjct: 221 ---------------------------DETIVQGIRDNEGGIGYFGFAYYNSNSEAVKAV 253

Query: 264 PI----DG--IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
            +    DG    PS+     G YP++RPL  Y       +   + E++ F +     A  
Sbjct: 254 EVKAEEDGECTAPSLANAKDGSYPLARPLFIYASESSLQN-EAVYEFIRFYLE---QAET 309

Query: 318 SQLFQYGLIPISNEER 333
             + + G +P S E+R
Sbjct: 310 DIVQEIGYVPSSAEQR 325


>gi|314933568|ref|ZP_07840933.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus caprae C87]
 gi|313653718|gb|EFS17475.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus caprae C87]
          Length = 326

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 74/299 (24%), Positives = 130/299 (43%), Gaps = 64/299 (21%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESG--GSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           GSST+ P  + + E +++   + K   + SG  G+  G ++F  G      D  ++SR I
Sbjct: 42  GSSTVAPIVEKLNEKWAKNHKDAK---ISSGQAGTGAGFQKFIAG----ETDFSDASRPI 94

Query: 90  TQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLT---VEDLYKALASYLIVDD 145
              E  + +  G+    E  I  D + +  ++D   V SLT   ++D+Y   A       
Sbjct: 95  KDEEKKKLEDKGIK-YHEFKIAQDAVTIAVNKDNKFVKSLTKSQLKDIYSGKA------- 146

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  K W ++   +P  +I    P+  HGT +  E++V+                  
Sbjct: 147 -------KTWKDVNSKWPNKKINAVSPNSSHGTYDFFEEEVMN----------------- 182

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                        +QD I  E + D  + ++ +  NK+  G+ G +FY+ N D LK V I
Sbjct: 183 -------------KQD-IKAEKNADTNQLVSSVTKNKEGIGYFGYAFYEQNKDKLKEVKI 228

Query: 266 ---DGIV--PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
              +G +  P+  TI +G Y +SRPL  YVK +       + E++ F + DE  + +++
Sbjct: 229 KDDNGKLTEPTKKTIKNGSYALSRPLFIYVKDKSLKDNKVMSEFMKFVLKDEGKSAEAK 287


>gi|242373684|ref|ZP_04819258.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis M23864:W1]
 gi|242348652|gb|EES40254.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis M23864:W1]
          Length = 331

 Score = 83.6 bits (205), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 122/289 (42%), Gaps = 58/289 (20%)

Query: 32  GSSTLFPYSKIIAENFSE-YFPEFKTPFVESG--GSSVGLKEFCRGIGDDTIDIVNSSRK 88
           GSST+ P    I E  +E +  + K   + SG  G+  G ++F  G      D  ++SR 
Sbjct: 42  GSSTVAP----IVEKLNEKWAKDHKDAKISSGQAGTGAGFQKFIAG----ETDFSDASRP 93

Query: 89  ITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVV 148
           I   E  + +  G+    E  I  DG+ +  ++D         D  K L    + +  + 
Sbjct: 94  IKDEEKKKLEDKGIK-YHEFKIAQDGVTIAVNKD--------NDFVKELTKSQLKE--IY 142

Query: 149 FNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNV 208
               K W ++   +P+ +I    P+  HGT +  E++V+                     
Sbjct: 143 SGKAKTWKDVNSKWPDKKINAVSPNSSHGTYDFFEEEVMD-------------------- 182

Query: 209 QQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--- 265
                     +QD I  E + D    ++ +  NK+  G+ G +FY+ N D LK V I   
Sbjct: 183 ----------KQD-IKAEKNADTNAIVSSVTKNKEGIGYFGYNFYEQNKDKLKEVKIKDD 231

Query: 266 DGIV--PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           +G +  P+  TI +G Y +SRPL  YVK +       + E++ F + DE
Sbjct: 232 NGKLTEPTKKTIKNGSYALSRPLFIYVKDKSLKDNKVMSEFMKFVLKDE 280


>gi|310657921|ref|YP_003935642.1| phosphate ABC transporter phosphate-binding protein [Clostridium
           sticklandii DSM 519]
 gi|308824699|emb|CBH20737.1| phosphate abc transporter, phosphate-binding protein [Clostridium
           sticklandii]
          Length = 332

 Score = 83.2 bits (204), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 77/300 (25%), Positives = 132/300 (44%), Gaps = 50/300 (16%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           ++ + GS T++P    IAEN+        +  V   GSS G K+F  G     +D  ++S
Sbjct: 44  QVIVDGSGTVYPLMANIAENYMTSVQPGVSVQVGRAGSSAGFKKFIPG----ELDFADAS 99

Query: 87  RKITQNELDECKKHGV---SDIQEVTIGHDGILLVSDRDMV-SVSLTVEDLYKALASYLI 142
           R I   E  + ++ G+    ++ E  +  DG+ +V +++   +  +T +++ K   S   
Sbjct: 100 RAIKDEEKAQLEEKGMKLGENVLEFKLALDGLTMVINKENTWAKEMTKDEIVKMYLSGSY 159

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
             D VV     KWS+IR D+P   I  Y P+  HGT E   +K+L E           +D
Sbjct: 160 NADDVV-----KWSDIRADWPAEEIKFYGPNENHGTFEFFFEKILDE-----------QD 203

Query: 203 MFK-YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
           M K  N+QQ                   +Y+  +  +  +K+   F G  +Y +N D L+
Sbjct: 204 MVKTANLQQ-------------------EYSTLVDLVSNDKNAIAFFGYGYYASNQDKLQ 244

Query: 262 LVPID----GIVPSMGTIVSGL--YPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
            V +D     + P++ TI   L     +RP+  Y+   +      + +Y  F VS +  A
Sbjct: 245 AVHVDFGNGPVEPTLETIGEDLPYAGFTRPVFTYLNADYAKERPQVLDYAKFVVSKDGAA 304


>gi|327480219|gb|AEA83529.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas stutzeri DSM 4166]
          Length = 323

 Score = 83.2 bits (204), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 117/268 (43%), Gaps = 49/268 (18%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           I GSST++P ++     F    P        S G+S G + FC G      DI ++SR++
Sbjct: 37  IDGSSTVYPLTREAVRRFQRAQPGHPIEVAFS-GTSAGFRRFCAG----KTDINDASRRM 91

Query: 90  TQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDDKV 147
             +E   C ++G+   +EV +  D I +V     D  S  +TVE+L K        +DKV
Sbjct: 92  NSSEQALCAQNGIG-YREVPLAMDAITVVVHPSNDWAS-DITVEELKKLWTP--AAEDKV 147

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
                + WS IR  +P+  + ++      GT +V  ++++ E   RS             
Sbjct: 148 -----RHWSHIRAGWPDRPVKLFGRGQDSGTYDVFTRQIVGE-AHRS------------- 188

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                      RQD  A E   +  E  A I    D  GF G+  Y  + D LKL+ ID 
Sbjct: 189 -----------RQDYTASE---NEEELAAGIAAEPDALGFFGIGAYHRHWDELKLLAIDS 234

Query: 268 ----IVPSMGTIVSGLY-PISRPLLFYV 290
               + P++ T+    Y P++RPL  Y+
Sbjct: 235 GKGPVYPTLKTVSEAHYQPLTRPLFIYL 262


>gi|289550797|ref|YP_003471701.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Staphylococcus lugdunensis HKU09-01]
 gi|315658292|ref|ZP_07911164.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus lugdunensis M23590]
 gi|289180329|gb|ADC87574.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Staphylococcus lugdunensis HKU09-01]
 gi|315496621|gb|EFU84944.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus lugdunensis M23590]
          Length = 326

 Score = 83.2 bits (204), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 69/300 (23%), Positives = 118/300 (39%), Gaps = 52/300 (17%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
            G G      ++  GSST+ P  + + E F++ +P+       SG      ++F  G   
Sbjct: 26  SGNGKDVSGEVKGDGSSTVGPIVEKLNEKFAKDYPDVTVSSGTSGTGGG-FEKFIAG--- 81

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKAL 137
              D  N+SR I   E  + +   +   +E  I  DG+ +  ++D   V    +D  K  
Sbjct: 82  -ETDFSNASRPIKDEEKKKLEDKNIK-YKEYKIAQDGVTVTVNKDNDFVDSLSKDQLK-- 137

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
                   K+     K W ++   +P  +I  + P   HGT +   ++V+ +G +++   
Sbjct: 138 --------KIYSGEAKTWKDVNSSWPNKKIKAFSPDQSHGTYDFFSEEVMDKGDIKA--- 186

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
                                       E + D    +  +E NK+  G+ G +FY+ N 
Sbjct: 187 ----------------------------EKNADTNVIVQSVEKNKEGIGYFGYNFYQQNK 218

Query: 258 DVLKLVPI-----DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           D LK V I         P+  TI    Y +SRPL  Y K +      G +E++ F + DE
Sbjct: 219 DKLKEVKIKDDKGKDTKPTKKTIQDNSYALSRPLFIYAKEKSLEENKGFQEFMKFVLKDE 278


>gi|154247879|ref|YP_001418837.1| phosphate binding protein [Xanthobacter autotrophicus Py2]
 gi|154161964|gb|ABS69180.1| phosphate binding protein [Xanthobacter autotrophicus Py2]
          Length = 333

 Score = 83.2 bits (204), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 73/288 (25%), Positives = 128/288 (44%), Gaps = 49/288 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +++ GSST+FP ++ +AE F +   + K   V   G+  G K+FCRG     IDI ++SR
Sbjct: 28  VKVDGSSTVFPVTEAMAEEFQKANKDIKV-TVGISGTGGGFKKFCRG----EIDISDASR 82

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            IT  E   CK+ G+  I E+ +  D + ++V   +  +  +TV DL K       + + 
Sbjct: 83  PITSAEQKACKEAGIEYI-ELPVALDALTVIVHPSNTWASEMTVADLKK-------IWEP 134

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W ++R  +P+  + +Y      GT +     ++ +      +F+   D    
Sbjct: 135 EAQGKITNWKQVRDSYPDRPLVLYGAGVDSGTYDYFTAAIVGKEHSSRGDFTASED---- 190

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                     +V   G+A    GD            +  GF GL++Y+ N   LK V I 
Sbjct: 191 ---------DNVLVQGVA----GD-----------PNALGFFGLAYYEENTGKLKAVKIK 226

Query: 267 ------GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
                  + PS+    +G Y P+SRP+  YV ++   +   + ++V F
Sbjct: 227 VDDAAPAVEPSVENARTGKYQPLSRPIFIYVNKKAAETRPEVAKFVEF 274


>gi|315426896|dbj|BAJ48516.1| phosphate ABC transporter substrate-binding protein [Candidatus
           Caldiarchaeum subterraneum]
          Length = 347

 Score = 82.8 bits (203), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 77/298 (25%), Positives = 133/298 (44%), Gaps = 57/298 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I + GSST++P ++  AE F     +  T  V   G+  G K F  G      DI ++SR
Sbjct: 52  IEVDGSSTVYPLTEAAAEQFMNIH-KGVTISVGISGTGGGFKRFVIG----ETDINDASR 106

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIVDDK 146
            I + E +   K+GV  I EV +  D +++V       V  +T+ +L            +
Sbjct: 107 PILRAEAETAAKNGVEWI-EVPVAIDALVVVVHPSNNWVDCITISEL------------R 153

Query: 147 VVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            ++ P   +K WS+IRP++P   I +Y P    GT                         
Sbjct: 154 AIWRPDSTVKLWSDIRPEWPNQPIKLYGPGPDSGT------------------------- 188

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           F Y  +++     + R D +A E D      +A +E ++   G+ G S++  N D +K++
Sbjct: 189 FDYFTERVVGKSKASRTDYVASEDD---NVLVAGVESDRLSLGYFGFSYFAENKDRIKVL 245

Query: 264 PI-------DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
            +       + + PS  T  +  YP++RPL  YV ++ +++   LRE+V + V +  M
Sbjct: 246 KVKDDLAGGECVEPSDETARTFTYPLARPLFIYVNKKSWDTKPHLREFVIYYVENGAM 303


>gi|156740607|ref|YP_001430736.1| phosphate binding protein [Roseiflexus castenholzii DSM 13941]
 gi|156231935|gb|ABU56718.1| phosphate binding protein [Roseiflexus castenholzii DSM 13941]
          Length = 669

 Score = 82.8 bits (203), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 130/292 (44%), Gaps = 40/292 (13%)

Query: 27  RIRIAGSSTLFPYSKIIAENFS-EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
            I  AGSST+FP ++ +AE F  E +    T  ++S G+  G + FC+       DI N+
Sbjct: 94  NIVTAGSSTVFPLTQRMAERFKDEGYAGNIT--IDSIGTGAGFERFCKA---GETDISNA 148

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR I   E++ C+  G   + E  +G D + +V +      +  V+ L KA  +      
Sbjct: 149 SRPIRPAEVENCRAIGREPV-EFRVGTDALAVVVN----PANTFVDTLTKAQLA------ 197

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +     K W ++ PD+P   I ++ P    GT +   + V+         F K      
Sbjct: 198 DIFSGKAKTWKDVNPDWPANPIKLFSPGSDSGTFDFFVEVVMDPA------FEKKGKEAI 251

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
            N   + ++      D + ++           +E + +  G+ G +++    D LK V I
Sbjct: 252 LNAPGIQLS----ENDNVLVQ----------GVEGDPNAIGYFGYAYFIAEKDRLKAVKI 297

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSF---SVSDEMM 314
           +G+ P+  T  SG YP++RPL  Y   +       + ++++F    V+DE++
Sbjct: 298 EGVEPNDQTAESGTYPLARPLFIYSDAKIMKEKPQVADFINFYLTYVNDEVL 349



 Score = 82.8 bits (203), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 130/292 (44%), Gaps = 40/292 (13%)

Query: 27  RIRIAGSSTLFPYSKIIAENFS-EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
            I  AGSST+FP ++ +AE F  E +    T  ++S G+  G + FC+       DI N+
Sbjct: 389 NIVTAGSSTVFPLTQRMAERFKDEGYAGNIT--IDSIGTGAGFERFCKA---GETDISNA 443

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR I   E++ C+  G   + E  +G D + +V +      +  V+ L KA  +      
Sbjct: 444 SRPIRPAEVENCRAIGREPV-EFRVGTDALAVVVN----PANTFVDTLTKAQLA------ 492

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +     K W ++ PD+P   I ++ P    GT +   + V+         F K      
Sbjct: 493 DIFSGKAKTWKDVNPDWPANPIKLFSPGSDSGTFDFFVEVVMDPA------FEKKGKEAI 546

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
            N   + ++      D + ++           +E + +  G+ G +++    D LK V I
Sbjct: 547 LNAPGIQLS----ENDNVLVQ----------GVEGDPNAIGYFGYAYFIAEKDRLKAVKI 592

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSF---SVSDEMM 314
           +G+ P+  T  SG YP++RPL  Y   +       + ++++F    V+DE++
Sbjct: 593 EGVEPNDQTAESGTYPLARPLFIYSDAKIMKEKPQVADFINFYLTYVNDEVL 644


>gi|327475166|gb|AEA77178.1| PstS [Exiguobacterium sp. EPVM]
          Length = 312

 Score = 82.4 bits (202), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 80/316 (25%), Positives = 137/316 (43%), Gaps = 47/316 (14%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           ++ + GSST+FP  + +AE +S   P+ +     SG      K F  G      D  N+S
Sbjct: 41  KVVMDGSSTVFPIMEAVAEEYSAEQPDVEVTVGVSGTGGG-FKRFVTG----ETDFSNAS 95

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           R+I + E  E +K+GV   Q + +  DG+ L+V+  +  +  +T+++L K     +  D 
Sbjct: 96  REIKEEEAAEAEKNGVEYTQ-IAVALDGLSLVVNPENDWAQDITIDELNK-----MWTDS 149

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            V     K W ++R D+P+  I+ + P    GT +   + VL++                
Sbjct: 150 NV-----KTWKDVRSDWPDEEISFFSPGKDSGTYDFFNEAVLED---------------- 188

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                     T +R+D    E D      +A     K   GF G ++Y  N D L+ + +
Sbjct: 189 ----------TDIREDAQLSEDDNVLVTGVAGT---KGAVGFFGFAYYIENKDTLRAMSV 235

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGL 325
           +GI P+  TI    YP+SR +  YV          + +Y  F +++   A   ++   G+
Sbjct: 236 EGIEPTTDTINDLSYPLSREIYTYVNNASLKDKPQVADYTRF-LNENAAALSEEVGYVGM 294

Query: 326 IPISNEERKSVRDSIA 341
                +E   V D IA
Sbjct: 295 EQSRYDENAEVIDEIA 310


>gi|33469603|gb|AAQ19844.1| phosphate-binding protein [Alcaligenes faecalis]
          Length = 330

 Score = 82.4 bits (202), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 123/271 (45%), Gaps = 45/271 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + I GSST+FP S+ +AE F           V   G+  G K+FCRG     +DI  +SR
Sbjct: 30  VLIDGSSTVFPISEAVAEEFQNAQKGKTRVTVGVSGTGGGFKKFCRG----ELDITGASR 85

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            I + E++ CK++GV  I+   +      +++ ++  +  L+V +L K         +  
Sbjct: 86  PIKKEEMELCKQNGVEFIEMPIVIDALATIINPQNNWAECLSVAELKKMW-------EPE 138

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
               +  W++I   FP+  + ++      GT                         + Y 
Sbjct: 139 AQGKITNWNQINSKFPDAPLVLFGAGTDSGT-------------------------YDYY 173

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-- 265
              +     S R D  A E D    + +AR   +K+  GF+GL++Y +N D +K V I  
Sbjct: 174 TFAIVGKEHSSRGDFTATEDDNVSVQGVAR---DKNAIGFLGLAYYDHNKDKIKPVAIRQ 230

Query: 266 -DG--IVPSMGTIVSGLY-PISRPLLFYVKR 292
            DG  ++PS+ T V G Y P++RP+ +YV +
Sbjct: 231 ADGSCVLPSVETAVDGTYQPLTRPIFYYVDK 261


>gi|239945780|ref|ZP_04697717.1| phosphate binding protein [Streptomyces roseosporus NRRL 15998]
          Length = 305

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 138/326 (42%), Gaps = 64/326 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +++ GSST+ P S + A+ F +  P  K     SG      ++FC G      DI N+SR
Sbjct: 27  VKVDGSSTVAPLSTVAAQLFQQANPGVKVTVGTSGTGGG-FEKFCAG----ETDISNASR 81

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDD 145
           +I   E   C+K GV   +E ++ +DG+ +V   D D V   LTVE L K          
Sbjct: 82  EIKDEEKALCEKAGVK-FEEFSVANDGLSVVVSKDNDFVEC-LTVEQLKK---------- 129

Query: 146 KVVFNPLKK---WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL-QEGCVRSRNFSKMR 201
             ++ P  K   W+++ P FP  ++ ++      GT +     +  +EG  R+       
Sbjct: 130 --IWEPGSKVNNWNQVDPKFPNQKMELFGAGTDSGTFDYFTDAINGEEGASRT------- 180

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
               YN  +                   D   T+  +  +K   G+ GLS+++ N D LK
Sbjct: 181 ---DYNPSE-------------------DDNVTVRGVSGSKGGIGYFGLSYFEENKDKLK 218

Query: 262 LVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            + IDG    + P + T+ +G Y P+ R L  Y K            +V + V +     
Sbjct: 219 ALKIDGGGGCVAPGIETVQNGTYTPLGRQLFIYPKASSLEKPE-AEAFVEYYVENSAEIA 277

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAV 342
           +   F    +P++ E++K +   +A 
Sbjct: 278 EKAQF----VPLNAEQQKELEKDLAT 299


>gi|239992251|ref|ZP_04712915.1| phosphate binding protein [Streptomyces roseosporus NRRL 11379]
          Length = 304

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 138/326 (42%), Gaps = 64/326 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +++ GSST+ P S + A+ F +  P  K     SG      ++FC G      DI N+SR
Sbjct: 26  VKVDGSSTVAPLSTVAAQLFQQANPGVKVTVGTSGTGGG-FEKFCAG----ETDISNASR 80

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDD 145
           +I   E   C+K GV   +E ++ +DG+ +V   D D V   LTVE L K          
Sbjct: 81  EIKDEEKALCEKAGVK-FEEFSVANDGLSVVVSKDNDFVEC-LTVEQLKK---------- 128

Query: 146 KVVFNPLKK---WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV-LQEGCVRSRNFSKMR 201
             ++ P  K   W+++ P FP  ++ ++      GT +     +  +EG  R+       
Sbjct: 129 --IWEPGSKVNNWNQVDPKFPNQKMELFGAGTDSGTFDYFTDAINGEEGASRT------- 179

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
               YN  +                   D   T+  +  +K   G+ GLS+++ N D LK
Sbjct: 180 ---DYNPSE-------------------DDNVTVRGVSGSKGGIGYFGLSYFEENKDKLK 217

Query: 262 LVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            + IDG    + P + T+ +G Y P+ R L  Y K            +V + V +     
Sbjct: 218 ALKIDGGGGCVAPGIETVQNGTYTPLGRQLFIYPKASSLEKPE-AEAFVEYYVENSAEIA 276

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAV 342
           +   F    +P++ E++K +   +A 
Sbjct: 277 EKAQF----VPLNAEQQKELEKDLAT 298


>gi|291449238|ref|ZP_06588628.1| phosphate binding protein [Streptomyces roseosporus NRRL 15998]
 gi|291352185|gb|EFE79089.1| phosphate binding protein [Streptomyces roseosporus NRRL 15998]
          Length = 318

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/326 (25%), Positives = 138/326 (42%), Gaps = 64/326 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +++ GSST+ P S + A+ F +  P  K     SG      ++FC G      DI N+SR
Sbjct: 40  VKVDGSSTVAPLSTVAAQLFQQANPGVKVTVGTSGTGGG-FEKFCAG----ETDISNASR 94

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDD 145
           +I   E   C+K GV   +E ++ +DG+ +V   D D V   LTVE L K          
Sbjct: 95  EIKDEEKALCEKAGVK-FEEFSVANDGLSVVVSKDNDFVEC-LTVEQLKK---------- 142

Query: 146 KVVFNPLKK---WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL-QEGCVRSRNFSKMR 201
             ++ P  K   W+++ P FP  ++ ++      GT +     +  +EG  R+       
Sbjct: 143 --IWEPGSKVNNWNQVDPKFPNQKMELFGAGTDSGTFDYFTDAINGEEGASRT------- 193

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
               YN  +                   D   T+  +  +K   G+ GLS+++ N D LK
Sbjct: 194 ---DYNPSE-------------------DDNVTVRGVSGSKGGIGYFGLSYFEENKDKLK 231

Query: 262 LVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            + IDG    + P + T+ +G Y P+ R L  Y K            +V + V +     
Sbjct: 232 ALKIDGGGGCVAPGIETVQNGTYTPLGRQLFIYPKASSLEKPE-AEAFVEYYVENSAEIA 290

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAV 342
           +   F    +P++ E++K +   +A 
Sbjct: 291 EKAQF----VPLNAEQQKELEKDLAT 312


>gi|158333396|ref|YP_001514568.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Acaryochloris marina MBIC11017]
 gi|158303637|gb|ABW25254.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Acaryochloris marina MBIC11017]
          Length = 330

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 89/352 (25%), Positives = 148/352 (42%), Gaps = 65/352 (18%)

Query: 6   VVLMCFVVLEVYCGTGTFARNR-IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           V L   V    +  T   A+ + I+I GSST+FP S+ +AE F +         V   G+
Sbjct: 13  VSLAVAVSTTAFSATSADAQTKKIKIDGSSTVFPISEAVAEEFQKLTNNKVNVTVGVSGT 72

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K+FC G      DI ++SR I + E   C   GV  I E+ +  D + +V ++   
Sbjct: 73  GGGFKKFCAG----ETDISDASRPIKEKEQKLC--EGVEYI-EIPVAFDALTVVVNKGNP 125

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
             S+TV +L K  +           NP   +  W E+   +P  +I+ Y P    GT + 
Sbjct: 126 IKSMTVAELKKMWSE----------NPEGSVTTWKEVNSSWPADKISFYAPGSDSGTFDY 175

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
                   G +  +N                      R+D  A E D    + ++R    
Sbjct: 176 F------NGTIAKKNH---------------------RKDITASEDDNILVQGVSR---E 205

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
            +  G+ G ++Y+ N D L  V ID     ++PS   + +G Y P+SRP+  YV ++   
Sbjct: 206 PNGIGYFGFAYYEQNKDRLNAVAIDNGNGPVLPSREAVENGTYTPLSRPIFIYVNKKAAK 265

Query: 297 SVLGLREYVSFSV--SDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
               +R++V++ +  + E  A      + G IP+     +    +   GK+G
Sbjct: 266 RPE-VRQFVNYYLRKAAEFSA------EVGYIPLPAPAYQQAAKNFREGKTG 310


>gi|196248927|ref|ZP_03147627.1| phosphate binding protein [Geobacillus sp. G11MC16]
 gi|196211803|gb|EDY06562.1| phosphate binding protein [Geobacillus sp. G11MC16]
          Length = 320

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 86/320 (26%), Positives = 139/320 (43%), Gaps = 63/320 (19%)

Query: 7   VLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFSEYFPE 53
           VL   +V    CG G  A                + + GSST++P ++  AE +    P 
Sbjct: 12  VLSGMMVFVAACGGGNKAGGNDAEGESASELSGEVIMDGSSTVYPIAEAAAEEYMAEQPN 71

Query: 54  FKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHD 113
            K   V   G+  G ++F +G      D  N+SR I + E      + + + QE  + +D
Sbjct: 72  VKVS-VGMSGTGGGFEKFSKG----ESDFSNASRPIKEEEKQAAAANDI-EFQEFQLAYD 125

Query: 114 GILLVSDRDMVSVS-LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVP 172
           G+ ++ +++   V  LTV++L K        D KV     KKWS+IR  +P+  I  + P
Sbjct: 126 GLSVIVNKENDWVDYLTVDELKKMWTE----DGKV-----KKWSDIRSGWPDEEIQFFSP 176

Query: 173 SGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYT 232
               GT +  ++ +L+            ++M K    QLS        D I +       
Sbjct: 177 GHDSGTYDYFDEVILE-----------GKEMVK--TAQLS------EDDNILVR------ 211

Query: 233 ETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLL 287
                +E ++   G+ G ++Y  N D LK+VPID     I P+  TI +G Y P+SRPL 
Sbjct: 212 ----GVEGDRYAIGYFGYAYYLENKDKLKIVPIDAGNGPIEPTNETIETGKYTPLSRPLF 267

Query: 288 FYVKRQHFNSVLGLREYVSF 307
            YV  +       + +Y+ F
Sbjct: 268 TYVNVKSLKEKPQVYDYMEF 287


>gi|159030987|emb|CAO88689.1| sphX [Microcystis aeruginosa PCC 7806]
          Length = 344

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 77/309 (24%), Positives = 134/309 (43%), Gaps = 49/309 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES----GGSSVGLKEFCRGIGDDTIDIV 83
           I+I GSST+ P +  + E+F    P      V+      G+  G ++FC G      DI 
Sbjct: 39  IKIDGSSTVAPITDKVLEDFKANPPHKALADVKVDANISGTGGGFRKFCAG----ETDIN 94

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I+  EL +C  + +  I E+ I  D + +V +      +  V+D+  +      +
Sbjct: 95  NASRPISVEELKKCDANKIRFI-ELPIAFDALTVVVN----PQNNWVDDI--STTELRTI 147

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            +    N +K+W++I P +P+  I ++ P    GT +   +       +  ++ S+    
Sbjct: 148 WEPAAENKIKRWNQINPAWPDRPITLHGPGKDSGTYDFFSE------VINGKDASRGDFN 201

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           F  + Q L     +V QD  A+                    G+ G ++Y+ N D LK +
Sbjct: 202 FSEDDQAL---VNAVSQDPNAL--------------------GYFGHAYYEQNRDKLKAL 238

Query: 264 PIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
            ++GI P+   +    Y P+SRPL  YV  Q       L ++V + +       DS    
Sbjct: 239 KVNGIEPTRSNVEDSKYQPLSRPLFIYVNAQKAQENPALEKFVKYYLDRVPNLLDS---- 294

Query: 323 YGLIPISNE 331
            G IP+ +E
Sbjct: 295 IGYIPLPDE 303


>gi|237736376|ref|ZP_04566857.1| phosphate ABC transporter [Fusobacterium mortiferum ATCC 9817]
 gi|229421418|gb|EEO36465.1| phosphate ABC transporter [Fusobacterium mortiferum ATCC 9817]
          Length = 281

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 80/336 (23%), Positives = 148/336 (44%), Gaps = 64/336 (19%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           M  F   L+  +V+     +   A  R   I+  GS T+   S+ IAEN+ +   + +  
Sbjct: 1   MNIFKKGLLGMLVVAGLLVSANTAEARSKVIQAKGSDTILNVSQSIAENYMKENRKARIA 60

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            V  GGS VG+     G    T DI  +SR I   E+++ K  G+ +++EV +G DGI +
Sbjct: 61  -VTGGGSGVGISALING----TTDIAMASRSIKSKEIEQAKAKGL-EVKEVVLGFDGITI 114

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDD----KVVFNPLKKWSEIRPDFPEVRIAIYVPS 173
           +++      + TV+D          +DD    KV    +  W E+  D  +  I +    
Sbjct: 115 IANH-----ANTVKD----------IDDITLGKVFRGEITNWKELGGD--DAPIVVLSRD 157

Query: 174 GKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACT-SVRQDGIAIEVDGDYT 232
              GT E  ++ +++E   +       +D+ +Y  + L +    +++Q+           
Sbjct: 158 SSSGTHEFFKEHIIRENNTK-------KDL-EYGPKTLYMPSNEAIKQE----------- 198

Query: 233 ETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKR 292
                ++ NK   G++G+ +  N+ + +K   +DGI  S+  + S  YPI+R + +YV  
Sbjct: 199 -----VKSNKYAIGYIGMGYMDNSVEAIK---VDGIEASVENVASKKYPIAREVYWYVDN 250

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPI 328
                V  L +Y   S   E++  +      G +P+
Sbjct: 251 NASEDVSNLVDYALSSKGQELVKEE------GFVPV 280


>gi|268317381|ref|YP_003291100.1| phosphate binding protein [Rhodothermus marinus DSM 4252]
 gi|262334915|gb|ACY48712.1| phosphate binding protein [Rhodothermus marinus DSM 4252]
          Length = 338

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/344 (24%), Positives = 149/344 (43%), Gaps = 75/344 (21%)

Query: 9   MCFVVLEVYCGTGTFARNR----IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           +  V++   CG G     +    ++I GSST++P ++ +AE F + +P  +   V   G+
Sbjct: 4   VLLVLMVAGCGRGQQQEGQLTGSVQIDGSSTVYPLTEAVAEEFMKQYPGVRV-TVGISGT 62

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD--RD 122
             G  +F R       DI ++SR I   E    +++GV  I E+ + +DGI +V +   D
Sbjct: 63  GGGFSKFVR----KETDINDASRPIRPVEDSLARQNGVEYI-ELPVAYDGIAVVVNPQND 117

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            V   LTVE+L +            ++ P   + +W+++R  FP   + +Y      GT 
Sbjct: 118 WVEC-LTVEELRR------------IWEPNSTITRWNQVRSSFPNRPLNLYGAGTDSGTY 164

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE-VDGDYTETLARI 238
           +     ++ E      +F+   D                  D + ++ + GD        
Sbjct: 165 DYFTAAIVGEEHASRSDFTASED------------------DNVLVQGISGD-------- 198

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDG---------IVPSMGTIVSGLY-PISRPLLF 288
               +  GF+ L++Y+ N D LK V ID          I PS  T+ +G Y P++RP+  
Sbjct: 199 ---PNALGFIPLAYYEENMDKLKAVAIDDGNPDNGEGCIHPSPETVNNGTYQPLARPIFI 255

Query: 289 YVKRQHFNSVLGLREYVSFSVSDEM-MAPDSQLFQYGLIPISNE 331
           YV  +  N    +  ++ F +     +AP     + G +P++ E
Sbjct: 256 YVNAERANDP-AVEAFIEFYLQHAAKLAP-----EVGYVPLTAE 293


>gi|87124691|ref|ZP_01080539.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. RS9917]
 gi|86167570|gb|EAQ68829.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. RS9917]
          Length = 305

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 72/274 (26%), Positives = 120/274 (43%), Gaps = 53/274 (19%)

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV--SD 120
           G++ G++EFC G     I I N+SR I  +EL  C  +GV+ I E+ +  D + +V  SD
Sbjct: 29  GTTGGIREFCAG----KIPIANASRPINSSELATCADNGVTFI-ELPLAFDALSVVVNSD 83

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            D    S++ ++L +          K     +  W +I  D+P+  + + VP    GT  
Sbjct: 84  NDWAK-SISTKELARTWG-------KQAEGKVTTWRDINLDWPDRPLKLCVPGTDSGT-- 133

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
                                  + Y  + ++   T  R D  + E D    E +A    
Sbjct: 134 -----------------------YDYFNEAINGNKTDARSDVQSSEDDNVLVECVAS--- 167

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDG-----IVPSMGTIVSGLY-PISRPLLFYVKRQH 294
           N D   + G ++Y+ N   LK + I G     + PS+ T+  G Y P+SRPL  YV  Q 
Sbjct: 168 NPDAMAYFGFAYYQANRQKLKALSIIGTEGESVPPSVETVQDGTYKPLSRPLFIYVNDQQ 227

Query: 295 FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPI 328
             +   +R +V +++S+ +   D    + G IP+
Sbjct: 228 MRNNNEIRRFVEYTLSNGLRFVD----EAGYIPL 257


>gi|118594575|ref|ZP_01551922.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Methylophilales bacterium HTCC2181]
 gi|118440353|gb|EAV46980.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Methylophilales bacterium HTCC2181]
          Length = 334

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/347 (23%), Positives = 151/347 (43%), Gaps = 71/347 (20%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG--------GSSVG 67
            +  + T A + I+I GSST++P ++ +AE F           + +G        G+  G
Sbjct: 20  AFSNSATAAVDIIKIDGSSTVYPITEAVAEEFQ----------IATGIKVTVGVSGTGGG 69

Query: 68  LKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR-DMVSV 126
            K+FCRG   DT+ I  +SR I   E  +C + G+  I EV + +D + +V ++ +  + 
Sbjct: 70  FKKFCRG---DTV-ISGASRPIKAKERKKCAEAGIEFI-EVPVAYDALTVVINKSNDWAK 124

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
            +T E++ K         +      +  WS++R  +P+  + +Y P    GT        
Sbjct: 125 EMTPEEVKKMW-------EPAAQGKIMSWSQVRAGWPDTPLKLYGPGADSGT-------- 169

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
                            F Y  + +     ++R D  A E D    + +A    +K   G
Sbjct: 170 -----------------FDYFTESIIKKSKAIRGDFTASEDDNVLVQGVAG---DKGGIG 209

Query: 247 FVGLSFYKNNADVLKLVPIDG-----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLG 300
           + GL+++  N + L  V I       ++PS+ T ++G Y P++RPL  Y+          
Sbjct: 210 YFGLAYFAENKNKLDAVAIKNAAGKFVLPSLETTMNGSYNPLARPLFIYLNATKAAFDPN 269

Query: 301 LREYVSFSVSDEMMAPDSQLFQ-YGLIPISNEERKSVRDSIAVGKSG 346
           +++++     D  +    Q+ Q  G IP S +E K++ D     K+G
Sbjct: 270 VKKFI-----DYYLKYAGQMAQEVGYIPFSKDEYKAIEDHYKGLKTG 311


>gi|172055282|ref|YP_001806609.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
 gi|171701563|gb|ACB54543.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
          Length = 350

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 86/350 (24%), Positives = 145/350 (41%), Gaps = 77/350 (22%)

Query: 4   FFVVLMCFVVLEVYCGTG-TFARNRIRIAGSSTLFPYSKIIAENFSEYFPE-------FK 55
           F  +L+  V+    C    T     IRI GSST++P ++ I ++      E        K
Sbjct: 14  FIQLLLTAVLFLPACSRPITEESEPIRIDGSSTVYPITEAILKSIQSQQSEKIAKGIKIK 73

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
             F  +GG   G  +FC G      DI  +SR I+  E++ C ++ V  I E+ I  D +
Sbjct: 74  ADFSGTGG---GFGKFCSG----ETDINGASRPISAVEMENCNRNQVRYI-ELPIAFDAV 125

Query: 116 LLV--SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP-----LKKWSEIRPDFPEVRIA 168
            +   S  D V  S+T+ +L            K ++ P     +  W ++R  +P   ++
Sbjct: 126 TVAVNSGNDWVQ-SMTIAEL------------KQIWEPSAQAQINNWQQVRASWPSRALS 172

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           +Y P    GT                         F Y  + +     S R D +  E D
Sbjct: 173 LYGPGKDSGT-------------------------FDYFTEAIVGQAGSSRTDYVYSEDD 207

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PIS 283
                 +A+   + +  G+ G ++Y+ NA+ LK V ID     + P+  T+ +G Y P++
Sbjct: 208 EVLVNGIAQ---DPNALGYFGYAYYEQNANKLKAVAIDSGSDPVAPTRETVENGSYRPLT 264

Query: 284 RPLLFYVKRQHFNSVLGLREYVSFSVSD--EMMAPDSQLFQYGLIPISNE 331
           RPL  YV  +       L  +V F + +  E+++      + G IP+  E
Sbjct: 265 RPLFIYVNAKRAQENRALETFVEFYLDNAKELVS------EVGYIPLPEE 308


>gi|239637078|ref|ZP_04678072.1| phosphate-binding protein PstS [Staphylococcus warneri L37603]
 gi|239597428|gb|EEQ79931.1| phosphate-binding protein PstS [Staphylococcus warneri L37603]
          Length = 326

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/296 (22%), Positives = 120/296 (40%), Gaps = 52/296 (17%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           +++  GSST+ P  + + E F++ +P        SG      ++F  G      D  N+S
Sbjct: 38  KVKGDGSSTVGPIIEKLNEKFAKDYPNATVSSGTSGTGGG-FEKFISG----ETDFSNAS 92

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R I   E  + +  G+   +E  I  DG+ +  ++D   V    +D  K + S       
Sbjct: 93  RPIKDEEKKKLEDKGIK-YKEYKIAQDGVTVTVNKDNDFVKSLSKDQLKEIYS------- 144

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K W ++   +P+ +I  + P   HGT +   ++V+ +G +++            
Sbjct: 145 ---GKAKTWKDVNSKWPDKKIKAFSPDQSHGTFDFFTEEVMDKGDIKA------------ 189

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI- 265
                              E + D    +  +E NK+  G+ G +FY+ N D LK V I 
Sbjct: 190 -------------------EKNADTNVIVQSVEKNKEGIGYFGYNFYQQNKDKLKEVKIK 230

Query: 266 ----DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
                   P+  TI    Y +SRPL  Y K +        +E++ F++ D+  A +
Sbjct: 231 DDKGKDTEPTKKTIQDNSYALSRPLFIYAKEKSLKDNKAFQEFMKFTLEDKGKAAE 286


>gi|148658246|ref|YP_001278451.1| phosphate binding protein [Roseiflexus sp. RS-1]
 gi|148570356|gb|ABQ92501.1| phosphate binding protein [Roseiflexus sp. RS-1]
          Length = 666

 Score = 80.9 bits (198), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 128/293 (43%), Gaps = 42/293 (14%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSE--YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
            I  AGSST+FP ++ +AE F +  Y        ++S G+  G + FC+       DI N
Sbjct: 386 NIVTAGSSTVFPLTQRMAERFKDEGYTGNIT---IDSIGTGAGFERFCKA---GETDISN 439

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I   E++ C+  G   + E  +G D + +V +      +  V+ L KA  +     
Sbjct: 440 ASRPIKAAEVENCRAIGREPV-EFRVGTDALAVVVN----PANTFVDSLTKAQLA----- 489

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
             +     K W ++ PD+P   I ++ P    GT +   + V+         F K     
Sbjct: 490 -DIFSGKAKTWKDVNPDWPANPIKLFSPGTDSGTFDFFVEVVMDPA------FEKKGKEA 542

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             N   + ++      D + ++           +E + +  G+ G +++    D LK V 
Sbjct: 543 ILNAPGIQLS----ENDNVLVQ----------GVEGDPNAIGYFGYAYFIAEKDRLKAVK 588

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFS---VSDEMM 314
           ++G+ P+  T  SG YP++RPL  Y   +       +  +++F    V+DE++
Sbjct: 589 VEGVEPNDQTAESGQYPLARPLFIYSDAKIMKEKPQVAAFINFYLTFVNDEVL 641



 Score = 80.5 bits (197), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/293 (23%), Positives = 128/293 (43%), Gaps = 42/293 (14%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSE--YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
            I  AGSST+FP ++ +AE F +  Y        ++S G+  G + FC+       DI N
Sbjct: 91  NIVTAGSSTVFPLTQRMAERFKDEGYTGNIT---IDSIGTGAGFERFCKA---GETDISN 144

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I   E++ C+  G   + E  +G D + +V +      +  V+ L KA  +     
Sbjct: 145 ASRPIKAAEVENCRAIGREPV-EFRVGTDALAVVVN----PANTFVDSLTKAQLA----- 194

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
             +     K W ++ PD+P   I ++ P    GT +   + V+         F K     
Sbjct: 195 -DIFSGKAKTWKDVNPDWPANPIKLFSPGSDSGTFDFFVEVVMDPA------FEKKGKEA 247

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             N   + ++      D + ++           +E + +  G+ G +++    D LK V 
Sbjct: 248 ILNAPGIQLS----ENDNVLVQ----------GVEGDPNAIGYFGYAYFVPEKDRLKAVK 293

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFS---VSDEMM 314
           ++G+ P+  T  +G YP++RPL  Y   +       +  +++F    V+DE++
Sbjct: 294 VEGVEPTEKTAETGEYPLARPLFIYSDAKIMKEKPQVAAFINFYLTFVNDEVL 346


>gi|139437190|ref|ZP_01771350.1| Hypothetical protein COLAER_00329 [Collinsella aerofaciens ATCC
           25986]
 gi|133776837|gb|EBA40657.1| Hypothetical protein COLAER_00329 [Collinsella aerofaciens ATCC
           25986]
          Length = 278

 Score = 80.5 bits (197), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 86/339 (25%), Positives = 145/339 (42%), Gaps = 66/339 (19%)

Query: 1   MRFFFVVLMCFVVLEVYCG-TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           MR    VL   V+    C  +   + + I +AGS+T  P ++I AE F E   E     +
Sbjct: 1   MRKIVSVLSAAVLTLTLCACSSGSSTSSITVAGSTTCLPIAEIAAEGFKE---ETGIDVL 57

Query: 60  ESG-GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
            SG GSS G++    G    T DI +SSR +  +E D         +  + I HDGI ++
Sbjct: 58  VSGLGSSAGIEAVSAG----TADIASSSRGLNADEQD-------LGLTPIVIAHDGIAVI 106

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
            + D    +L+ E L    A             +  W E+  +  ++RI +       GT
Sbjct: 107 VNDDNPVDNLSTEQLRDIYA-----------GKITNWKEVGGE--DLRIQVINRDEASGT 153

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
           RE     V+              D   ++ +   ++ T            G   + ++R 
Sbjct: 154 REAFRTIVM--------------DGTPFDRRSAVLSGT------------GQVRDVVSR- 186

Query: 239 EVNKDVFGFVGLSFYK--NNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFN 296
             ++   G++ L F +  N    +K V ++ +  S  T+ SG YPISR L F+VK     
Sbjct: 187 --SRGAIGYISLGFVESLNAKTSVKAVSVNHVEASEKTVASGGYPISRDLYFFVKGVPSQ 244

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKS 335
                ++Y+ +  S++M   D Q+ + G IP++N+E+ S
Sbjct: 245 QA---QDYIDYVTSEKM---DKQIREAGFIPVTNDEKGS 277


>gi|163845864|ref|YP_001633908.1| phosphate binding protein [Chloroflexus aurantiacus J-10-fl]
 gi|222523576|ref|YP_002568046.1| phosphate binding protein [Chloroflexus sp. Y-400-fl]
 gi|163667153|gb|ABY33519.1| phosphate binding protein [Chloroflexus aurantiacus J-10-fl]
 gi|222447455|gb|ACM51721.1| phosphate binding protein [Chloroflexus sp. Y-400-fl]
          Length = 682

 Score = 80.1 bits (196), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 79/311 (25%), Positives = 134/311 (43%), Gaps = 51/311 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST++P +   AE FS   P  +   V   G+  G K+FC G      DI N+SR
Sbjct: 61  IIIDGSSTVYPPTAAAAEEFSRLAPNVRVS-VGISGTGGGFKKFCNG----ETDISNASR 115

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I + E   C ++G+  I E+ + +DG+ ++V+ ++     LTV +L K       + + 
Sbjct: 116 PIREEEQAICAQNGIEFI-ELPVAYDGLSVVVNPQNDWVTCLTVAELKK-------IWEP 167

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W+++R  FP   + +       GT +   + ++ E      ++    D    
Sbjct: 168 AAQGVITNWNQVREGFPNRPLVLLGAGTDSGTFDYFTEAIVGEAKASRGDYQATED---- 223

Query: 207 NVQQLSVACTSVRQDGIAIE-VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                         D + I  V GD            +  G++G ++   N   +K + I
Sbjct: 224 --------------DNVTITGVSGDL-----------NAMGYLGYAYVVENQGKIKPIAI 258

Query: 266 DG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           D     + PS  TI    Y P+SRPL  YV ++       ++ +V+F +S E   P  Q 
Sbjct: 259 DNGNGCVEPSFETIADASYQPLSRPLFIYVNKEAAERPE-VQAFVNFYLSPEFT-PIIQT 316

Query: 321 FQYGLIPISNE 331
            Q G + +S+E
Sbjct: 317 PQVGYVKLSDE 327



 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/311 (24%), Positives = 135/311 (43%), Gaps = 51/311 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST++P +   AE FS      +   V   G+  G K+FC G      DI N+SR
Sbjct: 382 IIIDGSSTVYPPTAAAAEEFSRLASNVRVS-VGISGTGGGFKKFCNG----ETDISNASR 436

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
            I + E   C ++G+  I E+ + +DG+ ++V+ ++  +  LTV +L K       + + 
Sbjct: 437 PIREEEQAICAQNGIEFI-ELPVAYDGLSVVVNPQNDWATCLTVAELKK-------IWEP 488

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W+++R  FP+  + +       GT +   + ++ E      ++    D    
Sbjct: 489 AAQGVITNWNQVREGFPDRPLVLLGAGTDSGTFDYFTEAIVGEAKASRGDYQATED---- 544

Query: 207 NVQQLSVACTSVRQDGIAIE-VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                         D + I  V GD            +  G++G ++   N   +K + +
Sbjct: 545 --------------DNVTITGVSGDL-----------NAMGYLGYAYVVENQGKIKPIAV 579

Query: 266 DG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           D     + PS  TI    Y P+SRPL  YV ++       ++ +V+F +S E   P  Q 
Sbjct: 580 DNGNGCVEPSFETIADATYQPLSRPLFIYVNKEAAERPE-VQAFVNFYLSPEFT-PIIQT 637

Query: 321 FQYGLIPISNE 331
            Q G + +S+E
Sbjct: 638 PQVGYVKLSDE 648


>gi|330684714|gb|EGG96412.1| phosphate binding protein [Staphylococcus epidermidis VCU121]
          Length = 326

 Score = 80.1 bits (196), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/291 (22%), Positives = 118/291 (40%), Gaps = 52/291 (17%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           +++  GSST+ P  + + E F++ +P        SG      ++F  G      D  N+S
Sbjct: 38  KVKGDGSSTVGPIIEKLNEKFAKDYPNATVSSGTSGTGGG-FEKFISG----ETDFSNAS 92

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R I   E  + +  G+   +E  I  DG+ +  ++D   V    +D  K + S       
Sbjct: 93  RPIKDEEKKKLEDKGIK-YKEYKIAQDGVTVTVNKDNDFVKSLSKDQLKEIYS------- 144

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K W ++   +P+ +I  + P   HGT +   ++V+ +G +++            
Sbjct: 145 ---GKAKTWKDVNSKWPDKKIKAFSPDQSHGTFDFFTEEVMDKGDIKA------------ 189

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI- 265
                              E + D    +  +E NK+  G+ G +FY+ N D LK V I 
Sbjct: 190 -------------------EKNADTNVIVQSVEKNKEGIGYFGYNFYQQNKDKLKEVKIK 230

Query: 266 ----DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
                   P+  TI    Y +SRPL  Y K +        +E++ F++ D+
Sbjct: 231 DDKGKDTEPTKKTIQDNSYALSRPLFIYAKEKSLKENKAFQEFMKFTLEDK 281


>gi|119714459|ref|YP_921424.1| phosphate binding protein [Nocardioides sp. JS614]
 gi|119535120|gb|ABL79737.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Nocardioides sp. JS614]
          Length = 312

 Score = 80.1 bits (196), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 69/290 (23%), Positives = 122/290 (42%), Gaps = 54/290 (18%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           + GSST++P S+   +  S  +P+     V + G+  G  +FC G       I N+SR I
Sbjct: 39  VDGSSTVYPMSEAAYQLMSGEYPDIHVS-VTASGTGGGFAKFCVG----ETHISNASRPI 93

Query: 90  TQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVF 149
             +E   C+++GV+   E+ +G D + +V    +    LT + L +            ++
Sbjct: 94  DPDETKLCEENGVA-YTELQVGIDALTVVVHPRLGVDCLTTDQLVE------------LW 140

Query: 150 NP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
            P   + +W+++ P FP+ ++ ++ P    GT + L   +         ++    D    
Sbjct: 141 RPGADVARWNDLDPSFPDQKVVLFGPGTDSGTYDYLADVIGDPSEATRDDYESSEDD--- 197

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
           NV    VA T                             G+ G ++Y+  AD LK V ID
Sbjct: 198 NVLVQGVAGT-------------------------PGATGYFGYTYYEEYADALKAVAID 232

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
                + PS  T  +G Y P+SRPL  YV  + +     ++ Y  F +++
Sbjct: 233 DGNGCVAPSARTAGTGKYTPLSRPLFIYVNDRSYAENTAVKRYTDFYIAN 282


>gi|257093341|ref|YP_003166982.1| phosphate-binding protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257045865|gb|ACV35053.1| phosphate binding protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 291

 Score = 79.7 bits (195), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 124/302 (41%), Gaps = 48/302 (15%)

Query: 9   MCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGL 68
           +  + +     TG  AR  I+  GS TL   ++ +AE + +  P+     V  GGS  G+
Sbjct: 10  LAVLTIGAVAATGASARTEIQNKGSDTLVNAAQSLAEQYGKINPKVAVA-VSGGGSGTGI 68

Query: 69  KEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSL 128
                G    T+DI NSSRK+++ E+ E +  G   ++ + IG+D + +  ++   + S+
Sbjct: 69  AAMING----TVDIANSSRKMSEKEIKEAQAKGRQPVEHI-IGYDALAIFVNKKFPADSI 123

Query: 129 TVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKH--GTREVLEKKV 186
           TV DL K                  KWS++    P  +  I V S ++  GT    ++ V
Sbjct: 124 TVTDLAKIYGR---------DGGASKWSDLGITIPGCKGEIVVVSRQNNSGTYAYFKEAV 174

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           L E           +  F              RQ  + +    D  +    +E      G
Sbjct: 175 LGE-----------KGKF--------------RQGTLDMHGSKDVADL---VEKTPCAIG 206

Query: 247 FVGLSFYKNNADVLKLVPIDG---IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
           + GL++  ++   L + P  G   + P+  T   G YPISRPL  Y   +    V    +
Sbjct: 207 YSGLAYVTDHMKALCVAPSAGKPCVKPTEQTAFDGTYPISRPLFMYTNGEPTGEVKKYMD 266

Query: 304 YV 305
           ++
Sbjct: 267 WI 268


>gi|229916295|ref|YP_002884941.1| phosphate binding protein [Exiguobacterium sp. AT1b]
 gi|229467724|gb|ACQ69496.1| phosphate binding protein [Exiguobacterium sp. AT1b]
          Length = 312

 Score = 79.3 bits (194), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 74/281 (26%), Positives = 125/281 (44%), Gaps = 50/281 (17%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           ++ + GSST+FP  + +AE +S   PE +     SG      K F  G      D  N+S
Sbjct: 41  KVVMDGSSTVFPIMEAVAEEYSAEQPEVEVTVGVSGTGGG-FKRFVTG----ETDFSNAS 95

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           R+I + E  E +K+GV +  ++++  DG+ L+V+  +  +  +T+E+L K      I   
Sbjct: 96  REIKEEEAAEAEKNGV-EFTQLSVALDGLSLVVNPANDWAQDITIEELNKMWTDTSI--- 151

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  K W ++R D+P+  I+ + P    GT +   + VL +                
Sbjct: 152 -------KTWKDVRSDWPDEEISFFAPGKDSGTFDFFNEAVLDD---------------- 188

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                     T +R+D    E D      +A  E      GF G ++Y  N D L+ + +
Sbjct: 189 ----------TDIREDAQLSEDDNVLVTGVAGTE---GAIGFFGYAYYIENQDTLRAMAV 235

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
           +G+ P+  TI    YP+SR +  YV     N+ L  +E V+
Sbjct: 236 EGVEPTPETINDLSYPLSREIYTYVN----NASLKDKEQVA 272


>gi|229086841|ref|ZP_04219003.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-44]
 gi|228696485|gb|EEL49308.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-44]
          Length = 260

 Score = 79.3 bits (194), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 65/267 (24%), Positives = 117/267 (43%), Gaps = 46/267 (17%)

Query: 43  IAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV 102
           IAE +++  P  K   +   G+  G   F +G     +DI N+SRK+ Q E +  +++ +
Sbjct: 4   IAEEYTKKDPRVKIS-ISISGTGGGFHRFGKG----EVDINNASRKVKQVEEEFMRENSI 58

Query: 103 SDIQEVTIGHDGILLVSDR-DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPD 161
                  I +DG+ ++ +R +  + ++T+E+L       L+  +       K+WS I P 
Sbjct: 59  -QFTPFEIAYDGLTIIVNRQNTWADNMTIEELR------LLWSEN---GKTKRWSHIHPG 108

Query: 162 FPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQD 221
           +P  ++  Y P    GT +  +  VLQ   +                        S+ +D
Sbjct: 109 WPHEKVQFYAPGVDSGTYDYFQSVVLQNNRL--------------------AKTVSLSED 148

Query: 222 GIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY- 280
              I         +  +  +K+   FVG ++Y  N   +K + ++G+ P+  TI SG Y 
Sbjct: 149 DQVI---------MQGVMNDKNAIAFVGYAYYMANQHKVKAIKVNGVRPTKETIQSGAYQ 199

Query: 281 PISRPLLFYVKRQHFNSVLGLREYVSF 307
           P+SR L  YV      +   + EYV+F
Sbjct: 200 PLSRSLFAYVNHDSIRNNSSVAEYVTF 226


>gi|219667307|ref|YP_002457742.1| phosphate binding protein [Desulfitobacterium hafniense DCB-2]
 gi|219537567|gb|ACL19306.1| phosphate binding protein [Desulfitobacterium hafniense DCB-2]
          Length = 340

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 70/301 (23%), Positives = 133/301 (44%), Gaps = 48/301 (15%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           +  + I GS T++P    IAE++        +  V   GSS G K+F  G      D  +
Sbjct: 50  KGNVVIDGSGTVYPLMAHIAEDYMTNSQSGVSVQVGRAGSSAGFKKFIPG----ETDFAD 105

Query: 85  SSRKITQNELDECKKHGV---SDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKALASY 140
           +SR I  +E++E K  G+   +++ E+ + +DG+ +V +++   +  +T +++ K   S 
Sbjct: 106 ASRAIKDSEVEELKGKGLEMGANVMEIKLAYDGLTIVINKNNDWAKEMTDDEIVKMFTSK 165

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
            +  D  V      WS+IR ++P+  I  Y P+  HGT E   + +L +           
Sbjct: 166 AVKGDDNVL-----WSDIRAEWPQEEIKFYGPNENHGTYEFFYETILDK----------- 209

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
           +D+         V+  +++Q         +Y+  +  +  +K+   F G  +Y  N D L
Sbjct: 210 KDL---------VSSVNLQQ---------EYSTLVDLVAQDKNAIAFFGYGYYATNTDKL 251

Query: 261 KLVPID----GIVPSMGTIVSGL--YPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
             V +D     + P++ TI   L     +R +  Y+   +      + ++  F VS E  
Sbjct: 252 TAVKVDFGKGPVEPALNTIGEDLDYAGFTRLVYTYLNLNYAKEKPQVLDFAQFVVSPEGA 311

Query: 315 A 315
           A
Sbjct: 312 A 312


>gi|328955364|ref|YP_004372697.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Coriobacterium glomerans PW2]
 gi|328455688|gb|AEB06882.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Coriobacterium glomerans PW2]
          Length = 281

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 84/324 (25%), Positives = 143/324 (44%), Gaps = 67/324 (20%)

Query: 9   MCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG-GSSVG 67
           +C V L   C     + + + ++GS+T  P ++I AENF +      T  + SG GSS G
Sbjct: 12  ICAVAL-TGCSAAQVSEH-VTVSGSTTCLPIAEIAAENFKQ---RTSTDVLVSGLGSSAG 66

Query: 68  LKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS 127
           ++    G    T DI  SSR +  +E    +  G++ I    I HDGI ++ +       
Sbjct: 67  IEAVSNG----TADIATSSRDLNDDE----RSLGLTPIP---IAHDGIAIIVNTSNPVNR 115

Query: 128 LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL 187
           +T E L +  A  +             WSE+  D  +  I +       GTRE     V+
Sbjct: 116 VTTEQLRRIYAGQI-----------TNWSELGGD--DEPIQLVNRDEASGTREAFNTLVM 162

Query: 188 QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGF 247
           ++                ++ +   +  T            G   + ++R   +K   G+
Sbjct: 163 KK--------------VPFDRRAAVLPGT------------GQVRDVVSR---SKGAIGY 193

Query: 248 VGLSFYKNN-ADV-LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           + + F K++ AD  +K + +DGI  +  T+ SG+YPISR L F+VK     +    R Y+
Sbjct: 194 ISMGFVKSSFADTEVKTLDVDGIKATEETVTSGVYPISRDLYFFVKGTPSEAA---RRYI 250

Query: 306 SFSVSDEMMAPDSQLFQYGLIPIS 329
            + +SD+M   D+ + + G IP+S
Sbjct: 251 DYMLSDQM---DAMIREAGFIPMS 271


>gi|149182009|ref|ZP_01860495.1| phosphate ABC transporter (phosphate-binding protein) [Bacillus sp.
           SG-1]
 gi|148850274|gb|EDL64438.1| phosphate ABC transporter (phosphate-binding protein) [Bacillus sp.
           SG-1]
          Length = 308

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/312 (23%), Positives = 134/312 (42%), Gaps = 54/312 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEF-CRGIGDDTIDIVNSS 86
           + + GS T++P+   +AEN+     E     V   G+S G K+F   G G    D  N+S
Sbjct: 30  VVVDGSGTVYPFMAQMAENYMTENEEVSVE-VSRAGTSAGFKKFLVEGGG---TDFNNAS 85

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R I + E  +  + G+ D+ E  +  DG+  V + +         D    +    +V+  
Sbjct: 86  RHIKEEEQAQADEFGI-DVMEFQVALDGLTFVINPE--------NDWAAEMTQEEVVNIF 136

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           +    + KWS+I P++P+  I    P+  HGT E + + +++E     ++F         
Sbjct: 137 LAEGGVTKWSDINPEWPDEEIKPMGPNENHGTNEFMFESIMEE-----KDFVD-----SV 186

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
           N+QQ                   +Y+  +  +  +K+   F G  +Y+NN D L  V +D
Sbjct: 187 NLQQ-------------------EYSTLVDLVSKDKNAIAFFGYGYYENNKDKLGAVAVD 227

Query: 267 ----GIVPSMGTIVSG---LYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
                + P++ TI  G     P +RP+  Y+          + +Y  F +++   A D  
Sbjct: 228 FGNGPVEPNLETIGLGDAPYAPFTRPVYTYLNANMAKEKAQVLDYAKFIMNN---AQDVA 284

Query: 320 LFQYGLIPISNE 331
             + G  P+S+E
Sbjct: 285 A-ETGFAPLSDE 295


>gi|111075044|gb|ABH04890.1| ABC-type phosphate transporter phosphate-binding protein pstS
           [Heliobacillus mobilis]
          Length = 299

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 121/293 (41%), Gaps = 57/293 (19%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           +  I++ GS T+   S+ +AE + E   +     V  GGS  G+K    G    T D+ N
Sbjct: 45  KGSIQVKGSDTIVNLSQKMAETYMEKNKDANIA-VTGGGSGTGIKALING----TTDLAN 99

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR++   E  E K+    D +E+ I  DGI  + +++     LT++ L           
Sbjct: 100 ASREMKDEEKQELKEKTGKDTKEIVIARDGIGFIVNKNNPVKELTMDQL----------- 148

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
             +    +  W E+    P+ +I +Y      GT   +++ V++    R+          
Sbjct: 149 SDIYTGKVSNWKEL--GGPDEKIVVYARETSSGTHVFIKEHVMKNKDYRTDAL------- 199

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
              +Q  + A                    +  +E NK   G+VGL + K+    L  V 
Sbjct: 200 ---LQSSNAAI-------------------VKEVEANKGAIGYVGLGYLKDTTKTLG-VK 236

Query: 265 IDG----IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL-REYVSFSVSDE 312
            DG    ++PS  ++    YP+SRPL  Y   +      GL + +V F +SDE
Sbjct: 237 KDGQSAAVMPSEASVKDKSYPVSRPLFVYAAGEPE----GLAKSFVDFMLSDE 285


>gi|166364580|ref|YP_001656853.1| phosphate transport system substrate-binding protein [Microcystis
           aeruginosa NIES-843]
 gi|166086953|dbj|BAG01661.1| phosphate transport system substrate-binding protein [Microcystis
           aeruginosa NIES-843]
          Length = 344

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 74/306 (24%), Positives = 129/306 (42%), Gaps = 47/306 (15%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES---- 61
           +VL   ++L             I+I GSST+ P +  + E+F    P      V+     
Sbjct: 17  IVLGTALILPACANINPQDLKPIKIDGSSTVAPITDKVLEDFKANTPNKALADVKIDANI 76

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSD 120
            G+  G ++FC G      DI N+SR I+  EL EC  + V  I E+ I  D + ++V+ 
Sbjct: 77  SGTGGGFRKFCAG----ETDINNASRPISVEELKECDANKVRFI-ELPIAFDALTVVVNP 131

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++     ++  +L         + +    N +K+W++I P + +  I ++ P    GT +
Sbjct: 132 QNNWLDDISTRELK-------TIWEPAAENKIKRWNQINPAWTDRPITLHGPGKDSGTYD 184

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
                      +  ++ S+    F  + Q L     +V QD  A+               
Sbjct: 185 FFSD------VINGKDASRGDFNFSEDDQAL---VNAVSQDPNAL--------------- 220

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVL 299
                G+ G ++Y+ N D LK + ++GI P+   +    Y P+SRPL  YV  Q      
Sbjct: 221 -----GYFGHAYYEQNRDKLKALKVNGIEPTRSNVEDSKYQPLSRPLFIYVNAQKAQENP 275

Query: 300 GLREYV 305
            L ++V
Sbjct: 276 ALEKFV 281


>gi|288553551|ref|YP_003425486.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           pseudofirmus OF4]
 gi|288544711|gb|ADC48594.1| phosphate ABC transporter (phosphate-binding protein) [Bacillus
           pseudofirmus OF4]
          Length = 331

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 120/271 (44%), Gaps = 49/271 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + + GS T++P   ++AE +        +  V   G+S G  +F    G D  D   +SR
Sbjct: 54  VVVDGSGTVYPLMSVLAEEYMINEQPNVSVEVSRSGTSAGFGKFLVPNGTDFND---ASR 110

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           +I   EL+E + +G+ ++QE  +  DG+  ++   +  +  LT E+L     S    D  
Sbjct: 111 EIKDEELEEAEANGI-EVQEFKVALDGLTFVIHPENDWAKELTEEELI----SIFSADGG 165

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           V      KWS+IRP+FP+  I    P+  HGT E   + +L +G +              
Sbjct: 166 VT-----KWSDIRPEFPDEEIKPMGPNENHGTYEFFYENILDKGDLVD----------GV 210

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
           N+QQ                   +Y+  +  +  +K+   F G  +Y NN D ++ V +D
Sbjct: 211 NLQQ-------------------EYSTLVNLVAEDKNAIAFFGFGYYVNNQDQIQAVNVD 251

Query: 267 ----GIVPSMGTIVS-GLY-PISRPLLFYVK 291
                + PS+ TI   G Y P +RP+  Y+ 
Sbjct: 252 FGEGPVEPSLDTIAEDGDYAPFTRPVFTYLN 282


>gi|218679864|ref|ZP_03527761.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
          etli CIAT 894]
          Length = 74

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 32/51 (62%), Positives = 43/51 (84%)

Query: 25 RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
          R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+
Sbjct: 24 RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGV 74


>gi|222478937|ref|YP_002565174.1| phosphate binding protein [Halorubrum lacusprofundi ATCC 49239]
 gi|222451839|gb|ACM56104.1| phosphate binding protein [Halorubrum lacusprofundi ATCC 49239]
          Length = 329

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 80/310 (25%), Positives = 133/310 (42%), Gaps = 57/310 (18%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
           G+G      I IAGSST+FP    I E+F+    +       +G        FC  +GD 
Sbjct: 39  GSGDALSGSINIAGSSTVFPLMSAIGEDFAAEHDQVSVDISSTGSGGGFSNYFC--VGD- 95

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKAL 137
             D  N+SR I   E + C+++GV  + E+    D + +V + +   + SLTVE+L +  
Sbjct: 96  -TDFNNASRPIQPAEEELCEENGVEYV-ELIAATDALTIVVNPEADWIDSLTVEELAQIW 153

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
                       +P + W E+R +FP   I  +  +   GT +   + +L+E    S   
Sbjct: 154 EE----------DPAQTWDEVRDEFPNEEIERFGAADTSGTYDYFIESILEERGHTSDYQ 203

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
           +  +D                  + IA  V G           ++   G+ G ++Y  N 
Sbjct: 204 ATEQD------------------NSIAQGVSG-----------SEYAIGYFGFAYYFQNP 234

Query: 258 DVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFY-----VKRQHFNSVLGLREYVSF 307
           D LK + ID     + PS+ T  SG Y P+SRPL  Y     + ++H       R +V  
Sbjct: 235 DQLKALGIDDGNGPVEPSLETASSGEYTPLSRPLFTYPSIESLGKEHVAEF--ARYFVEQ 292

Query: 308 SVSDEMMAPD 317
           + +++++A D
Sbjct: 293 TTNEDLVAGD 302


>gi|294495555|ref|YP_003542048.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanohalophilus mahii DSM 5219]
 gi|292666554|gb|ADE36403.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanohalophilus mahii DSM 5219]
          Length = 295

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 76/280 (27%), Positives = 127/280 (45%), Gaps = 51/280 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GS+T+FP ++  AE + E  PE K+  V SGGS+ G+K F  G     +DI  +SR
Sbjct: 48  IDIEGSTTVFPLAQAAAEIYMENHPE-KSINVVSGGSTTGIKAFIDG----DVDIAMASR 102

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
           K+  +E++E + +G+  ++ + I  DG+ +V +       LT E +            K 
Sbjct: 103 KLKDSEIEEAEANGIDPVEHI-IAWDGLTVVVNPANPVNQLTYEQI------------KG 149

Query: 148 VFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           ++N  +  W+ +  +  E+ I    PS   GT    + ++L E   R    S  RD    
Sbjct: 150 IYNGSISNWANVGGEDEEMVIQNRDPS--SGTYGYFKDELLGEEEFRPDLVS--RDSNGA 205

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
            VQ       +V Q+  AI                    G++G ++  ++  V+ +   +
Sbjct: 206 IVQ-------AVTQEDAAI--------------------GYIGFAYLDDSVKVVDIDAGN 238

Query: 267 GIV-PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           G+V P+   I+ G YP++RPL FY   Q         EY+
Sbjct: 239 GMVAPTSENILPGEYPLARPLHFYTDGQPTGFAANFIEYI 278


>gi|317129723|ref|YP_004096005.1| phosphate binding protein [Bacillus cellulosilyticus DSM 2522]
 gi|315474671|gb|ADU31274.1| phosphate binding protein [Bacillus cellulosilyticus DSM 2522]
          Length = 339

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 74/275 (26%), Positives = 122/275 (44%), Gaps = 62/275 (22%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPF---VESGGSSVGLKEFCRGIGDDTIDIVN 84
           + I GS T++P    IA+   EY    +T     V  GG+S G++++  G      D  N
Sbjct: 58  VSIDGSGTVYPLMARIAD---EYMTSVETGVSVEVGRGGTSAGMQKYVVG----ETDFSN 110

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIV 143
           +SR I + EL E   +G+ + +E+ +  DG+ ++++  +  +  +T E++     +    
Sbjct: 111 ASRPIKEEELSELDANGI-ESKELKVALDGLTIVINPENDWATEMTEEEISTMFVTGQYK 169

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE-----VLEKKVLQEGCVRSRNFS 198
           DD VV      WS+IR ++PE  I  Y P+  HGT E     ++EK+ L  G    + +S
Sbjct: 170 DDDVVL-----WSDIRSEWPEEEINFYGPNENHGTYEFFVDVIIEKQDLVAGINLQQEYS 224

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
            +            V+  S   +GIA                      F G  +Y NN D
Sbjct: 225 TL------------VSLVSDDVNGIA----------------------FFGYGYYANNDD 250

Query: 259 VLKLVPID----GIVPSMGTIVS-GLY-PISRPLL 287
            +  V +D     + PS+ TI   G Y P +RP+ 
Sbjct: 251 KITAVKVDFGNGPVGPSIDTIAEDGDYAPFTRPVF 285


>gi|302872905|ref|YP_003841541.1| phosphate binding protein [Caldicellulosiruptor obsidiansis OB47]
 gi|302575764|gb|ADL43555.1| phosphate binding protein [Caldicellulosiruptor obsidiansis OB47]
          Length = 381

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 73/289 (25%), Positives = 123/289 (42%), Gaps = 55/289 (19%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           RI IAGS+++ P +  +A  F + +P+     V+ GGSSVG+K   +GI    +DI  SS
Sbjct: 138 RIMIAGSTSVQPLADELARYFMQIYPKVSIE-VQGGGSSVGIKSAIQGI----VDIGTSS 192

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R++T+   DE K+      QEV I  DGI ++  +     +LT++ +    +        
Sbjct: 193 RELTE---DESKQLSSKGWQEVKIAEDGIAVIVHKSNPVSNLTIDQIRDIFS-------- 241

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +K W E+     + +I +       GTR   E+ V+ +                 
Sbjct: 242 ---GKIKNWKEVGGK--DAKIVVVTREEGSGTRGAFEEIVMGK----------------- 279

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                    T +    I     G    T+++ E   +  GF+ +    N    +K + +D
Sbjct: 280 --------STKITDSAIVQPSTGAVKTTVSQDE---NAIGFISIGVLDN---TVKGIKVD 325

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           G+ P+   +  G Y I RP LF + +   N     + +V F +SDE  A
Sbjct: 326 GVEPTEKNVKLGKYKIKRPFLFLLSK---NPSKVTKAFVDFVLSDEGQA 371


>gi|222530696|ref|YP_002574578.1| phosphate binding protein [Caldicellulosiruptor bescii DSM 6725]
 gi|222457543|gb|ACM61805.1| phosphate binding protein [Caldicellulosiruptor bescii DSM 6725]
          Length = 381

 Score = 77.0 bits (188), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 81/299 (27%), Positives = 132/299 (44%), Gaps = 62/299 (20%)

Query: 22  TFARN---RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
           TF+ N   RI IAGS+++ P +  +A+ F + +P+     V+ GGSSVG+K   +GI   
Sbjct: 130 TFSTNLSGRIMIAGSTSVQPLADELAKYFMQQYPKVSIE-VQGGGSSVGIKSAIQGI--- 185

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
            +DI  SSR++T+   DE K+      QE+ I  DGI ++  +     +L++E +    +
Sbjct: 186 -VDIGTSSRELTE---DESKQLSAKGWQEIKIAEDGIAVIVHKSNPVSNLSIEQIRDIFS 241

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                        +K W E+     + +I +       GTR   E+ V+ +        S
Sbjct: 242 -----------GKIKNWKEVGGK--DAKIVVVTREEGSGTRGAFEEIVMGKS-------S 281

Query: 199 KMRDMFKYNVQQLSVAC--TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
           K+ D     + Q S     T+V QD  AI                    G++ +    + 
Sbjct: 282 KITDS---AIVQPSTGAVKTTVSQDENAI--------------------GYISIGVLDST 318

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
              +K V ++G+ PS   +  G Y I RP LF V +   N     + +V F +SDE  A
Sbjct: 319 ---VKGVKVEGVEPSEKNVKLGKYKIKRPFLFLVSK---NPSKVTKAFVDFVLSDEGQA 371


>gi|167630151|ref|YP_001680650.1| phosphate abc transporter, phosphate-binding protein pstd
           [Heliobacterium modesticaldum Ice1]
 gi|167592891|gb|ABZ84639.1| phosphate abc transporter, phosphate-binding protein pstd
           [Heliobacterium modesticaldum Ice1]
          Length = 300

 Score = 76.6 bits (187), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 113/268 (42%), Gaps = 50/268 (18%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           +  I++ GS T+   S+ +AE F +   +     V  GGS  G+K    G    T D+ N
Sbjct: 46  KGSIQVKGSDTIVNLSQAMAEEFMKKNKDASIA-VTGGGSGTGIKALVNG----TADLAN 100

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR +   E +E K+    D++E  I +DGI  + ++D     LT+E L           
Sbjct: 101 SSRDMKAEEKNEIKEKTQKDVKEFVIANDGIGFIVNKDNPVKELTMEQLA---------- 150

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
             +    +  W E+  +  + +I +Y      GT   +++ V++    RS          
Sbjct: 151 -DIYTGKVSNWKELGGN--DEKIVVYARETSSGTHVFVKEHVMKNKEYRSDAL------- 200

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
              +Q  S A        I  EV+G           NK   G+VGL + K++   + +  
Sbjct: 201 ---LQSSSAA--------IVKEVEG-----------NKGAIGYVGLGYLKDSVKTIAVKK 238

Query: 265 IDG---IVPSMGTIVSGLYPISRPLLFY 289
             G   ++PS  ++    YP+SRPL  Y
Sbjct: 239 DAGSAAVLPSEASVKDKSYPVSRPLFVY 266


>gi|76803413|ref|YP_327682.1| ABC transporter periplasmic phosphate-binding protein [Natronomonas
           pharaonis DSM 2160]
 gi|76559228|emb|CAI50832.1| ABC-type transport system periplasmic phosphate-binding protein
           (probable substrate phosphate) 2 [Natronomonas pharaonis
           DSM 2160]
          Length = 337

 Score = 76.6 bits (187), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 69/273 (25%), Positives = 122/273 (44%), Gaps = 55/273 (20%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I  +GS+T+ P +    ENFS  FP+     V+  G+  G +EFCR       D+ ++SR
Sbjct: 42  IDASGSNTVAPITSWAGENFSNEFPDVLVD-VDPQGTGAGFQEFCR----QNSDVQSASR 96

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIVDD 145
            IT  E+D C ++ V+    + +G DG+ +V  S+ D V  ++T+++L +          
Sbjct: 97  LITDEEVDLCNENDVN-YDHLEVGLDGLAVVKNSENDWVD-NITLDELQQVWE------- 147

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
               + ++ WS+IR ++P+  IA++      GT +   + +  E          +RD + 
Sbjct: 148 --FQSDVETWSDIRSEWPDREIALHARDSASGTFDYFTRAINGE-------IGNIRDDYS 198

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD--VLKLV 263
              Q                       E +  +  N D FG+ G+ + +   D   ++ V
Sbjct: 199 ATSQT---------------------NEIMGAVADNIDGFGWGGVGYLRAIEDDQPIEAV 237

Query: 264 P-----IDG-IVPSMGTIVSGLY-PISRPLLFY 289
           P     +DG  +P    + SG Y P++RPL  Y
Sbjct: 238 PVESDSVDGFFLPQRENVESGDYSPLARPLFAY 270


>gi|147919155|ref|YP_687112.1| high-affinity phosphate ABC-type import system, periplasmic
           component [uncultured methanogenic archaeon RC-I]
 gi|110622508|emb|CAJ37786.1| high-affinity phosphate ABC-type import system, periplasmic
           component [uncultured methanogenic archaeon RC-I]
          Length = 280

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 72/288 (25%), Positives = 123/288 (42%), Gaps = 61/288 (21%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
            R++I GS+++ PY+  +A++FS  +P      V  GGS  G+K       D T  I  S
Sbjct: 40  GRVKIIGSTSVQPYATELADSFSVKYPGADA-LVSGGGSGAGIKAAQ----DGTAQIGMS 94

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR++T+ E         S ++ + IG+DGI++V +      SLT + +    A       
Sbjct: 95  SRELTEEEK-------ASGLRAIVIGYDGIIVVVNPANPLSSLTRQQIKDIFAGR----- 142

Query: 146 KVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                 +  W ++   D P   + +       GTR   ++ V+ E  +  R         
Sbjct: 143 ------VTNWKDVGGSDAP---VTVVTRESGSGTRAAFQEIVMGETNLTDR--------- 184

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                    A T     GI   V GD           ++  G++    Y +  D +K++ 
Sbjct: 185 ---------AVTLGSTGGITQTVSGD-----------RNAIGYI---SYGSLDDSVKVLA 221

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           +DG+ PS   I  G YPI RP LF  K +  + V   + ++ +++S+E
Sbjct: 222 VDGVAPSADAIKDGTYPIRRPFLFVTKGEPTDPV--TKAFIEYTLSEE 267


>gi|254432347|ref|ZP_05046050.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Cyanobium sp. PCC 7001]
 gi|197626800|gb|EDY39359.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Cyanobium sp. PCC 7001]
          Length = 305

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 57/258 (22%), Positives = 116/258 (44%), Gaps = 47/258 (18%)

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDR 121
           G+S GL+ FC G     + I N+SR I+  EL  C   G++ I E+ +  D + + V+  
Sbjct: 29  GTSAGLRAFCSG----EVPIANASRPISSEELQVCADAGITFI-ELPLAFDALTVAVNPG 83

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           +  + +++ E+L +  +       +     +K+W++I   +P+  + +  P    GT   
Sbjct: 84  NSWATAISTEELQRTWS-------RSAQGRVKRWNQINGAWPDNPLRLCAPGADSGT--- 133

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
                                 F Y  + ++    + R D   +E   D T  +A +  +
Sbjct: 134 ----------------------FDYFNEAINGGKANARTD---VESSEDDTVLVACVASD 168

Query: 242 KDVFGFVGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
            +   + G ++Y  NA+ ++ +PI     + + PS+  +  GLY P++RPL  YV  +  
Sbjct: 169 PNAMAYFGFAYYTANAERIRALPIAAPGAEPVPPSVSAVQKGLYKPLARPLFIYVNDRQM 228

Query: 296 NSVLGLREYVSFSVSDEM 313
            +   +R +V ++V + +
Sbjct: 229 LADDEIRSFVGYTVGNGL 246


>gi|312623579|ref|YP_004025192.1| phosphate binding protein [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312204046|gb|ADQ47373.1| phosphate binding protein [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 381

 Score = 76.3 bits (186), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 79/291 (27%), Positives = 128/291 (43%), Gaps = 59/291 (20%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           RI IAGS+++ P +  +A+ F + +P+     V+ GGSSVG+K   +GI    +DI  SS
Sbjct: 138 RIMIAGSTSVQPLADELAKYFMQQYPKVSIE-VQGGGSSVGIKSAIQGI----VDIGTSS 192

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R++T+   DE K+      QE+ I  DGI ++  +     +LT+E +    +        
Sbjct: 193 RELTE---DESKQLSAKGWQEIKIAEDGIAVIVHKSNPVSNLTIEQIRDIFS-------- 241

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +K W E+     + +I +       GTR   E+ V+ +        SK+ D    
Sbjct: 242 ---GKIKNWKEVGGK--DAKIVVVTREEGSGTRGAFEEIVMGKS-------SKITD---S 286

Query: 207 NVQQLSVAC--TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
            + Q S     T+V QD  AI                    G++ +    +    +K V 
Sbjct: 287 AIVQPSTGAVKTTVLQDENAI--------------------GYISIGVLDST---VKGVK 323

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           ++G+ PS   +  G Y I RP LF V +   N     + +V F +SDE  A
Sbjct: 324 VEGVEPSEKNVKLGKYKIKRPFLFLVSK---NPSKVTKAFVDFVLSDEGQA 371


>gi|312136499|ref|YP_004003836.1| phosphate abc transporter substrate-binding protein, phot family
           [Methanothermus fervidus DSM 2088]
 gi|311224218|gb|ADP77074.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanothermus fervidus DSM 2088]
          Length = 283

 Score = 75.9 bits (185), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 73/299 (24%), Positives = 140/299 (46%), Gaps = 62/299 (20%)

Query: 17  YCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIG 76
           +  TG   ++RI+IAGS+++ P ++ +A+ +++  P  K   V+ GGSSVG+ +  +G  
Sbjct: 20  FLATGQ-KKSRIQIAGSTSVQPVAEKLAQAYTKKHPNVKI-NVQGGGSSVGITQAKQG-- 75

Query: 77  DDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKA 136
             TIDI  SS+ +  +E     + G+S      IG DGI ++ +++       + DL K+
Sbjct: 76  --TIDIGTSSKDLKPDE-----RQGLS---VYLIGRDGIAIIVNKNN-----PINDLSKS 120

Query: 137 LASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
                I D  +    ++ W E+    P+ +I +       GTR+  E+ V++   +R   
Sbjct: 121 Q----IRD--IFSGKIRNWKEV--GGPDAKINVITREAGSGTRKSFEEVVMKNEKIRGDA 172

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
                         +  +  +V+Q                 ++ + +  G++ L+    +
Sbjct: 173 I-------------VQSSTEAVKQ----------------AVKNDPNAIGYISLAHLDES 203

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
              +K + +DG+ PS  T+  G YPI+RP L  VK +  + V   ++++ F +S E  A
Sbjct: 204 ---VKGISVDGVPPSEKTVADGSYPIARPFLMLVKGEPKDIV---KDFLKFVLSPEGQA 256


>gi|283470603|emb|CAQ49814.1| phosphate-binding protein PstS (PBP) [Staphylococcus aureus subsp.
           aureus ST398]
          Length = 371

 Score = 75.9 bits (185), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 116/291 (39%), Gaps = 52/291 (17%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E +++   + K    ++G +  G ++F  G     ID  ++SR I  
Sbjct: 41  GSSTVAPIVEKLNEKWAQDHSDAKISAGQAG-TGAGFQKFIAG----DIDFADASRPIKD 95

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
            E  + +   +   +E  I  DG+ +  +++   V    +   KA+ S            
Sbjct: 96  EEKQKLQNKNIK-YKEFKIAQDGVTVAVNKENDFVDELDKQQLKAIYS----------GK 144

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
            K W ++   +P+ +I    P+  HGT +  E +V+                        
Sbjct: 145 AKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM------------------------ 180

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----D 266
                   ++ I  E + D    ++ +  NK+  G+ G +FY  N D LK V I      
Sbjct: 181 -------NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGK 233

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
              P+  TI    Y +SRPL  YV  +       + E++ F + D+  A +
Sbjct: 234 ATEPTKKTIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAE 284


>gi|312136215|ref|YP_004003553.1| phosphate binding protein [Caldicellulosiruptor owensensis OL]
 gi|311776266|gb|ADQ05753.1| phosphate binding protein [Caldicellulosiruptor owensensis OL]
          Length = 380

 Score = 75.9 bits (185), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 79/290 (27%), Positives = 125/290 (43%), Gaps = 58/290 (20%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           RI IAGS+++ P +  +A+ F + +P+     V+ GGSSVG+K   +GI    +DI  SS
Sbjct: 138 RIMIAGSTSVQPLADELAKYFMQQYPKVSIE-VQGGGSSVGIKSAIQGI----VDIGTSS 192

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R++T+   DE K+      QEV I  DGI ++  +     +LT+E +    +        
Sbjct: 193 RELTE---DESKQLSSKGWQEVKIAEDGIAVIVHKSNPVSNLTIEQIRDIFS-------- 241

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +K W E+     + +I +       GTR   E+ V+ +  +              
Sbjct: 242 ---GKIKNWKEVGGK--DAKIIVVTREEGSGTRGAFEEIVMGKAKITDSAI--------- 287

Query: 207 NVQQLSVAC-TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
            VQ  + A  T+V QD  AI                    GF+ +    +    +K V +
Sbjct: 288 -VQPSTGAIKTTVSQDENAI--------------------GFISIGVLDS---TVKGVKV 323

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           DGI P+   +  G Y I RP LF V     N     + ++ F +SDE  A
Sbjct: 324 DGIEPTEKNVKLGKYKIKRPFLFLVSN---NPSKVTKAFLDFVLSDEGQA 370


>gi|304381035|ref|ZP_07363689.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|304340344|gb|EFM06284.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
          Length = 327

 Score = 75.9 bits (185), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 116/291 (39%), Gaps = 52/291 (17%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E +++   + K    ++G +  G ++F  G     ID  ++SR I  
Sbjct: 41  GSSTVAPIVEKLNEKWAQDHSDAKISAGQAG-TGAGFQKFIAG----DIDFADASRPIKD 95

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
            E  + +   +   +E  I  DG+ +  +++   V    +   KA+ S            
Sbjct: 96  EEKQKLQDKNIK-YKEFKIAQDGVTVAVNKENDFVDELDKQQLKAIYS----------GK 144

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
            K W ++   +P+ +I    P+  HGT +  E +V+                        
Sbjct: 145 AKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM------------------------ 180

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----D 266
                   ++ I  E + D    ++ +  NK+  G+ G +FY  N D LK V I      
Sbjct: 181 -------NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGK 233

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
              P+  TI    Y +SRPL  YV  +       + E++ F + D+  A +
Sbjct: 234 ATAPTKKTIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAE 284


>gi|15615556|ref|NP_243860.1| phosphate ABC transporter (phosphate-binding protein) [Bacillus
           halodurans C-125]
 gi|10175616|dbj|BAB06713.1| phosphate ABC transporter (phosphate-binding protein) [Bacillus
           halodurans C-125]
          Length = 335

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 77/278 (27%), Positives = 122/278 (43%), Gaps = 57/278 (20%)

Query: 28  IRIAGSSTLFPYSKIIAENF--SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
           + + GS T++P    IAE +  SE  P      V   G+S G  +F    G D  D   +
Sbjct: 58  VVVDGSGTVYPLMAAIAEEYMISEQ-PNVSVE-VSRAGTSAGFGKFLVENGTDFND---A 112

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYLIV 143
           SR+I   E +  ++ G+ D+QE  +  DG+  V   D D  +  LT E+L    A+    
Sbjct: 113 SRQIKDEEKETAEELGI-DVQEFKVALDGLTFVIHPDNDWAT-ELTKEELISIFAA---- 166

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D  V     +KWS+IRP+FP+  I    P+  HGT E   + +++E           +D+
Sbjct: 167 DGGV-----EKWSDIRPEFPDEEINPMGPNENHGTYEFFYEVIMEE-----------QDL 210

Query: 204 F-KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
               N+QQ                   +Y+  +  +  + +   F G  +Y NN D L  
Sbjct: 211 VDNVNLQQ-------------------EYSTLVNLVSEDPNAIAFFGFGYYVNNQDQLGA 251

Query: 263 VPID----GIVPSMGTIVS-GLY-PISRPLLFYVKRQH 294
           V +D     + P++ TI   G Y P +RP+  Y+   H
Sbjct: 252 VHVDFGDGPVEPNLETIAEDGDYAPFTRPVFTYLNVNH 289


>gi|253583357|ref|ZP_04860555.1| ABC-type phosphate transporter phosphate-binding protein pstS
           [Fusobacterium varium ATCC 27725]
 gi|251833929|gb|EES62492.1| ABC-type phosphate transporter phosphate-binding protein pstS
           [Fusobacterium varium ATCC 27725]
          Length = 283

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 78/342 (22%), Positives = 145/342 (42%), Gaps = 74/342 (21%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNR-----IRIAGSSTLFPYSKIIAENFSEYFPEFK 55
           MR  F+       L V  G G   R       +++ GS T+   S+ IAE F     E K
Sbjct: 1   MRKNFLKKGLIAALIVMGGIGLGQRAEAKSGVVQVKGSDTILNASQAIAEKF---MSENK 57

Query: 56  TP--FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHD 113
                V  GGS VG+        + T DI  +SR I   E+++ K  G+ +++E+ +G D
Sbjct: 58  GARIAVTGGGSGVGISALI----NKTTDIAMASRNIKDKEIEQAKAKGI-NVEEIVVGFD 112

Query: 114 GILLVSDRDMVSVSLTVEDLYKALASYLIVDDK----VVFNPLKKWSEIRPDFPEVRIAI 169
           GI +++++     +  ++D          +DDK    V    +  W E+  D  E  I +
Sbjct: 113 GITIIANK-----TNPIKD----------IDDKTLGKVFRGEITNWKELGGDDAE--IVV 155

Query: 170 YVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACT-SVRQDGIAIEVD 228
                  GT E  ++ +++EG  +           +Y  + L +    +++Q+       
Sbjct: 156 LSRDSSSGTHEFFKEHIIREGNSKGTQ--------EYGAKTLYMPSNEAIKQE------- 200

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLF 288
                    I+ NK   G++G+ +  ++   ++ V +DG+  +   +++  YPI+R + +
Sbjct: 201 ---------IKANKYAIGYIGMGYMDSS---VEAVTVDGVAATPENVLNKTYPIAREVFW 248

Query: 289 YVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ--LFQYGLIPI 328
           Y        V   +E V ++VS     P  Q  +   G +P+
Sbjct: 249 YADSAREGVV---KELVDYAVS-----PKGQEIIKNEGFVPV 282


>gi|82750981|ref|YP_416722.1| phosphate-binding lipoprotein [Staphylococcus aureus RF122]
 gi|123549144|sp|Q2YXX9|PSTS_STAAB RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|82656512|emb|CAI80934.1| phosphate-binding lipoprotein [Staphylococcus aureus RF122]
          Length = 327

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 116/291 (39%), Gaps = 52/291 (17%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E +++   + K    ++G +  G ++F  G     ID  ++SR I  
Sbjct: 41  GSSTVAPIVEKLNEKWAQDHSDAKISAGQAG-TGAGFQKFIAG----DIDFADASRPIKD 95

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
            E  + +   +   +E  I  DG+ +  +++   V    +   KA+ S            
Sbjct: 96  EEKQKLQDKNIK-YKEFKIAQDGVTVAVNKENDFVDELDKQQLKAIYS----------GK 144

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
            K W ++   +P+ +I    P+  HGT +  E +V+                        
Sbjct: 145 AKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM------------------------ 180

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----D 266
                   ++ I  E + D    ++ +  NK+  G+ G +FY  N D LK V I      
Sbjct: 181 -------NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENCK 233

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
              P+  TI    Y +SRPL  YV  +       + E++ F + D+  A +
Sbjct: 234 ATEPTKKTIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAE 284


>gi|78187108|ref|YP_375151.1| phosphate binding protein [Chlorobium luteolum DSM 273]
 gi|78167010|gb|ABB24108.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chlorobium luteolum DSM 273]
          Length = 271

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/328 (22%), Positives = 128/328 (39%), Gaps = 70/328 (21%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ F  +LM   V  +       A  +I + GS+T+ P    IA++F+ YF         
Sbjct: 1   MKLFSKILMGAAVFGMMASGDASAAGKIVMDGSTTVGP----IAKSFAAYF-------TR 49

Query: 61  SGGSSVGLKEFCRGIG-----DDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
           + G+ V + E   G G     + T DI N SR +  NE+   K  GV+ ++ V +  DG+
Sbjct: 50  TTGTDVTVSESGSGNGAKSIINSTCDIANMSRAMKTNEIAAAKAKGVNPVEHV-VALDGM 108

Query: 116 LLV---SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVP 172
            +V   S+R        + D+Y                 +  W+++    P   I     
Sbjct: 109 AIVVNPSNRVKNLTKTQIRDIYSG--------------KITNWNQV--GGPTAEIVKIQR 152

Query: 173 SGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYT 232
               GT++  +  V+ +    S+                              E      
Sbjct: 153 ESNSGTQDTFKSLVMGKAAPISKR----------------------------AETQASNG 184

Query: 233 ETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKR 292
              +R+       GF+GL F   +   +K V ++G+ P++ ++  G YPISRPL  Y   
Sbjct: 185 AVKSRVASTPAAIGFLGLGFVDGS---VKAVSVEGVAPTVASVKDGTYPISRPLFMYTNG 241

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           Q   +V   ++++  + + E M   S+L
Sbjct: 242 QPKGAV---KQFIELNQTPEGMRMISEL 266


>gi|49483580|ref|YP_040804.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257425454|ref|ZP_05601879.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428114|ref|ZP_05604512.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430745|ref|ZP_05607127.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433505|ref|ZP_05609863.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436346|ref|ZP_05612393.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           M876]
 gi|282903970|ref|ZP_06311858.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus C160]
 gi|282905735|ref|ZP_06313590.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908706|ref|ZP_06316524.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282910970|ref|ZP_06318772.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914178|ref|ZP_06321965.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus M899]
 gi|282919100|ref|ZP_06326835.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924283|ref|ZP_06331957.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           C101]
 gi|293501205|ref|ZP_06667056.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510166|ref|ZP_06668874.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           M809]
 gi|293526758|ref|ZP_06671443.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus M1015]
 gi|295427903|ref|ZP_06820535.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297591136|ref|ZP_06949774.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus MN8]
 gi|81651164|sp|Q6GH18|PSTS_STAAR RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|49241709|emb|CAG40399.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257271911|gb|EEV04049.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274955|gb|EEV06442.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278873|gb|EEV09492.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281598|gb|EEV11735.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284628|gb|EEV14748.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313670|gb|EFB44063.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           C101]
 gi|282316910|gb|EFB47284.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           C427]
 gi|282322246|gb|EFB52570.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus M899]
 gi|282324665|gb|EFB54975.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282326970|gb|EFB57265.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331027|gb|EFB60541.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282595588|gb|EFC00552.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus C160]
 gi|290920830|gb|EFD97893.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus M1015]
 gi|291096210|gb|EFE26471.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467110|gb|EFF09628.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           M809]
 gi|295128261|gb|EFG57895.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297576022|gb|EFH94738.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus MN8]
 gi|312438210|gb|ADQ77281.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus TCH60]
 gi|315195282|gb|EFU25669.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           CGS00]
          Length = 327

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 116/291 (39%), Gaps = 52/291 (17%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E +++   + K    ++G +  G ++F  G     ID  ++SR I  
Sbjct: 41  GSSTVAPIVEKLNEKWAQDHSDAKISAGQAG-TGAGFQKFIAG----DIDFADASRPIKD 95

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
            E  + +   +   +E  I  DG+ +  +++   V    +   KA+ S            
Sbjct: 96  EEKQKLQDKNIK-YKEFKIAQDGVTVAVNKENDFVDELDKQQLKAIYS----------GK 144

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
            K W ++   +P+ +I    P+  HGT +  E +V+                        
Sbjct: 145 AKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM------------------------ 180

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----D 266
                   ++ I  E + D    ++ +  NK+  G+ G +FY  N D LK V I      
Sbjct: 181 -------NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGK 233

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
              P+  TI    Y +SRPL  YV  +       + E++ F + D+  A +
Sbjct: 234 ATEPTKKTIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAE 284


>gi|282916656|ref|ZP_06324414.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           D139]
 gi|283770461|ref|ZP_06343353.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           H19]
 gi|282319143|gb|EFB49495.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           D139]
 gi|283460608|gb|EFC07698.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           H19]
          Length = 327

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 116/291 (39%), Gaps = 52/291 (17%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E +++   + K    ++G +  G ++F  G     ID  ++SR I  
Sbjct: 41  GSSTVAPIVEKLNEKWAQDHSDAKISAGQAG-TGAGFQKFIAG----DIDFADASRPIKD 95

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
            E  + +   +   +E  I  DG+ +  +++   V    +   KA+ S            
Sbjct: 96  EEKQKLQDKNIK-YKEFKIAQDGVTVAVNKENDFVDELDKQQLKAIYS----------GK 144

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
            K W ++   +P+ +I    P+  HGT +  E +V+                        
Sbjct: 145 AKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM------------------------ 180

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----D 266
                   ++ I  E + D    ++ +  NK+  G+ G +FY  N D LK V I      
Sbjct: 181 -------NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGK 233

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
              P+  TI    Y +SRPL  YV  +       + E++ F + D+  A +
Sbjct: 234 ATEPTKKTIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAE 284


>gi|15924379|ref|NP_371913.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu50]
 gi|15926969|ref|NP_374502.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus N315]
 gi|21283006|ref|NP_646094.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus MW2]
 gi|49486231|ref|YP_043452.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57651889|ref|YP_186276.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus COL]
 gi|87161503|ref|YP_493980.1| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|88195116|ref|YP_499916.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|148267877|ref|YP_001246820.1| phosphate binding protein [Staphylococcus aureus subsp. aureus JH9]
 gi|150393941|ref|YP_001316616.1| phosphate binding protein [Staphylococcus aureus subsp. aureus JH1]
 gi|151221512|ref|YP_001332334.1| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus str. Newman]
 gi|156979708|ref|YP_001441967.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu3]
 gi|161509556|ref|YP_001575215.1| phosphate ABC transporter ATP-binding protein [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|221140586|ref|ZP_03565079.1| phosphate ABC transporter ATP-binding protein [Staphylococcus
           aureus subsp. aureus str. JKD6009]
 gi|253317017|ref|ZP_04840230.1| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus str. CF-Marseille]
 gi|253732024|ref|ZP_04866189.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|255006178|ref|ZP_05144779.2| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus Mu50-omega]
 gi|257795556|ref|ZP_05644535.1| thioredoxine reductase [Staphylococcus aureus A9781]
 gi|258413364|ref|ZP_05681640.1| thioredoxine reductase [Staphylococcus aureus A9763]
 gi|258420529|ref|ZP_05683471.1| thioredoxine reductase [Staphylococcus aureus A9719]
 gi|258423653|ref|ZP_05686541.1| thioredoxine reductase [Staphylococcus aureus A9635]
 gi|258434699|ref|ZP_05688773.1| phosphate-binding protein pstS [Staphylococcus aureus A9299]
 gi|258444725|ref|ZP_05693054.1| thioredoxine reductase [Staphylococcus aureus A8115]
 gi|258447440|ref|ZP_05695584.1| thioredoxine reductase [Staphylococcus aureus A6300]
 gi|258449281|ref|ZP_05697384.1| thioredoxine reductase [Staphylococcus aureus A6224]
 gi|258451786|ref|ZP_05699810.1| thioredoxine reductase [Staphylococcus aureus A5948]
 gi|258454661|ref|ZP_05702625.1| thioredoxine reductase [Staphylococcus aureus A5937]
 gi|262049858|ref|ZP_06022721.1| thioredoxine reductase [Staphylococcus aureus D30]
 gi|269203011|ref|YP_003282280.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus ED98]
 gi|282892881|ref|ZP_06301116.1| phosphate-binding protein pstS [Staphylococcus aureus A8117]
 gi|282926211|ref|ZP_06333845.1| phosphate-binding protein pstS [Staphylococcus aureus A9765]
 gi|282928949|ref|ZP_06336538.1| phosphate-binding protein pstS [Staphylococcus aureus A10102]
 gi|284024390|ref|ZP_06378788.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus 132]
 gi|294848395|ref|ZP_06789142.1| phosphate-binding protein pstS [Staphylococcus aureus A9754]
 gi|295406335|ref|ZP_06816142.1| phosphate-binding protein pstS [Staphylococcus aureus A8819]
 gi|296276661|ref|ZP_06859168.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus MR1]
 gi|297207957|ref|ZP_06924388.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297244564|ref|ZP_06928447.1| phosphate-binding protein pstS [Staphylococcus aureus A8796]
 gi|300912041|ref|ZP_07129484.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|81649338|sp|Q6G9H1|PSTS_STAAS RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|81694529|sp|Q5HG31|PSTS_STAAC RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|81704436|sp|Q7A0X7|PSTS_STAAW RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|81704844|sp|Q7A2S1|PSTS_STAAM RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|81705716|sp|Q7A5Q2|PSTS_STAAN RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|122539596|sp|Q2FYP6|PSTS_STAA8 RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|123485982|sp|Q2FH48|PSTS_STAA3 RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|6434037|emb|CAB60743.1| thioredoxine reductase [Staphylococcus aureus]
 gi|13701186|dbj|BAB42481.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus N315]
 gi|14247160|dbj|BAB57551.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu50]
 gi|21204445|dbj|BAB95142.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus MW2]
 gi|49244674|emb|CAG43106.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57286075|gb|AAW38169.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus COL]
 gi|87127477|gb|ABD21991.1| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|87202674|gb|ABD30484.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|147740946|gb|ABQ49244.1| phosphate binding protein [Staphylococcus aureus subsp. aureus JH9]
 gi|149946393|gb|ABR52329.1| phosphate binding protein [Staphylococcus aureus subsp. aureus JH1]
 gi|150374312|dbj|BAF67572.1| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus str. Newman]
 gi|156721843|dbj|BAF78260.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368365|gb|ABX29336.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253724265|gb|EES92994.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|257789528|gb|EEV27868.1| thioredoxine reductase [Staphylococcus aureus A9781]
 gi|257839928|gb|EEV64396.1| thioredoxine reductase [Staphylococcus aureus A9763]
 gi|257843477|gb|EEV67884.1| thioredoxine reductase [Staphylococcus aureus A9719]
 gi|257846151|gb|EEV70177.1| thioredoxine reductase [Staphylococcus aureus A9635]
 gi|257849060|gb|EEV73042.1| phosphate-binding protein pstS [Staphylococcus aureus A9299]
 gi|257850218|gb|EEV74171.1| thioredoxine reductase [Staphylococcus aureus A8115]
 gi|257853631|gb|EEV76590.1| thioredoxine reductase [Staphylococcus aureus A6300]
 gi|257857269|gb|EEV80167.1| thioredoxine reductase [Staphylococcus aureus A6224]
 gi|257860617|gb|EEV83441.1| thioredoxine reductase [Staphylococcus aureus A5948]
 gi|257863044|gb|EEV85808.1| thioredoxine reductase [Staphylococcus aureus A5937]
 gi|259162082|gb|EEW46661.1| thioredoxine reductase [Staphylococcus aureus D30]
 gi|262075301|gb|ACY11274.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus ED98]
 gi|269940885|emb|CBI49267.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282589458|gb|EFB94548.1| phosphate-binding protein pstS [Staphylococcus aureus A10102]
 gi|282592275|gb|EFB97293.1| phosphate-binding protein pstS [Staphylococcus aureus A9765]
 gi|282764878|gb|EFC05003.1| phosphate-binding protein pstS [Staphylococcus aureus A8117]
 gi|285817067|gb|ADC37554.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Staphylococcus aureus 04-02981]
 gi|294825195|gb|EFG41617.1| phosphate-binding protein pstS [Staphylococcus aureus A9754]
 gi|294968923|gb|EFG44945.1| phosphate-binding protein pstS [Staphylococcus aureus A8819]
 gi|296887200|gb|EFH26102.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297178594|gb|EFH37840.1| phosphate-binding protein pstS [Staphylococcus aureus A8796]
 gi|300886287|gb|EFK81489.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|302751219|gb|ADL65396.1| ABC-type phosphate transport system, periplasmic component
           [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|312829784|emb|CBX34626.1| phosphate binding family protein [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315131196|gb|EFT87180.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus CGS03]
 gi|315196350|gb|EFU26702.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus CGS01]
 gi|320140280|gb|EFW32138.1| phosphate binding protein [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143948|gb|EFW35720.1| phosphate binding protein [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323441174|gb|EGA98881.1| phosphate-binding lipoprotein [Staphylococcus aureus O11]
 gi|323444043|gb|EGB01654.1| phosphate-binding lipoprotein [Staphylococcus aureus O46]
 gi|329314065|gb|AEB88478.1| Phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329727527|gb|EGG63983.1| phosphate binding protein [Staphylococcus aureus subsp. aureus
           21172]
 gi|329728913|gb|EGG65331.1| phosphate binding protein [Staphylococcus aureus subsp. aureus
           21193]
          Length = 327

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 116/291 (39%), Gaps = 52/291 (17%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E +++   + K    ++G +  G ++F  G     ID  ++SR I  
Sbjct: 41  GSSTVAPIVEKLNEKWAQDHSDAKISAGQAG-TGAGFQKFIAG----DIDFADASRPIKD 95

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
            E  + +   +   +E  I  DG+ +  +++   V    +   KA+ S            
Sbjct: 96  EEKQKLQDKNIK-YKEFKIAQDGVTVAVNKENDFVDELDKQQLKAIYS----------GK 144

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
            K W ++   +P+ +I    P+  HGT +  E +V+                        
Sbjct: 145 AKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM------------------------ 180

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----D 266
                   ++ I  E + D    ++ +  NK+  G+ G +FY  N D LK V I      
Sbjct: 181 -------NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGK 233

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
              P+  TI    Y +SRPL  YV  +       + E++ F + D+  A +
Sbjct: 234 ATEPTKKTIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAE 284


>gi|257467879|ref|ZP_05631975.1| phosphate abc transporter, phosphate-binding protein pstd
           [Fusobacterium ulcerans ATCC 49185]
          Length = 283

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/338 (22%), Positives = 146/338 (43%), Gaps = 72/338 (21%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTP-- 57
           F    L+  +++    G G  A  R   +++ GS T+   S+ IAE F     E K    
Sbjct: 5   FLKKGLIAALIVMGGMGLGQKAEARSSVVQVKGSDTILNASQAIAEKF---MSENKGARI 61

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            V  GGS VG+        + T DI  +SR I   E+++ K  G+ ++ E+ +G DGI +
Sbjct: 62  AVTGGGSGVGISALI----NKTTDIAMASRNIKDKEIEQAKAKGI-NVDEIVVGFDGITI 116

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKV---VF-NPLKKWSEIRPDFPEVRIAIYVPS 173
           ++++     S  ++D          +DDK    VF   +  W E+  D  E  I +    
Sbjct: 117 IANK-----SNPIKD----------IDDKTLGKVFRGEITNWKELGGDDAE--IVVLSRD 159

Query: 174 GKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACT-SVRQDGIAIEVDGDYT 232
              GT E  ++ +++EG  +           +Y  + L +    +++Q+           
Sbjct: 160 SSSGTHEFFKEHIIREGNSKGTQ--------EYGAKTLYMPSNEAIKQE----------- 200

Query: 233 ETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKR 292
                ++ NK   G++G+ +  ++   ++ V +DG+  +   +++  YPI+R + +Y   
Sbjct: 201 -----VKANKYAVGYIGMGYMDSS---VEAVTVDGVAATPENVLNKTYPIAREVFWYADS 252

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQ--LFQYGLIPI 328
                    RE V  S+ D  ++P  Q  +   G +P+
Sbjct: 253 --------AREGVVKSLVDYAISPKGQEIIKNEGFVPV 282


>gi|145592852|ref|YP_001157149.1| phosphate binding protein [Salinispora tropica CNB-440]
 gi|145302189|gb|ABP52771.1| phosphate binding protein [Salinispora tropica CNB-440]
          Length = 315

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 120/281 (42%), Gaps = 71/281 (25%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG--------GSSVGLKEFCRGIGDD 78
            +++ GSST+ P S+  A  + E         V+SG        G+  G + FC+G    
Sbjct: 37  EVKVNGSSTVAPLSEAAATFYRE---------VQSGVNVSVGTSGTGGGFERFCKG---- 83

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
             DI ++SR I  +E++ C+  G+   +E+ + +D + +V  +D               A
Sbjct: 84  ETDISDASRPIKDSEIEACEAAGIQ-YKELIVANDALTVVVSKD------------NDWA 130

Query: 139 SYLIVDD-KVVFNP---LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
             L VD  K ++ P   +  W+++ P FP+  + ++ P    GT                
Sbjct: 131 DCLTVDQLKAIWEPNSQITSWNQVDPSFPDEPLKLFGPGTDSGT---------------- 174

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
                    F Y   +++    + R D  A E D    + +A     K   G+ G ++++
Sbjct: 175 ---------FDYFTDEINGEEGASRTDYTASENDNVVVQGVAGT---KGGLGYFGFTYFE 222

Query: 255 NNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYV 290
            NAD LK + +DG    + PS+ T     Y P+SRPL  YV
Sbjct: 223 ENADKLKALKVDGGSGCVEPSLKTAQENTYQPLSRPLFIYV 263


>gi|304314074|ref|YP_003849221.1| extracellular phosphate-binding protein [Methanothermobacter
           marburgensis str. Marburg]
 gi|302587533|gb|ADL57908.1| predicted extracellular phosphate-binding protein
           [Methanothermobacter marburgensis str. Marburg]
          Length = 271

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 77/292 (26%), Positives = 131/292 (44%), Gaps = 62/292 (21%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           + +I I GS+++ P ++ +A  + +  P  K   V+ GGSSVG+K    G    T DI  
Sbjct: 29  QEKIDIVGSTSVQPVAEKLAAEYMKKHPNVKI-NVQGGGSSVGIKSAQDG----TADIGT 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS+++  +E     K G++   E  IG DGI ++     V+   TV DL K         
Sbjct: 84  SSKELKPDE-----KKGLT---EYMIGKDGIAVI-----VNSKNTVSDLSKDQV------ 124

Query: 145 DKVVFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            K +F+  +  W E+    P+ +I +       GTR+  E+ V+ +              
Sbjct: 125 -KDIFSGKITNWKEV--GGPDAKITVITREDGSGTRKAFEEIVMGK-------------- 167

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                       T +++D I +E   +  +   + + N    GF+ L+   N  + +K +
Sbjct: 168 -----------ETKIKKDAI-VESSTEAVKQAVKQDAN--AIGFISLA---NLDETVKAL 210

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
            IDG+ PS  T+  G Y I RP LF VK     +V   ++++ + +S E  A
Sbjct: 211 KIDGVTPSEQTVADGSYKIQRPFLFLVKGSAQGAV---KDFIDWVLSPEGQA 259


>gi|159035998|ref|YP_001535251.1| phosphate binding protein [Salinispora arenicola CNS-205]
 gi|157914833|gb|ABV96260.1| phosphate binding protein [Salinispora arenicola CNS-205]
          Length = 318

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/320 (23%), Positives = 137/320 (42%), Gaps = 60/320 (18%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            +++ GSST+ P S+  A  + E   +     V + G+  G + FC+G      DI ++S
Sbjct: 40  EVKVNGSSTVAPLSEAAATFYKETQSDVNV-SVGTSGTGGGFERFCKG----ETDISDAS 94

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD- 145
           R I  +E + C   G+ + +E+ + +D + +V  +D               A  L VD  
Sbjct: 95  RPIKDSEKEACAAAGI-EYKELVVANDALTVVVSKD------------NDWADCLTVDQL 141

Query: 146 KVVFNPLKK---WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           K ++ P  K   W +I P FP+  + ++ P    GT                        
Sbjct: 142 KTIWEPDSKVTNWKQIDPTFPDEPLKLFGPGTDSGT------------------------ 177

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
            F Y   +++    + R D  A E D    + +A     K   G+ G ++++ NAD LK 
Sbjct: 178 -FDYFTDEINGEEGASRTDYTASENDNVVVQGVAGT---KGGLGYFGFTYFEENADKLKA 233

Query: 263 VPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           + +DG    + PS+ T     Y P+SRPL  YV           +E V+  V+  +   D
Sbjct: 234 LKVDGGSGCVEPSLKTAQENTYQPLSRPLFIYVSDAGVK-----KEQVADFVTFYIERID 288

Query: 318 SQLFQYGLIPISNEERKSVR 337
             + +   +P++ E++ +++
Sbjct: 289 DIVLEAQYVPLTEEQKSTLK 308


>gi|253733363|ref|ZP_04867528.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus TCH130]
 gi|253728631|gb|EES97360.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus TCH130]
          Length = 327

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 116/291 (39%), Gaps = 52/291 (17%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E +++   + K    ++G +  G ++F  G     ID  ++SR I  
Sbjct: 41  GSSTVAPIVEKLNEKWAQDHSDAKISAGQAG-TGAGFQKFIAG----DIDFADASRPIKD 95

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
            E  + +   +   +E  I  DG+ +  +++   V    +   KA+ S            
Sbjct: 96  EEKQKLQDKNIK-YKEFKIAQDGVTVAVNKENDFVDELDKQQLKAIYS----------GK 144

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
            K W ++   +P+ +I    P+  HGT +  E +V+                        
Sbjct: 145 AKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM------------------------ 180

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----D 266
                   ++ I  E + D    ++ +  NK+  G+ G +FY  N D LK V I      
Sbjct: 181 -------NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYIQNKDKLKEVKIKDENGK 233

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
              P+  TI    Y +SRPL  YV  +       + E++ F + D+  A +
Sbjct: 234 ATEPTKKTIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAE 284


>gi|87302283|ref|ZP_01085108.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. WH 5701]
 gi|87283208|gb|EAQ75164.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. WH 5701]
          Length = 345

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/317 (22%), Positives = 133/317 (41%), Gaps = 52/317 (16%)

Query: 2   RFFFVVLMCFVVLEVYCGT-----GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKT 56
           R  ++ L+  +      GT     G  ++  IRI+GSST+FP +   +  F +  P    
Sbjct: 3   RGLWICLLAALAPLPTLGTSGPALGQSSKGVIRISGSSTVFPITAEASRRFRQSPPGRDV 62

Query: 57  PF-VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
            F ++  G++ G + FC G     + I N+SR I   EL  C   G+  I E+ I  D +
Sbjct: 63  RFELKETGTTGGFRAFCSG----AVAISNASRPINSQELKACAAKGIRFI-ELPIAFDAL 117

Query: 116 LL-VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            + V+ R+  + +++  +L +       + ++     + +W+++   +P   I +  P  
Sbjct: 118 TVAVNPRNSWARTISPRELGR-------LWNRSAQGRIMRWNQVNSAWPAKPITLCGPDK 170

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT                         F Y  + ++   T+ R D  + E D      
Sbjct: 171 DSGT-------------------------FDYFNKAVNGNATNSRSDYRSSEDDNVLVNC 205

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFY 289
           +A    +    G+ G S+Y  N + L+ + ++G    + PS+ T+    Y P SRPL  Y
Sbjct: 206 VAN---DLQALGYFGYSYYAANRNRLRALAVEGPKGAVHPSLETVQKERYLPFSRPLFLY 262

Query: 290 VKRQHFNSVLGLREYVS 306
           +  +       L+ +V+
Sbjct: 263 INNEQLQERPELQRFVT 279


>gi|302333002|gb|ADL23195.1| ABC-type phosphate transport system, periplasmic component
           [Staphylococcus aureus subsp. aureus JKD6159]
          Length = 327

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 116/291 (39%), Gaps = 52/291 (17%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E +++   + K    ++G +  G ++F  G     ID  ++SR I  
Sbjct: 41  GSSTVAPIIEKLNEKWAQDHSDAKISAGQAG-TGAGFQKFIAG----DIDFADASRPIKD 95

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
            E  + +   +   +E  I  DG+ +  +++   V    +   KA+ S            
Sbjct: 96  EEKQKLQDKNIK-YKEFKIAQDGVTVAVNKENDFVDELDKQQLKAIYS----------GK 144

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
            K W ++   +P+ +I    P+  HGT +  E +V+                        
Sbjct: 145 AKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM------------------------ 180

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----D 266
                   ++ I  E + D    ++ +  NK+  G+ G +FY  N D LK V I      
Sbjct: 181 -------NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGK 233

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
              P+  TI    Y +SRPL  YV  +       + E++ F + D+  A +
Sbjct: 234 ATEPTKKTIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAE 284


>gi|73662670|ref|YP_301451.1| phosphate ABC transporter periplasmic protein [Staphylococcus
           saprophyticus subsp. saprophyticus ATCC 15305]
 gi|123642568|sp|Q49XJ1|PSTS_STAS1 RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|72495185|dbj|BAE18506.1| ABC-type phosphate transport system periplasmic component
           [Staphylococcus saprophyticus subsp. saprophyticus ATCC
           15305]
          Length = 319

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 68/300 (22%), Positives = 116/300 (38%), Gaps = 52/300 (17%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            ++  GSST+ P    I E  +E F +       S G+S     F + I   T D  N+S
Sbjct: 35  EVKGDGSSTVGP----IIEKLNEKFAKDNKDVTVSSGTSGTGGGFEKFISGST-DFSNAS 89

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R I   E  +    G+    E  I  DG+ +  ++D   V    ++  K + S       
Sbjct: 90  RPIKDEEKKKLDDKGIK-YDEFKIAQDGVTITVNKDNDFVDELTKEQLKEIYS------- 141

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 K W ++ P +P   I  Y P   HGT +   ++V+ +G +++            
Sbjct: 142 ---GKAKTWKDVNPKWPSKEIKAYSPDQSHGTYDFFTEEVMDKGDIKA------------ 186

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                              E + D    +  ++ N+   G+ G +FY+ N D LK V + 
Sbjct: 187 -------------------EKNADTNVIVQSVQKNEQGIGYFGYNFYEQNKDKLKEVKVK 227

Query: 267 G-----IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
                   P+  TI  G Y +SRPL  Y   +      G ++++ F + D+  + +   F
Sbjct: 228 DDSGKTTEPTKKTIQDGSYALSRPLYIYTNEKKLKDNKGFQDFMKFVLEDKGKSAEDAGF 287


>gi|145219805|ref|YP_001130514.1| phosphate binding protein [Prosthecochloris vibrioformis DSM 265]
 gi|145205969|gb|ABP37012.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chlorobium phaeovibrioides DSM 265]
          Length = 271

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 73/297 (24%), Positives = 117/297 (39%), Gaps = 59/297 (19%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ F   LM   VL V       A  +I + GS+T+ P    IA++F+ YF   KT   E
Sbjct: 1   MKLFSKFLMGAAVLGVMASGDASAAGKIVMDGSTTVGP----IAKSFAAYFT--KTTGTE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV-- 118
              S  G     + I + T DI N SR +   E+   K  GV+ ++ + +  DG+ +V  
Sbjct: 55  VTVSESGSGNGAKSIINGTCDIANMSRAMKDKEVAAAKAKGVNPVEHI-VALDGLAVVVN 113

Query: 119 -SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
             +R        + D+Y                 +  WS++    P  +I         G
Sbjct: 114 PGNRVTALSKAQIRDIYSG--------------NITNWSKV--GGPNAQIVKIQRESNSG 157

Query: 178 TREVLEKKVL-QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
           T++  +  V+ +E  +  R  S+  +    N                             
Sbjct: 158 TQDTFKSLVMGKEYPISKRAESQASNGAVKN----------------------------- 188

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
           R+       GF+GL F  ++   +K + +DG+ PS  T+ +G YPISRPL  Y   Q
Sbjct: 189 RVSTTPAAIGFIGLGFVDSS---VKPLLVDGVAPSAQTVKNGTYPISRPLFMYTNGQ 242


>gi|317062168|ref|ZP_07926653.1| phosphate ABC transporter [Fusobacterium ulcerans ATCC 49185]
 gi|313687844|gb|EFS24679.1| phosphate ABC transporter [Fusobacterium ulcerans ATCC 49185]
          Length = 267

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 75/323 (23%), Positives = 140/323 (43%), Gaps = 72/323 (22%)

Query: 18  CGTGTFARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTP--FVESGGSSVGLKEFC 72
            G G  A  R   +++ GS T+   S+ IAE F     E K     V  GGS VG+    
Sbjct: 4   MGLGQKAEARSSVVQVKGSDTILNASQAIAEKF---MSENKGARIAVTGGGSGVGISALI 60

Query: 73  RGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVED 132
               + T DI  +SR I   E+++ K  G+ ++ E+ +G DGI +++++     S  ++D
Sbjct: 61  ----NKTTDIAMASRNIKDKEIEQAKAKGI-NVDEIVVGFDGITIIANK-----SNPIKD 110

Query: 133 LYKALASYLIVDDKV---VF-NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQ 188
                     +DDK    VF   +  W E+  D  E  I +       GT E  ++ +++
Sbjct: 111 ----------IDDKTLGKVFRGEITNWKELGGDDAE--IVVLSRDSSSGTHEFFKEHIIR 158

Query: 189 EGCVRSRNFSKMRDMFKYNVQQLSVACT-SVRQDGIAIEVDGDYTETLARIEVNKDVFGF 247
           EG  +           +Y  + L +    +++Q+                ++ NK   G+
Sbjct: 159 EGNSKGTQ--------EYGAKTLYMPSNEAIKQE----------------VKANKYAVGY 194

Query: 248 VGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSF 307
           +G+ +  ++   ++ V +DG+  +   +++  YPI+R + +Y            RE V  
Sbjct: 195 IGMGYMDSS---VEAVTVDGVAATPENVLNKTYPIAREVFWYADS--------AREGVVK 243

Query: 308 SVSDEMMAPDSQ--LFQYGLIPI 328
           S+ D  ++P  Q  +   G +P+
Sbjct: 244 SLVDYAISPKGQEIIKNEGFVPV 266


>gi|283958152|ref|ZP_06375603.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|283790301|gb|EFC29118.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus A017934/97]
          Length = 327

 Score = 73.6 bits (179), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 64/291 (21%), Positives = 115/291 (39%), Gaps = 52/291 (17%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+ P  + + E +++   + K    ++G +  G ++F  G     ID  ++SR I  
Sbjct: 41  GSSTVAPIVEKLNEKWAQDHSDAKISAGQAG-TGAGFQKFIAG----DIDFADASRPIKD 95

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
            E  + +   +   +E  I  DG+ +  ++    V    +   KA+ S            
Sbjct: 96  EEKQKLQDKNIK-YKEFKIAQDGVTVAVNKGNDFVDELDKQQLKAIYS----------GK 144

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
            K W ++   +P+ +I    P+  HGT +  E +V+                        
Sbjct: 145 AKTWKDVNSKWPDKKINAVSPNSSHGTYDFFENEVM------------------------ 180

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----D 266
                   ++ I  E + D    ++ +  NK+  G+ G +FY  N D LK V I      
Sbjct: 181 -------NKEDIKAEKNADTNAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGK 233

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
              P+  TI    Y +SRPL  YV  +       + E++ F + D+  A +
Sbjct: 234 ATEPTKKTIQDNSYALSRPLFIYVNEKALKDNKVMSEFIKFVLEDKGKAAE 284


>gi|284166703|ref|YP_003404982.1| phosphate binding protein [Haloterrigena turkmenica DSM 5511]
 gi|284016358|gb|ADB62309.1| phosphate binding protein [Haloterrigena turkmenica DSM 5511]
          Length = 328

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 113/269 (42%), Gaps = 48/269 (17%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKE-FCRGIGDDTIDIVNS 85
            I IAGSST++P  + I+E ++E   +     + S GS  G ++ FC G      D  N+
Sbjct: 43  EIDIAGSSTVYPLMEAISEKYNEDEDDSVGFNISSTGSGGGFEDHFCPG----ETDFNNA 98

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR +   E  +CK++ V  I+ V       +++++ +  +  +T+E+L +   +      
Sbjct: 99  SRAMKDEEKSKCKENDVEWIELVAATDALTVVINNENDWATEMTIEELAQIWEA------ 152

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
               +  + WS++  ++P+  I  +      GT +   + V+ E    + ++        
Sbjct: 153 ----DAAETWSDVNSEWPDEEIGRHGADDTSGTYDYFLENVMGEDRGHTDDYQATE---- 204

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                          D I   V GD           +   G+ G S+Y  N D +  V I
Sbjct: 205 -------------NDDNIVTGVQGD-----------QYAIGYFGFSYYYQNPDQVTAVAI 240

Query: 266 DG----IVPSMGTIVSGLY-PISRPLLFY 289
           D     + PS+ T  SG Y P+SR L  Y
Sbjct: 241 DNGDGPVEPSLDTAASGEYQPLSRSLYTY 269


>gi|312794734|ref|YP_004027657.1| phosphate binding protein [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312181874|gb|ADQ42044.1| phosphate binding protein [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 381

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 127/291 (43%), Gaps = 59/291 (20%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           RI IAGS+++ P +  +A+ F + +P+     V+ GGSSVG+K   +GI    +DI  SS
Sbjct: 138 RIMIAGSTSVQPLADELAKYFMQQYPKVSIE-VQGGGSSVGIKSAIQGI----VDIGTSS 192

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R++T+   DE K+      QE+ I  DGI ++  +     +LT++ +    +        
Sbjct: 193 RELTE---DEAKQLSSKGWQEIKIAEDGIAVIVHKSNPVSNLTIDQIRDIFS-------- 241

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +K W E+     + +I +       GTR   E+ V+ +         K+ D    
Sbjct: 242 ---GKIKNWKEVGGK--DAKIVVVTREEGSGTRGAFEEIVMGKSA-------KITD---S 286

Query: 207 NVQQLSVAC--TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
            + Q S     T+V QD  AI                    G++ +    +    +K V 
Sbjct: 287 AIVQPSTGAVKTTVSQDENAI--------------------GYISIGVLDST---IKGVK 323

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           ++GI P+   +  G Y I RP LF V +   N     + ++ F +SDE  A
Sbjct: 324 VEGIEPTEKNVKLGKYKIKRPFLFLVSK---NPSKVTKAFIDFVLSDEGQA 371


>gi|126660946|ref|ZP_01732035.1| SphX protein precursor [Cyanothece sp. CCY0110]
 gi|126617764|gb|EAZ88544.1| SphX protein precursor [Cyanothece sp. CCY0110]
          Length = 345

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 84/311 (27%), Positives = 138/311 (44%), Gaps = 52/311 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENF-SEYFPE-FKTPF 58
           +R + V L+   +L         A   I+I GSST+FP ++ + E++ SE   +  K   
Sbjct: 11  VRTWGVGLISLSLLSACGSVPESAIKPIKIDGSSTVFPITERVLESYESEAVNQPIKELN 70

Query: 59  VES--GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGIL 116
           +E    G+  G ++FC G      DI  +SR I+  E+  C  + +  I E+ I  D I 
Sbjct: 71  IEGEFSGTGGGFQKFCAG----ETDINAASRPISSEEMKVCSNNEIRYI-ELPIAFDAIT 125

Query: 117 L-VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
           + V+  +  + +LTVE L           +    N + +W+++ P +P   + +Y P   
Sbjct: 126 IAVNPGNNWTDTLTVEQLKTMW-------EPTAENQVTQWNQVDPTYPNRPLTLYGPDEL 178

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GT +   K ++ E                           + RQD +A E D      L
Sbjct: 179 SGTYDYFTKAIVGE-------------------------TGASRQDYVASEDDEVLVTGL 213

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYV 290
           A+   + +  G+ G  +Y+ N D LK V +D    G++PS+ T+ +  Y P+SRPL  YV
Sbjct: 214 AQ---DPNGIGYFGYGYYQQNQDKLKAVAVDNGNGGVIPSLQTVENEEYQPLSRPLFIYV 270

Query: 291 --KRQHFNSVL 299
             KR   N  L
Sbjct: 271 NAKRAQENPAL 281


>gi|119356864|ref|YP_911508.1| phosphate binding protein [Chlorobium phaeobacteroides DSM 266]
 gi|119354213|gb|ABL65084.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chlorobium phaeobacteroides DSM 266]
          Length = 272

 Score = 73.2 bits (178), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 75/312 (24%), Positives = 127/312 (40%), Gaps = 54/312 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ F  +L+   VL V       A  +I + GS+T+ P    IA++F+ YF   KT  V+
Sbjct: 1   MKLFRKILLSAAVLGVMASGTAEAAGKIVMDGSTTVGP----IAKSFAAYFT--KTTGVQ 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
              S  G     + + + T DI N SR +  NE+   +  GV+ ++ V I  DGI +V  
Sbjct: 55  VTVSESGSGNGAKSLINKTCDIGNMSRAMKSNEVMAARSKGVNPVEHV-IALDGIAMV-- 111

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
              V  S  V+ L KA          +       WS++    P   I I       GT++
Sbjct: 112 ---VHPSNRVDALSKAQI------QGIYMGKYTNWSQV--GGPNAAIVIIQRESNSGTQD 160

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             ++ V+ +    S+                              E         +R+  
Sbjct: 161 TFKELVMGKDSPISKR----------------------------AETQASNGAVKSRVSS 192

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
                GF+GL F  ++   +K + +D + P + T+ +G YPISRPL  Y   Q    +  
Sbjct: 193 TPAAIGFIGLGFIDSS---VKALLVDKVEPEVRTVKNGTYPISRPLFMYTNGQATGVI-- 247

Query: 301 LREYVSFSVSDE 312
            ++++  + ++E
Sbjct: 248 -KQFIDLAKTEE 258


>gi|119356865|ref|YP_911509.1| phosphate binding protein [Chlorobium phaeobacteroides DSM 266]
 gi|119354214|gb|ABL65085.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chlorobium phaeobacteroides DSM 266]
          Length = 270

 Score = 73.2 bits (178), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 77/305 (25%), Positives = 133/305 (43%), Gaps = 60/305 (19%)

Query: 8   LMCFVVLEVYCGTGTF--ARNRIRIAGSSTLFPYSKIIAENFSEYFPE-FKTPF-VESGG 63
           LM F+ + ++ G+G+   A   I + GS+T+ P    IA++F+ YF + +  P  V   G
Sbjct: 4   LMLFLFVMLFAGSGSLLAAPRSIVLDGSTTVGP----IAKSFAAYFTKKYHLPVTVSESG 59

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K       + + DI   SR + + EL   KK GV+ +  +    DGI +V     
Sbjct: 60  SGNGAKSLI----NRSCDIATMSRTMKKEELGAAKKKGVNPVATIA-ALDGIAVV----- 109

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
           V     V +L KA  +  I   KV       W+++    P+ RI +       GT+E  +
Sbjct: 110 VHPGNPVRNLTKAQIA-AIYQGKV-----SNWNQV--GGPDSRIVVIQRESNSGTQESFK 161

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           + ++ +                 + Q +  A T      +            +RI V + 
Sbjct: 162 ELIVGK-----------------SAQIVRTAETQASNGAVK-----------SRIAVTRT 193

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             GF+G+ F       +K + ++GI P++ T+ +  YP+SRPL FY   Q   ++   ++
Sbjct: 194 AIGFLGMGFVDR---TVKPLAVNGIQPTVSTVKNRTYPVSRPLYFYTNGQPAGTI---KQ 247

Query: 304 YVSFS 308
           +V  S
Sbjct: 248 FVDLS 252


>gi|312876174|ref|ZP_07736161.1| phosphate binding protein [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796989|gb|EFR13331.1| phosphate binding protein [Caldicellulosiruptor lactoaceticus 6A]
          Length = 381

 Score = 73.2 bits (178), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 75/291 (25%), Positives = 127/291 (43%), Gaps = 59/291 (20%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           RI IAGS+++ P +  +A+ F + +P+     V+ GGSSVG+K   +GI    +DI  SS
Sbjct: 138 RIMIAGSTSVQPLADELAKYFMQQYPKVSIE-VQGGGSSVGIKSAIQGI----VDIGTSS 192

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R++T+   DE K+      QE+ I  DGI ++  +     +LT++ +    +        
Sbjct: 193 RELTE---DEAKQLSSKGWQEIKIAEDGIAVIVHKSNPVSNLTIDQIRDIFS-------- 241

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +K W E+     + +I +       GTR   E+ V+ +         K+ D    
Sbjct: 242 ---GKIKNWKEVGGK--DAKIVVVTREEGSGTRGAFEEIVMGKSA-------KITD---S 286

Query: 207 NVQQLSVAC--TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
            + Q S     T+V QD                    ++  G++ L    +    +K V 
Sbjct: 287 AIVQPSTGAVKTTVSQD--------------------ENSIGYISLGVLDST---VKGVK 323

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           ++GI P+   +  G Y I RP LF V +   N     + ++ F +SDE  A
Sbjct: 324 VEGIEPTEKNVKLGKYKIKRPFLFLVSK---NPSKVTKAFIDFVLSDEGQA 371


>gi|189347114|ref|YP_001943643.1| phosphate binding protein [Chlorobium limicola DSM 245]
 gi|189341261|gb|ACD90664.1| phosphate binding protein [Chlorobium limicola DSM 245]
          Length = 272

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 71/292 (24%), Positives = 117/292 (40%), Gaps = 60/292 (20%)

Query: 6   VVLMCFVVLEVYCGTGTFAR-NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           ++LM  + L +      FA  N I + GS+T+ P +K  A  F++ +   K    ESG S
Sbjct: 8   MLLMALIALSITAPV--FAGGNSIVMDGSTTVGPLAKSFAAYFTKKY-NVKVTVSESG-S 63

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K       + + DI   SR +   E+   KK GV+ +   T+  DGI ++      
Sbjct: 64  GNGAKSLI----NKSCDIATMSRAMKPQEMAAAKKKGVNPVVH-TVALDGIAMIVHPSNP 118

Query: 125 SVSLT---VEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
             +LT   + D+YK                   W+++    P  RI +       GT+E 
Sbjct: 119 VRTLTKAQIADIYKG--------------KFINWNQV--GGPNSRIVVIQRESNSGTQEA 162

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
            ++ V+ +    S+N                             E          R+   
Sbjct: 163 FKELVMGKTAQISKN----------------------------AETQASNGAIKNRVSST 194

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
           +   GFVGL F   +   +K + ++G++PS+ T+ +G YP+SRPL  Y   Q
Sbjct: 195 RSAIGFVGLGFVDRS---VKPIAVNGVLPSVATVRNGSYPVSRPLYMYTNGQ 243


>gi|229815113|ref|ZP_04445450.1| hypothetical protein COLINT_02155 [Collinsella intestinalis DSM
           13280]
 gi|229809343|gb|EEP45108.1| hypothetical protein COLINT_02155 [Collinsella intestinalis DSM
           13280]
          Length = 264

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 83/317 (26%), Positives = 139/317 (43%), Gaps = 68/317 (21%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG-GSSVGLKEFCRGIG 76
           C +GT +   I +AGS+T  P ++  AE F E   E  T  + SG GSS G++    G  
Sbjct: 7   CSSGT-STESITVAGSTTCLPIAEQAAELFKE---ETGTGVLVSGLGSSAGIEAVSTG-- 60

Query: 77  DDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKA 136
             T +I  SSR +   E    +K G++ I    + HDGI ++ +      +L++E L   
Sbjct: 61  --TAEIATSSRGLNAEE----QKLGLTTIP---VAHDGIAVIVNTANPVQNLSIEQLR-- 109

Query: 137 LASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
                     +    +  WSE+   D P   I +       GTRE   K ++ +G     
Sbjct: 110 ---------GIYSGKISNWSEVGGEDLP---IQLVNRDEASGTREAF-KSIVMDG----- 151

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                 + F      LS                G   + ++R   ++   G++ + F ++
Sbjct: 152 ------EPFDRRAAVLSGT--------------GQVRDVVSR---SRGAIGYISMGFVES 188

Query: 256 N-ADV-LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
             A+  ++ + ++ + P   TI SG YPISR L F+ K +   +     EY+++ +SDEM
Sbjct: 189 AYAETEVRALNVNHVEPQEKTIASGGYPISRDLYFFTKGEPTGAAA---EYIAYVLSDEM 245

Query: 314 MAPDSQLFQYGLIPISN 330
              D Q+ + G IP+S 
Sbjct: 246 ---DDQIREAGFIPVSG 259


>gi|258513492|ref|YP_003189714.1| phosphate binding protein [Desulfotomaculum acetoxidans DSM 771]
 gi|257777197|gb|ACV61091.1| phosphate binding protein [Desulfotomaculum acetoxidans DSM 771]
          Length = 307

 Score = 71.6 bits (174), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 67/277 (24%), Positives = 116/277 (41%), Gaps = 60/277 (21%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFK-----------TPFVESGGSSVGLKEFCRGIG 76
           I+I GSSTL P     A+NF+E +  +            T FV SGGS  G+K    G  
Sbjct: 43  IKIGGSSTLSPVIAKCADNFTEKYKTWNKIDPKLPEEAITIFVSSGGSGFGVKSTING-- 100

Query: 77  DDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKA 136
             T+DI  +SR+IT +E ++  K              G +     D +++++  ++    
Sbjct: 101 --TVDIGLASREITNSEKEKMAK--------------GNIFKMGSDALTIAVNPQNPVLK 144

Query: 137 LASYLIVDD-KVVFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
           +   L  D+ K +F+  +K W ++ P   +  I I V     G  +V ++ V++      
Sbjct: 145 VKPNLTADEIKRIFSGEIKTWKQLDPGLSDTPIVIAVRDLGGGASQVFDELVMK------ 198

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
                                T V ++ + +   G       ++  N +  G+V +    
Sbjct: 199 --------------------GTPVAKEALQLPSMGALA---GKVMENANAIGYVSVGLVT 235

Query: 255 NNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVK 291
            N + L ++ +DGI P++  I  G Y I+RPLL   K
Sbjct: 236 QNQNKLAVLKVDGIEPTVENIALGKYKIARPLLLLTK 272


>gi|23100591|ref|NP_694058.1| phosphate ABC transporter phosphate-binding protein [Oceanobacillus
           iheyensis HTE831]
 gi|22778824|dbj|BAC15092.1| phosphate ABC transporter phosphate-binding protein [Oceanobacillus
           iheyensis HTE831]
          Length = 325

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 77/327 (23%), Positives = 140/327 (42%), Gaps = 61/327 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + I GS T++P    +AE +        +  V   G+S G ++F   + ++  D  ++SR
Sbjct: 50  VAIDGSGTVYPLMARLAEEYMINEQPGVSVEVSRAGTSAGFEKF---LAENGTDFNDASR 106

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKALASYLIVDDK 146
            I + E  +  + G+ D++E+ +  DG+ +V+  D   +  LT E +             
Sbjct: 107 LIKEEEQAKADELGI-DVKELKVALDGLTIVTHPDNDWATELTQEQV-----------QG 154

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           +       WS+I   +P+  I  Y P+  HGT E   + +L+E           +D+ + 
Sbjct: 155 IFLGEYTNWSDIDSSWPDQPIQTYGPNENHGTYEFFYENILEE-----------QDLVE- 202

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                             I++  DY+  +  I  +++  GF G  +Y +N D ++ V ID
Sbjct: 203 -----------------TIDLQQDYSTLVTLISQDENAIGFFGFGYYDSNKDSIQAVNID 245

Query: 267 ----GIVPSMGTIVS-GLYP-ISRPLLFYV---KRQHFNSVLGLREYVSFSVSDEMMAPD 317
                + PS+ TI   G Y   +RP+  Y+     Q    VL    Y+  +V+    A +
Sbjct: 246 FGDGPVEPSLDTIAEDGDYAGFTRPVFTYLNVGNAQEKPQVLDYAIYIMNNVN--TFAGE 303

Query: 318 SQLFQYGLIPISNEERKSVRDSIAVGK 344
           +     G  PI  EE +S+ + + V K
Sbjct: 304 T-----GFAPIPEEEAQSLVEELEVLK 325


>gi|289580177|ref|YP_003478643.1| phosphate ABC transporter periplasmic protein [Natrialba magadii
           ATCC 43099]
 gi|289529730|gb|ADD04081.1| phosphate binding protein [Natrialba magadii ATCC 43099]
          Length = 348

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 74/301 (24%), Positives = 125/301 (41%), Gaps = 66/301 (21%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           IRI GS+TL P S ++AE F       +   V + G+  G ++F R      I + N+SR
Sbjct: 56  IRIDGSNTLRPNSALVAEQFMWENNRVQAS-VSASGTGAGFQQFAR----REISLQNASR 110

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVS--DRDMVSVSLTVEDLYKALASYLIVDD 145
            IT  E + C+++GV  + E+ +  DGI L+   D D     LTV++L            
Sbjct: 111 PITDEEAEHCRENGVEWL-ELEVVLDGIALLKHPDNDWCEC-LTVDELGDLWER------ 162

Query: 146 KVVFNPLKKWSEIRP-----DFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
               + ++ W+++ P     ++P+  I+ Y      GT                      
Sbjct: 163 ---GSDIETWADLEPEQSDEEWPDEEISFYGRDAASGT---------------------- 197

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
              F Y  + ++ +  ++R D        D    +  +  N+   GF G  +Y  N    
Sbjct: 198 ---FDYFTEHITGSVGNIRNDYSGTP---DTNNIIRGVRGNEYTIGFGGAGYYYENEADA 251

Query: 261 KLVPI-------------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVS 306
           +L+ +             D IVP+  +I +  Y P+SRP+  YV+R    +    RE+V 
Sbjct: 252 ELIAVNYEDGEDPGDEWDDCIVPTRESIEAEAYQPLSRPMYIYVRRDEL-ARPEYREFVR 310

Query: 307 F 307
           F
Sbjct: 311 F 311


>gi|289191692|ref|YP_003457633.1| phosphate binding protein [Methanocaldococcus sp. FS406-22]
 gi|288938142|gb|ADC68897.1| phosphate binding protein [Methanocaldococcus sp. FS406-22]
          Length = 273

 Score = 71.2 bits (173), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 129/318 (40%), Gaps = 65/318 (20%)

Query: 1   MRFFFVVLMCFVVLEVYCG-----TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFK 55
           MR F  + +  +V+   CG       T    +I +AG + L P  +   + F +  P  K
Sbjct: 1   MRKFLGIFIGILVVLCLCGCINSNKETVKEEKITLAGGTALVPIMEEAGKEFMKKHPNVK 60

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
              V  GGS  G+K+    +G+  +DI  + R +   E     K    +++   IG+DG+
Sbjct: 61  V-IVSGGGSGFGIKQ----VGEGYVDIGMAGRDLKPEE-----KEKYPNLKVYRIGYDGV 110

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR-PDFPEVRIAIYVPSG 174
            +V +       LT E + K  A  +             W E+   D P   I IY    
Sbjct: 111 AIVVNPKNPIDGLTKEQVKKIFAGEIT-----------NWKEVGGKDAP---INIYTRDP 156

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
           + GTR+   + VL +G                N+ + ++   S               E 
Sbjct: 157 ESGTRDTFWRLVLDKG----------------NITKKAIVVAS-------------NGEM 187

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQH 294
            A+I ++++  G++ + +   +   +KL   DGI P+   ++ G+Y + RPL      + 
Sbjct: 188 KAKIAMDENGIGYLSVGYVDKSVKAIKL---DGIAPTQENVMKGIYKVYRPLNLITNGEP 244

Query: 295 FNSVLGLREYVSFSVSDE 312
              V   +E++ F +SDE
Sbjct: 245 KGVV---KEFIDFVLSDE 259


>gi|15679719|ref|NP_276837.1| phosphate-binding protein PstS [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|2622858|gb|AAB86197.1| phosphate-binding protein PstS [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 271

 Score = 70.9 bits (172), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 75/292 (25%), Positives = 129/292 (44%), Gaps = 62/292 (21%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           + +I I GS+++ P ++ +A  + +     K   V+ GGSSVG+K    G    T DI  
Sbjct: 29  QEKIDIVGSTSVQPVAEKLAAEYMKKHLNVKI-NVQGGGSSVGIKSAADG----TADIGT 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS+++  +E     K G++   E  IG DGI ++     V+   TV DL K         
Sbjct: 84  SSKELKPDE-----KKGLT---EYLIGKDGIAII-----VNSKNTVSDLTKDQV------ 124

Query: 145 DKVVFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
            K +F+  +  W E+    P+ +I +       GTR+  E+ V+ +              
Sbjct: 125 -KDIFSGKITNWKEV--GGPDAKITVVTREDGSGTRKAFEEIVMGK-------------- 167

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                       T +++D I   V+         ++ + +  GF+ L+   N  + +K +
Sbjct: 168 -----------ETKIKKDAI---VESSTEAVKQAVKQDPNAIGFISLA---NLDETVKAL 210

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
            IDG+ PS  T+  G Y I RP LF VK     +V   ++++ + +S E  A
Sbjct: 211 KIDGVAPSEQTVADGSYKIQRPFLFLVKGSAKGAV---KDFIDWVLSPEGQA 259


>gi|189347115|ref|YP_001943644.1| phosphate binding protein [Chlorobium limicola DSM 245]
 gi|189341262|gb|ACD90665.1| phosphate binding protein [Chlorobium limicola DSM 245]
          Length = 290

 Score = 70.9 bits (172), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 75/294 (25%), Positives = 121/294 (41%), Gaps = 53/294 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M FF  ++    VL +  G    A N+I + GS+T+ P    IA++F+ YF   KT  V+
Sbjct: 20  MNFFKKIVFGAAVLGLMAGGTAEAANKIVMDGSTTVGP----IAKSFAAYFT--KTTGVQ 73

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
              S  G     + + + T DI N SR++   E+   K  GV  ++ + +  DG+ +V  
Sbjct: 74  VTVSESGSGNGAKSLINKTCDIANMSREMKDKEVAAAKSKGVKPVEHI-VAMDGLAIV-- 130

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
              V  S  V  L KA         + ++N     W+++    P   I         GT+
Sbjct: 131 ---VHPSNRVNALSKA-------QIRGIYNGKYTNWNQV--GGPNAAIVKIQRESNSGTQ 178

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +  ++ V+ +    S+         K   Q  + A  +                   R+ 
Sbjct: 179 DSFKELVMGKDNPISK---------KAETQASNGAVKN-------------------RVA 210

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
                 GF+GL F  N    +K V +DG+ P   T+ +G YPI+RPL  Y   Q
Sbjct: 211 STPAAIGFIGLGFVDN---AVKAVMVDGVEPDERTVKNGTYPITRPLFMYTNGQ 261


>gi|284045940|ref|YP_003396280.1| phosphate binding protein [Conexibacter woesei DSM 14684]
 gi|283950161|gb|ADB52905.1| phosphate binding protein [Conexibacter woesei DSM 14684]
          Length = 326

 Score = 70.5 bits (171), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 69/270 (25%), Positives = 117/270 (43%), Gaps = 51/270 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           IRI GSST+ P ++ IAE F    P+ +     S G+  G ++FC+G      D  ++S 
Sbjct: 46  IRIDGSSTVAPLTEAIAEQFMGENPDVRITVGTS-GTGGGFEKFCQG----ETDANDASD 100

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            I +     C++ GV + +E+ + +D + +V++ +     LT + L +   +   V    
Sbjct: 101 AIDEETEAACRRGGV-EWEELQVANDALTVVANPENPISCLTTDQLRQIWGANSKV---- 155

Query: 148 VFNPLKKWSEIRPDFP--EVRIAIYVPSGKHGTREVLEKKV-LQEGCVRSRNFSKMRDMF 204
                K W+E+    P  +  +A + P    GT     + V  +EG  R+          
Sbjct: 156 -----KNWNEVTGTDPRFDAELAAFGPGTDSGTFAYFTETVDGEEGAQRT---------- 200

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
            YN                   V  D  +T+  +       G+ G SF++ N+D L+ + 
Sbjct: 201 DYN------------------NVGEDDNQTVTGVAGAPGGIGYFGFSFFQENSDKLRALE 242

Query: 265 IDG----IVPSMGTIVSGLY-PISRPLLFY 289
           IDG    + PS  T+  G Y P++RPL  Y
Sbjct: 243 IDGGSGCVAPSAETVQDGTYRPLARPLFIY 272


>gi|300780326|ref|ZP_07090182.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Corynebacterium genitalium ATCC 33030]
 gi|300534436|gb|EFK55495.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Corynebacterium genitalium ATCC 33030]
          Length = 335

 Score = 70.1 bits (170), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 121/283 (42%), Gaps = 57/283 (20%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T   A   I+  GS+T+ P +  +A  +     +F    VE+ GS+ G ++FC G     
Sbjct: 46  TNAAAGGPIKTTGSATIEPITSYMANRY-----DFDVD-VEAIGSTDGFEKFCNG----E 95

Query: 80  IDIVNSSRKITQN--ELDECKKHGVSDIQ--EVTIGHDGILLVSDRDM-VSVSLTVEDLY 134
            DI ++S  I  +  E+D  K+   +D++  E+ IG D I +V  RD   +  LTVE L+
Sbjct: 96  ADINDASTPIPGDGAEVDFQKQCADNDVEYIELPIGLDAITIVKHRDNDFATDLTVEQLH 155

Query: 135 KALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
              +           + + KWS+I P +P+  I +Y      GT  V E  VL       
Sbjct: 156 DIWSKE---------SEVSKWSDIDPSWPDEEIKLYGRPEGSGTLGVFEDLVL------- 199

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFY- 253
            +  ++RD +                     E   D  E    +  + +   F+G+  Y 
Sbjct: 200 -DGDEIRDDY---------------------ESTDDIDELTQWVADDPNALSFMGIGNYL 237

Query: 254 ---KNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
              ++   ++  V + G+ P+      G YP+SRPL  YV ++
Sbjct: 238 SAEEDAQRMIDNVKVGGVEPTAEETKDGNYPLSRPLFIYVSKK 280


>gi|256827776|ref|YP_003151735.1| ABC-type phosphate transporter periplasmic component
           [Cryptobacterium curtum DSM 15641]
 gi|256583919|gb|ACU95053.1| ABC-type phosphate transport system, periplasmic component
           [Cryptobacterium curtum DSM 15641]
          Length = 331

 Score = 69.3 bits (168), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 68/297 (22%), Positives = 112/297 (37%), Gaps = 63/297 (21%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFK-----------TPFVESGGSSVGLKEFCR 73
           ++ I   GS++L+P    +A +F++ +P +            + +V  GGS VG+     
Sbjct: 59  KSNIMFCGSTSLYPIMSSLASSFTDSYPTWNEVDASFPKTNVSIYVAPGGSGVGVSALEE 118

Query: 74  GIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDL 133
           G  D           +    L + +K  + D  E  +          +D ++VS+  E+ 
Sbjct: 119 GTCD---------YGMVARTLKDSEKEALGDYTEYEVA---------KDALTVSVNAENP 160

Query: 134 YKALASYLIVDD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGC 191
                  L  D   ++    +  W+++    P+  I +Y+     G  EV +K V+    
Sbjct: 161 IVGTVDNLSTDTIRQIFAGEITSWNQVDASLPDEPIQVYIRDLSGGAYEVFQKSVMGSST 220

Query: 192 VRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLS 251
           V +              Q  S+                  TE    I  NK   G+ G  
Sbjct: 221 VTASA-----------TQSASM------------------TELATNIANNKWAIGYAGFG 251

Query: 252 FY-KNNADVLKLVP--IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
            Y K NA+  KLV   +DG+  S   IVSG Y I RP++F  K     S     +YV
Sbjct: 252 AYNKANANGTKLVAMKVDGVEASEANIVSGDYTIQRPVMFVGKGTPTKSSQAFIDYV 308


>gi|312128794|ref|YP_003993668.1| phosphate binding protein [Caldicellulosiruptor hydrothermalis 108]
 gi|311778813|gb|ADQ08299.1| phosphate binding protein [Caldicellulosiruptor hydrothermalis 108]
          Length = 380

 Score = 69.3 bits (168), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 73/290 (25%), Positives = 124/290 (42%), Gaps = 58/290 (20%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           RI IAGS+++ P +  +A+ F + +P+     V+ GGSSVG+K   +GI    +DI  SS
Sbjct: 138 RIMIAGSTSVQPLADELAKYFMQQYPKVSIE-VQGGGSSVGIKSAIQGI----VDIGTSS 192

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R++T    DE K+      QE+ I  DGI ++  +     +LT++ +    +        
Sbjct: 193 RELTS---DEAKQLSAKGWQEIKIAEDGIAVIVHKSNPVSNLTIDQIRDIFS-------- 241

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +K W E+     + +I +       GTR   E+ V+ +  +              
Sbjct: 242 ---GKIKNWKEVGGK--DAKIVVVTREEGSGTRGAFEEIVMGKAKITDSAI--------- 287

Query: 207 NVQQLSVAC-TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
            VQ  + A  T+V QD                    ++  G++ L    +    +K V +
Sbjct: 288 -VQPSTGAVKTTVSQD--------------------ENSIGYISLGVLDST---VKGVKV 323

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           +G+ P+   +    Y I RP LF V +   N     + +V F +SDE  A
Sbjct: 324 EGVDPTEKNVKLEKYKIKRPFLFLVSK---NPSKVTKAFVDFVLSDEGQA 370


>gi|326790243|ref|YP_004308064.1| phosphate binding protein [Clostridium lentocellum DSM 5427]
 gi|326541007|gb|ADZ82866.1| phosphate binding protein [Clostridium lentocellum DSM 5427]
          Length = 275

 Score = 69.3 bits (168), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 126/291 (43%), Gaps = 58/291 (19%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
           CG+ +    ++ I GS+T+    + +AE + E  P+     V+  GSS G+K     + D
Sbjct: 22  CGSSSSKGPKVSIVGSTTVSEPMEQLAEKYKETVPDANIE-VQGNGSSAGIK----AVAD 76

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLT---VEDLY 134
            T D+  SSR++++ E    K+ G++   E  I HD I +V +      +LT   ++D+Y
Sbjct: 77  GTADMGMSSRELSEEE----KRLGLT---ETVIAHDAIAVVVNTTNEVTNLTKEQIKDIY 129

Query: 135 KALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
           +                +  WS++     +  I +       GTR   E+ +   G + +
Sbjct: 130 EG--------------KITNWSQV--GGKDENIIVVTREAGSGTRGAFEELL---GLLTT 170

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
              S + D                    +  E  G    T+A  E   +  G++ L  Y+
Sbjct: 171 DKASTIIDR------------------ALVSEGTGSIMATVASKE---NAIGYISLG-YR 208

Query: 255 NNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           N  + +KLV +DG++PS  T+++  Y ISRPLL        +    L +Y+
Sbjct: 209 N--ETVKLVEVDGVMPSAETVLANEYMISRPLLLLTSNNTSDEAKALLDYI 257


>gi|194333773|ref|YP_002015633.1| phosphate binding protein [Prosthecochloris aestuarii DSM 271]
 gi|194311591|gb|ACF45986.1| phosphate binding protein [Prosthecochloris aestuarii DSM 271]
          Length = 272

 Score = 68.9 bits (167), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 109/288 (37%), Gaps = 51/288 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + M F VL         A + I + GS+T+ P +K  A  F++ +    T  V 
Sbjct: 1   MKMLKKLFMLFTVLSFAAAGPVQAGDAIVMDGSTTVGPIAKSFAAYFTKKYGVQVT--VS 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GS  G K    G      DI N SR +   E+   K  GV  +  V +  DGI +V  
Sbjct: 59  ESGSGNGAKSIING----ACDIANMSRGMKDAEVAAAKSKGVDPVSHV-VALDGIAVV-- 111

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  +   +   AL+   I+D  +    +  WS++    P   I +       GT++
Sbjct: 112 -------VHPSNFVNALSKAQIMD--IYRGKVTNWSQV--GGPSANIVVIQRESNSGTQD 160

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
                V+ +G   ++                              E         +R+  
Sbjct: 161 SFRSLVIGKGNTITKR----------------------------AETQASNGAVKSRVST 192

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLF 288
                GF+GL F     D +K + +DG+ PS+ T+ SG YP++RPL  
Sbjct: 193 TPAAIGFIGLGFVD---DSVKALNVDGVTPSVETVKSGQYPVARPLFM 237


>gi|300866765|ref|ZP_07111447.1| hypothetical protein OSCI_3080036 [Oscillatoria sp. PCC 6506]
 gi|300335271|emb|CBN56607.1| hypothetical protein OSCI_3080036 [Oscillatoria sp. PCC 6506]
          Length = 341

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 75/276 (27%), Positives = 119/276 (43%), Gaps = 61/276 (22%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSE--YFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
           GT A     I+GS  + P S+ IA+ F +  Y  +     +++G   V  K  C    + 
Sbjct: 68  GTLA-----ISGSPVVLPISQAIAQRFIQDGYPSKIALSSIDTG---VSFKLLCE---EK 116

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQ-EVTIGHDGILLVSDRDMVSVSLTVEDLYKAL 137
            +DIVN+ R IT  EL  C + G+  I   + I    I++ S    V  SLT ++L K  
Sbjct: 117 KVDIVNTVRPITSQELAICSQSGIEPIGFPIAIDAVTIVVSSQNKFVPNSLTRDELAK-- 174

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG--KHGTREVLEKKVLQEGCVRSR 195
                     VF  ++KWS++ P +P   I   +P+G    G  ++  + +L     +  
Sbjct: 175 ----------VFT-VEKWSDVNPKWPAEAIKRIIPAGVSAGGAVDLFAQAILNGNVSQII 223

Query: 196 NFSKMRDMFKYN-VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
           N    R+   Y+ V+QL                   ++E L    +N  + GF+    YK
Sbjct: 224 N---ARNTISYHFVEQL-------------------HSEAL----INPYMVGFLEYGSYK 257

Query: 255 NNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYV 290
            N D LK + ID + P +       YP++R L  YV
Sbjct: 258 QNRDKLKAIAIDRVDPFLPA-----YPLTRYLYIYV 288


>gi|193212575|ref|YP_001998528.1| phosphate binding protein [Chlorobaculum parvum NCIB 8327]
 gi|193086052|gb|ACF11328.1| phosphate binding protein [Chlorobaculum parvum NCIB 8327]
          Length = 272

 Score = 68.9 bits (167), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 74/283 (26%), Positives = 116/283 (40%), Gaps = 66/283 (23%)

Query: 19  GTGTF-ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF---VESGGSSVGLKEFCRG 74
           GTG+  A  +I + GS+T+ P    IA+ F+ Y+ + KT     V   GS  G K    G
Sbjct: 18  GTGSASAAGKITLDGSTTVGP----IAKAFAAYYTK-KTGVDVTVSESGSGNGAKSLING 72

Query: 75  IGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV---SDRDMVSVSLTVE 131
               T DI N SR +  NE+   K  GV+ ++ V +  DGI ++    +R        + 
Sbjct: 73  ----TCDIANMSRAMKDNEIAAAKSKGVNPVEHV-VALDGIAIIVHPGNRVAALSRAQIR 127

Query: 132 DLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEG 190
           D+Y                 ++ WS++  P+ P V I                       
Sbjct: 128 DIYSG--------------KVRNWSQVGGPNAPIVMIQ---------------------- 151

Query: 191 CVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGL 250
             R  N S  +D FK+ V     A  S R      E         +R+       GFVGL
Sbjct: 152 --RESN-SGTQDSFKHLVMGKE-APISKRA-----ETQASNGAVKSRVASTPTAVGFVGL 202

Query: 251 SFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
            +  ++   +K + +DG+ P++ T+ +  YP++RPL  Y   Q
Sbjct: 203 GYVDSS---VKALAVDGVEPTVATVKAAKYPVARPLFMYTNGQ 242


>gi|327475164|gb|AEA77177.1| PstS [Bacillus sp. 15.4]
          Length = 342

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 68/296 (22%), Positives = 127/296 (42%), Gaps = 57/296 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE--SGGSSVGLKEFCRGIGDDTIDIVNS 85
           + I GS T++P+   +AEN   Y  E     VE    G+S G K+F   + +   D  ++
Sbjct: 63  VVIDGSGTVYPFMSQMAEN---YMGENGDVSVEVSRAGTSAGFKKFL--VEEGGTDFNDA 117

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR+I   EL      G+ ++ E+ +  DG+  V + +         D    +    +V+ 
Sbjct: 118 SREIKDEELTTADDLGI-EVLEMQVALDGLTFVINPE--------NDWATEMTQEEVVNI 168

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +    + KWS+I P++P+  I    P+  HGT E + + +++E     ++F        
Sbjct: 169 FLAEGGVTKWSDINPEWPDEEIKPMGPNENHGTNEFMFETIMEE-----KDFVD-----G 218

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
            N+QQ                   +Y+  +  +  +K+   F G  +Y NN D +  V +
Sbjct: 219 VNLQQ-------------------EYSTLVDLVSKDKNAIAFFGYGYYDNNKDKISAVNV 259

Query: 266 D----GIVPSMGTIVSGL------YPISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           D     + PS+ TI  GL       P +RP+  Y+          + +Y  +++++
Sbjct: 260 DFGDGPVEPSLDTI--GLSEDFAYNPFTRPVFTYLNVNMAKEKPQVLDYAKYTMNN 313


>gi|15679720|ref|NP_276838.1| phosphate-binding protein PstS-like protein [Methanothermobacter
           thermautotrophicus str. Delta H]
 gi|2622859|gb|AAB86198.1| phosphate-binding protein PstS homolog [Methanothermobacter
           thermautotrophicus str. Delta H]
          Length = 278

 Score = 68.2 bits (165), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 65/265 (24%), Positives = 112/265 (42%), Gaps = 58/265 (21%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           RI IAGS+++ P ++ +A  + +  P+ K   V+ GGS +G++   +GI    +DI  SS
Sbjct: 33  RIEIAGSTSVQPVAEELAAEYMKKHPDVKI-NVQGGGSGMGVRTVQQGI----VDIGTSS 87

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           + +   E D        D+QE  IG DGI++  +       LTV+ L    +  +     
Sbjct: 88  KALKPEEKD--------DLQEYVIGKDGIVIAVNNQNPVDDLTVDQLRDIFSGKIT---- 135

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                   W E+    P+  I + V     GTR   +  V+++  +RS            
Sbjct: 136 -------NWKEV--GGPDAEIHVIVREEGSGTRSSFKSLVMKDEKIRSDAI--------- 177

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
               +  +  SV+Q                 I+ +    GFV ++   ++   +K + ++
Sbjct: 178 ----VQGSTESVKQ----------------AIKSDPYAIGFVSMAHMSSD---VKALEVN 214

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVK 291
           G+ PS  TI  G YP+  P  F  K
Sbjct: 215 GVTPSETTIADGSYPLVVPFEFLTK 239


>gi|323699483|ref|ZP_08111395.1| phosphate binding protein [Desulfovibrio sp. ND132]
 gi|323459415|gb|EGB15280.1| phosphate binding protein [Desulfovibrio desulfuricans ND132]
          Length = 269

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 80/328 (24%), Positives = 139/328 (42%), Gaps = 67/328 (20%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L+ FV L V   +       IR+ GS+T+ P  K +   +     +   P V    S+ 
Sbjct: 4   LLIAFVTLAVLSVSALSFAAEIRVKGSTTVDPAMKKLVAAY-----QTANPGVNFSISAT 58

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGIL-LVSDRDMVS 125
           G  +  + I + T DI   SR +   E+ +C+ +G+  ++ + I  D I+ +V   + VS
Sbjct: 59  GSGDGAKAIINKTADIGMMSRPMKDAEVKKCQANGIEPVRTI-IALDCIVPIVHPSNPVS 117

Query: 126 VSLTVE--DLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              T +  D+Y+         DKV     + W EI  +  +  IA++      GT EV E
Sbjct: 118 ALTTAQLKDIYQ---------DKV-----RNWKEIGGN--DGMIALFSRETNSGTYEVWE 161

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+ +            D+        ++A                      +I  NK+
Sbjct: 162 EKVMDK--------EDENDLVSRMPSNAAMA---------------------GKIAGNKN 192

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G+VGL F       +K + ++GIVPS+ T   G YP++R L  Y   Q    V   ++
Sbjct: 193 GIGYVGLGFLNPK---VKGLAVNGIVPSVKTGADGTYPLARKLNLYTGGQPTGEV---KK 246

Query: 304 YVSFSVSDEMMAPDSQ--LFQYGLIPIS 329
           +  F     +M+P  Q  + + G +P++
Sbjct: 247 FFDF-----VMSPAGQKIIAEVGFVPVN 269


>gi|311743232|ref|ZP_07717039.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Aeromicrobium marinum DSM 15272]
 gi|311313300|gb|EFQ83210.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Aeromicrobium marinum DSM 15272]
          Length = 320

 Score = 67.8 bits (164), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 61/280 (21%), Positives = 115/280 (41%), Gaps = 50/280 (17%)

Query: 68  LKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS 127
            ++FC G      DI N+SR I  +E+  C+++G+ +  E+ +  D + +V  +D   + 
Sbjct: 81  FEKFCLG----ETDISNASRPIGDDEIVICEENGI-EFTELRVASDALSIVVSQDNEFLE 135

Query: 128 LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL 187
               D    L              +  W ++ P+FP   I +Y P    GT +    ++ 
Sbjct: 136 CLTTDELATLWG------PAAEGTITSWDQVNPEFPAETIELYGPGTDSGTFDYFTDEIN 189

Query: 188 -QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
            +EG  RS           YN  +          D + ++           +  ++   G
Sbjct: 190 GEEGASRS----------DYNASE---------DDNVIVQ----------GVSGSEFALG 220

Query: 247 FVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGL 301
           + GLS++  N+  LK V +D     + PS  T+    Y P+ RPL  YVK + +     +
Sbjct: 221 YFGLSYFLENSGSLKTVQVDSGDGCVEPSAETVADDTYTPLGRPLFIYVKNESYADKPQV 280

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
             +V + V       ++  F    I +++E++  + D +A
Sbjct: 281 AAFVDYFVEQSASIAEAAEF----IALNDEQQGELEDVLA 316


>gi|327475168|gb|AEA77179.1| PstS [Bacillus aquimaris]
          Length = 194

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 51/183 (27%), Positives = 90/183 (49%), Gaps = 27/183 (14%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            +++ GSST+ P ++ + E +S   P+ K         S     F + I  +T D+ N+S
Sbjct: 38  NVKVDGSSTVAPIAEAVNEEYSAVQPDVKVSIG----VSGSGGGFEKFIAGET-DLSNAS 92

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKALASYLIVDD 145
           R I   E  + ++ G+ D  E  + +DG+ +V +++   +  LTVEDL K     L ++D
Sbjct: 93  RPIKDEEKQKLEEAGI-DFTEFKVANDGLTIVVNKENDWAEDLTVEDLRK-----LWLED 146

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  KKWS+I P++P+  +  Y P    GT +   +++L+E           +DM K
Sbjct: 147 ----GKTKKWSDINPEWPDEEVKFYAPGTDSGTYDYFHEEILEE-----------KDMVK 191

Query: 206 YNV 208
            N+
Sbjct: 192 KNI 194


>gi|18309619|ref|NP_561553.1| phosphate ABC transporter phosphate-binding protein [Clostridium
           perfringens str. 13]
 gi|18144296|dbj|BAB80343.1| probable phosphate ABC transporter [Clostridium perfringens str.
           13]
          Length = 272

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 137/312 (43%), Gaps = 71/312 (22%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++ M F++    CG G+ A N I+I+GSS++ P  +  AE F +  P+  T  V   GSS
Sbjct: 13  ILAMGFLL--TGCGGGSRA-NIIKISGSSSVGPLVEAEAEVFKKDMPDI-TVEVNQLGSS 68

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G+K+   G    T++I  SSR + + EL+       S I+E  I +DG+ ++ + +   
Sbjct: 69  AGIKDAING----TVEIGISSRDLKEKELE-------SGIKEKPIAYDGMSVIINNENPV 117

Query: 126 VSLTVE---DLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREV 181
            +LT+E   D+Y                 +  W E+   D P   I +       GTR+ 
Sbjct: 118 QNLTMEQIRDIYTG--------------KITNWKEVGGEDTP---IVLVSREDGSGTRDA 160

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLS-VACTSVRQDGIAIEVDGDYTETLARIEV 240
            +                  ++  +N +++S  A  S     I   V G           
Sbjct: 161 FQ------------------EIVGFNSEEISPQAQISDGSGSIKTMVSG----------- 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G++  S+  N+   +  V IDG+ P+   + + +Y +SRP L   K ++ N    
Sbjct: 192 NKNAIGYISFSYVDNS---VHAVSIDGVKPTAENVQNKMYKLSRPFLLVYKEENLNE--N 246

Query: 301 LREYVSFSVSDE 312
            ++++ F +S E
Sbjct: 247 SKKFIDFIMSKE 258


>gi|169344711|ref|ZP_02865671.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens C str. JGS1495]
 gi|169297146|gb|EDS79261.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens C str. JGS1495]
          Length = 272

 Score = 67.4 bits (163), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 137/312 (43%), Gaps = 71/312 (22%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++ M F++    CG G+ A N I+I+GSS++ P  +  AE F +  P+  T  V   GSS
Sbjct: 13  ILAMGFLL--TGCGGGSRA-NIIKISGSSSVGPLVEAEAEVFKKEMPDI-TVEVNQLGSS 68

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G+K+   G    T++I  SSR + + EL+       S I+E  I +DG+ ++ + +   
Sbjct: 69  AGIKDAING----TVEIGISSRDLKEKELE-------SGIKEKPIAYDGMSVIINNENPV 117

Query: 126 VSLTVE---DLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREV 181
            +LT+E   D+Y                 +  W E+   D P   I +       GTR+ 
Sbjct: 118 QNLTMEQIRDIYTG--------------KITNWKEVGGEDTP---IVLVSREDGSGTRDA 160

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLS-VACTSVRQDGIAIEVDGDYTETLARIEV 240
            +                  ++  +N +++S  A  S     I   V G           
Sbjct: 161 FQ------------------EIVGFNSEEISPQAQISDGSGSIKTMVAG----------- 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G++  S+  N+   +  V IDG+ P+   + + +Y +SRP L   K ++ N    
Sbjct: 192 NKNAIGYISFSYVDNS---VHAVSIDGVKPTAENVQNKMYKLSRPFLLVYKEENLNE--N 246

Query: 301 LREYVSFSVSDE 312
            ++++ F +S E
Sbjct: 247 SKKFIDFIMSKE 258


>gi|146297751|ref|YP_001181522.1| phosphate binding protein [Caldicellulosiruptor saccharolyticus DSM
           8903]
 gi|145411327|gb|ABP68331.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 381

 Score = 67.0 bits (162), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 73/291 (25%), Positives = 124/291 (42%), Gaps = 60/291 (20%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           RI IAGS+++ P +  +A+ F +  P+     V+ GGSSVG+K   + I    +DI  SS
Sbjct: 139 RILIAGSTSVQPLADELAKYFMQQNPKISIE-VQGGGSSVGIKSAIQSI----VDIGTSS 193

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R++T+   DE ++      Q++ I  DGI ++  +     +L++E +    +        
Sbjct: 194 RELTE---DETRQLSAKGWQQIKIAEDGIAVIVHKTNPVSNLSIEQIRDIFS-------- 242

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +K W E+        I +       GTR   E+ V+ +        +K+ D    
Sbjct: 243 ---GKIKNWKEVGGK--NAPIVVVTREEGSGTRGAFEEIVMGK--------AKITD---S 286

Query: 207 NVQQLSVAC--TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
            + Q S     T+V QD                    ++  GF+ L    +    +K V 
Sbjct: 287 AIVQPSTGAVKTTVSQD--------------------ENAIGFISLGVLDST---VKGVK 323

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           +DG+ P+   +  G Y + RP LF V +   N     + +V F +SDE  A
Sbjct: 324 VDGVEPTEKNVKLGKYKVKRPFLFLVSK---NPSRVTKAFVDFVLSDEGQA 371


>gi|124485938|ref|YP_001030554.1| hypothetical protein Mlab_1118 [Methanocorpusculum labreanum Z]
 gi|124363479|gb|ABN07287.1| phosphate binding protein [Methanocorpusculum labreanum Z]
          Length = 278

 Score = 66.6 bits (161), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 80/330 (24%), Positives = 136/330 (41%), Gaps = 74/330 (22%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE--SGG 63
           ++   F+V    C +       + +AGS+T+ P ++ +AE    Y  E  T  ++   GG
Sbjct: 16  ILFAVFLVFASGCVSQGEEPETLTLAGSTTVLPVAQTVAEI---YMDEHATADIQVSGGG 72

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SSVG      G    T DI   SR     EL + +K G SD++E  I  DGI L++    
Sbjct: 73  SSVGATAAKEG----TADIGMLSR-----ELKDSEKEG-SDLKEYVIAKDGIALIAHPSN 122

Query: 124 VSVSLTVE---DLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
               LT+E   D+Y+                +  W E+     +++I +       GTRE
Sbjct: 123 TVSDLTLEQIKDIYQ--------------GKITNWKELGG--ADMKIVLIGRDSASGTRE 166

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + VL+    +    S M++       Q +VA T                        
Sbjct: 167 FFTEFVLK----KEDAASTMQEFSSNGAVQQAVAQT------------------------ 198

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
                G+V L F     D +K   + G+ P++  +++G Y I+RPLL     +      G
Sbjct: 199 -PGAIGYVSLEFVD---DSVKAFTLSGVAPTVENVINGSYSINRPLLMITNGEP----TG 250

Query: 301 L-REYVSFSVSDEMMAPDSQLFQYGLIPIS 329
           L ++++ F +SDE     + + + G +P++
Sbjct: 251 LAKKFLEFILSDE---GQTIIAENGFVPVN 277


>gi|168218151|ref|ZP_02643776.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens NCTC 8239]
 gi|182379846|gb|EDT77325.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens NCTC 8239]
          Length = 272

 Score = 66.2 bits (160), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 136/312 (43%), Gaps = 71/312 (22%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++ M F++    CG G+ A N I+I+GSS++ P  +  AE F +  P+  T  V   GSS
Sbjct: 13  ILAMGFLL--TGCGGGSRA-NIIKISGSSSVGPLVEAEAEVFKKDMPDI-TVEVNQLGSS 68

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G+K+   G    T++I  SSR + + EL+       S I+E  I +DG+ ++ + +   
Sbjct: 69  AGIKDAING----TVEIGISSRDLKEKELE-------SGIKEKPIAYDGMSVIINNENPV 117

Query: 126 VSLTVE---DLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREV 181
            +LT+E   D+Y                 +  W E+   D P   I +       GTR+ 
Sbjct: 118 QNLTMEQIRDIYTG--------------KITNWKEVGGEDTP---IVLVSREDGSGTRDA 160

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLS-VACTSVRQDGIAIEVDGDYTETLARIEV 240
            +                  ++  +N +++S  A  S     I   V G           
Sbjct: 161 FQ------------------EIVGFNSEEISPQAQISDGSGSIKTMVAG----------- 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G++  S+     D +  V IDG+ P+   + + +Y +SRP L   K ++ N    
Sbjct: 192 NKNAIGYISFSYVD---DSVHAVSIDGVKPTAENVQNKMYKLSRPFLLVYKEENLNE--N 246

Query: 301 LREYVSFSVSDE 312
            ++++ F +S E
Sbjct: 247 SKKFIDFIMSKE 258


>gi|330508190|ref|YP_004384618.1| phosphate binding protein [Methanosaeta concilii GP-6]
 gi|328928998|gb|AEB68800.1| phosphate binding protein [Methanosaeta concilii GP-6]
          Length = 274

 Score = 66.2 bits (160), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 72/339 (21%), Positives = 137/339 (40%), Gaps = 76/339 (22%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGT---FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR  F  L+  +++   C  GT    A   +R+AGS+T+ P ++  AE F+    +++  
Sbjct: 1   MRKLFGALLIALIV---CAIGTTMVVAMEDVRVAGSTTVLPLAEGGAEVFNAEQSDYRVT 57

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
                 +  G     + I +   +I  +SR++T    DE ++      QE  IG+DGI++
Sbjct: 58  V-----TGGGTGVGMKNIAEGNSEIAMASREVT----DEEREKFGDKFQENLIGYDGIVI 108

Query: 118 VSDRDMVSVSLT------VEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
              R++    +T      VE++Y                 +  W E+  D P+  I +  
Sbjct: 109 AVSREIYDAGVTSLSKEQVEEIYAG--------------EIDNWEEL--DGPDEEILVIG 152

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
                GTR+   ++++ +    +   S                            V G  
Sbjct: 153 REQGSGTRDTFNEEIMGDKSAETPGVST---------------------------VAGSN 185

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVK 291
            E    +  +    G++G S+ ++  D +  + +DGI+P+  TI  G Y ++R L FY  
Sbjct: 186 AEIKTALTGSDQAIGYLGYSYVQD--DSVGTISLDGILPTEETIKDGSYELARELYFYT- 242

Query: 292 RQHFNSVLGLREYVSFSVSDEMMAPDSQ--LFQYGLIPI 328
             +  +  G + ++ F     M+    +    +YG IP+
Sbjct: 243 --YDEATAGAQSFIDF-----MLGSKGRDVATEYGFIPL 274


>gi|302391638|ref|YP_003827458.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Acetohalobium arabaticum DSM 5501]
 gi|302203715|gb|ADL12393.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Acetohalobium arabaticum DSM 5501]
          Length = 303

 Score = 65.9 bits (159), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 118/271 (43%), Gaps = 52/271 (19%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
           G+   A+N + I GSST+ P ++  AE + E  PE     V  GGS  G+        D 
Sbjct: 51  GSDEKAKN-LSIQGSSTVLPIAQRAAEVYMEKNPEVNIT-VRGGGSGNGIAALV----DG 104

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
            +DI ++SR I + E D+ + +G+  +    +  DGI +V         LT++++ KA+ 
Sbjct: 105 AVDIADASRFIKEGEYDQARDNGIYPVPH-RVAMDGIAVVLHPSNSVDGLTLDEI-KAIY 162

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
           +  I +          W E+  +  E  I +       GT EV  +  L           
Sbjct: 163 TGEITN----------WKELGGEDEE--IVVVSRDSSSGTFEVFGEIAL----------- 199

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
                     +   VA +++ Q      V G  +ET   I       G+VGL +    +D
Sbjct: 200 ----------EGEKVAPSALMQASNGA-VSGTVSETEGAI-------GYVGLGYL---SD 238

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFY 289
            LK V ++G+ PS  T+ SG +PI+RPL  +
Sbjct: 239 DLKAVKVNGVKPSNATVASGAFPIARPLFMF 269


>gi|168214869|ref|ZP_02640494.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens CPE str. F4969]
 gi|170713699|gb|EDT25881.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens CPE str. F4969]
          Length = 272

 Score = 65.9 bits (159), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 135/312 (43%), Gaps = 71/312 (22%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++ M F++    CG G+ A N I+I+GSS++ P  +  AE F +  P+  T  V   GSS
Sbjct: 13  ILAMGFLL--TGCGGGSRA-NIIKISGSSSVGPLVEAEAEVFKKEMPDI-TVEVNQLGSS 68

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G+K+   G    T++I  SSR + + EL+       S I+E  I +DG+ ++ +     
Sbjct: 69  AGIKDAING----TVEIGISSRDLKEKELE-------SGIKEKPIAYDGMSVIINNKNPV 117

Query: 126 VSLTVE---DLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREV 181
            +LT+E   D+Y                 +  W E+   D P   I +       GTR+ 
Sbjct: 118 QNLTMEQIRDIYTG--------------KITNWKEVGGEDTP---IVLVSREDGSGTRDA 160

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLS-VACTSVRQDGIAIEVDGDYTETLARIEV 240
            +                  ++  +N +++S  A  S     I   V G           
Sbjct: 161 FQ------------------EIVGFNSEEISPQAQISDGSGSIKTMVAG----------- 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G++  S+     D +  V IDG+ P+   + + +Y +SRP L   K ++ N    
Sbjct: 192 NKNAIGYISFSYVD---DSVHAVSIDGVKPTAENVQNKMYKLSRPFLLVYKEENLNE--N 246

Query: 301 LREYVSFSVSDE 312
            ++++ F +S E
Sbjct: 247 SKKFIDFIMSKE 258


>gi|206895081|ref|YP_002247459.1| phosphate-binding protein [Coprothermobacter proteolyticus DSM
           5265]
 gi|206737698|gb|ACI16776.1| phosphate-binding protein [Coprothermobacter proteolyticus DSM
           5265]
          Length = 302

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 91/359 (25%), Positives = 142/359 (39%), Gaps = 92/359 (25%)

Query: 1   MRFFFVVLMCFVVLEVY----CGT-----GTFARNRIRIAGSSTLFPYSKIIAENFSEYF 51
           MR  +V ++ F+++       C T     G      I I GS T     + +AE F    
Sbjct: 1   MRRRYVSVVGFILVAALLLAGCTTQPENAGNTESKSIVIKGSDTEVNMVQALAEEFRNQH 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
           P+  T  V  GGS  G+     G     IDI NSSR+I+Q ELD+ K + + +I      
Sbjct: 61  PDI-TISVSGGGSGSGIAALING----EIDIANSSREISQEELDQAKANNI-EIGTFIDA 114

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIY 170
            DGI ++  ++     LT++ +            K+    +  W E+   D P   I +Y
Sbjct: 115 RDGITVIVHQNNPVEKLTLDQI-----------GKIYRGEITNWKEVGGKDMP---ITLY 160

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
                 GT                  F+  RD                      + V GD
Sbjct: 161 GRQSNSGT------------------FTFFRD----------------------VAVKGD 180

Query: 231 YTETLARIEVNKDV----------FGFVGLSFYKNNADVLK--LVPIDG----IVPSMGT 274
           Y  ++  +  N D+           G+VG+ ++K   + +K  LV  DG        +  
Sbjct: 181 YASSMRSMNGNSDIINAVAQDETAIGYVGVGYFKQAQNQVKQVLVSTDGNNYYSSTDLQA 240

Query: 275 IVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER 333
           I   LYP++RPL  YVK     +V   ++++SF +S+E  A    + + G  PI  EER
Sbjct: 241 IDQKLYPLARPLYQYVKMPLTQAV---KDFLSFEISEEGQAI---VEENGFYPIGPEER 293


>gi|21673723|ref|NP_661788.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Chlorobium tepidum TLS]
 gi|21646846|gb|AAM72130.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Chlorobium tepidum TLS]
          Length = 270

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 117/296 (39%), Gaps = 58/296 (19%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF-- 58
           M  F  ++    V+ +       A  +I I GS+T+ P    IA+ F+ YF + KT    
Sbjct: 1   MNLFKKIIFGAAVMGLMAAGDASAAGKIVIDGSTTVGP----IAKAFAAYFHK-KTGIDV 55

Query: 59  -VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            V   GS  G K       + T DI + SR +   E+   K +GV+ ++ V +  DG+ +
Sbjct: 56  TVSESGSGNGAKSLI----NKTCDIADMSRPMEPKEIAAAKANGVNPVEHV-VALDGLSM 110

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           +         LT   ++            +    +  W ++    P  +I         G
Sbjct: 111 IVHPSNPVAKLTTAQIHD-----------IYLGKITNWKQV--GGPNAQIVFVQRESNSG 157

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T+E  EK V+++                    +++ A  +   +G             +R
Sbjct: 158 TQECFEKLVMKD-------------------DKIAPAAETAASNG----------AVKSR 188

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
           +    +  GFVGL F   +   +K + ++G+ PS+ T+ +G Y + RPL  Y   Q
Sbjct: 189 VASTPNAIGFVGLGFVDKS---VKPLIVNGVKPSIATVRNGSYVLHRPLFMYTNGQ 241


>gi|134300134|ref|YP_001113630.1| phosphate-binding protein [Desulfotomaculum reducens MI-1]
 gi|134052834|gb|ABO50805.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Desulfotomaculum reducens MI-1]
          Length = 304

 Score = 65.5 bits (158), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/281 (22%), Positives = 114/281 (40%), Gaps = 64/281 (22%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEF-----KTP------FVESGGSSVGLKEFCRGIG 76
           I+I GSSTL P     A++F+E +  +     K P      FV +GGS  G+K       
Sbjct: 42  IKIGGSSTLAPVIAKCADDFTEEYKTWNKVDPKLPEEPIVIFVSTGGSGFGVKSAI---- 97

Query: 77  DDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD----MVSVSLTVED 132
           D T+DI   SR     E+ + +K  + + + + +G D + +  +       V   LT ++
Sbjct: 98  DGTVDIGLVSR-----EVKDTEKGKMPNGKIIKMGSDALTIAVNPKNPVIQVKPDLTNDE 152

Query: 133 LYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCV 192
           + +  A  +           K W E+    P   + + +     G  +V ++ V+++   
Sbjct: 153 VKRIFAGEI-----------KTWQELDAKLPARPVVLAIRDLGGGASQVFDELVMKK--- 198

Query: 193 RSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSF 252
                                  T + ++ + +   G     +A    N D  G+V    
Sbjct: 199 -----------------------TPIAKEALQLPSMGALAGKVAE---NADAIGYVSFGL 232

Query: 253 YKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
            K N   + ++ +DG+ P+  +I SG Y I+RPLL   K Q
Sbjct: 233 VKQNQGKISVLSVDGVTPTTESIASGQYKIARPLLLVTKEQ 273


>gi|302342493|ref|YP_003807022.1| phosphate binding protein [Desulfarculus baarsii DSM 2075]
 gi|301639106|gb|ADK84428.1| phosphate binding protein [Desulfarculus baarsii DSM 2075]
          Length = 276

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 73/302 (24%), Positives = 117/302 (38%), Gaps = 57/302 (18%)

Query: 8   LMCFVVLEVYC-GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           ++C     V   G    A ++I I+GS+T+ P ++  AE + +  P      V   GS  
Sbjct: 10  VICLAAAGVMLLGGAALAADKISISGSTTVLPIAQKAAEVYMKTNPGAAEISVSGTGSGD 69

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           GLK    G    +IDI +SSR     E+    + GV  ++ V +  D I+ V +      
Sbjct: 70  GLKALVEG----SIDIADSSRAAKDKEIKRADEKGVKLVKHV-VALDCIVPVVNPANKVT 124

Query: 127 SLT---VEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            LT   ++D+Y                 +K WSE+  D  +  I +       GT EV  
Sbjct: 125 GLTKAQIKDIYT--------------GAIKNWSEVGGD--DGPIVVISRDSSSGTFEVWN 168

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           + VL +  VR                QL  +  +V Q                 +  NK 
Sbjct: 169 ELVLHKERVRPD-------------AQLQASNGAVAQ----------------AVASNKY 199

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G+VG+ +   +   LK + +DG+  S        YP+SR L  Y   +   +V    +
Sbjct: 200 AIGYVGIGYLSKD---LKGLTVDGVAASSDAARDKSYPVSRELYMYTNGEPTGAVKAFID 256

Query: 304 YV 305
           +V
Sbjct: 257 FV 258


>gi|304314075|ref|YP_003849222.1| extracellular phosphate-binding protein [Methanothermobacter
           marburgensis str. Marburg]
 gi|302587534|gb|ADL57909.1| predicted extracellular phosphate-binding protein
           [Methanothermobacter marburgensis str. Marburg]
          Length = 275

 Score = 65.1 bits (157), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 66/289 (22%), Positives = 121/289 (41%), Gaps = 61/289 (21%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           RI IAGS+++ P ++ +AE + +  P  +   V+ GGS +G++   +G+    +DI  SS
Sbjct: 30  RIEIAGSTSVQPVAEKLAEEYMKDHPNVRI-NVQGGGSGMGIRTVQQGV----VDIGTSS 84

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           + +  +E D  K        E  IG DGI++  +       LT E L    +  +     
Sbjct: 85  KALKSDEKDGLK--------EYVIGKDGIVIAVNHQNPVDDLTTEQLRDIFSGKI----- 131

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                 + W E+    P+  I + V     GTR   +  V+++  +RS            
Sbjct: 132 ------RNWKEV--GGPDAEIHVIVREEGSGTRSSFKSLVMKDEKIRSDAI--------- 174

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
               +  +  SV+Q                 I+ +    GFV ++   ++   +K + ++
Sbjct: 175 ----VQGSTESVKQ----------------AIKSDPYAVGFVSMAHMSSD---VKALEVN 211

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           GI PS  T+  G YP+  P  F  + +    V   ++++ +  S E  A
Sbjct: 212 GITPSETTVADGSYPLVVPFEFITRGEPVGVV---KDFIDWVFSPEGQA 257


>gi|168211949|ref|ZP_02637574.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens B str. ATCC 3626]
 gi|170710111|gb|EDT22293.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens B str. ATCC 3626]
          Length = 272

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 136/312 (43%), Gaps = 71/312 (22%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++ M F++    CG G+ A N I+I+GSS++ P  +  AE F +  P+  T  V   GSS
Sbjct: 13  ILAMGFLL--TGCGGGSRA-NIIKISGSSSVGPLVEAEAEVFKKDMPDI-TVEVNQLGSS 68

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G+K+   G    T++I  SSR + + EL+       S I+E  I +DG+ ++ + +   
Sbjct: 69  AGIKDAING----TVEIGISSRDLKEKELE-------SGIKEKPIAYDGMSVIINNENPV 117

Query: 126 VSLTVE---DLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREV 181
            +LT+E   D+Y                 +  W E+   D P   I +       GTR+ 
Sbjct: 118 QNLTMEQIRDIYTG--------------KITNWKEVGGEDTP---IVLVSREDGSGTRDA 160

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLS-VACTSVRQDGIAIEVDGDYTETLARIEV 240
            +                  ++  +N +++S  A  S     I   V G           
Sbjct: 161 FQ------------------EIVGFNSEEISPQAQISDGSGSIKTMVAG----------- 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G++  S+  N+   +  V IDG+ P+   + +  Y +SRP L   K ++ N    
Sbjct: 192 NKNAIGYISFSYVDNS---VHAVSIDGVNPTAENVQNKKYKLSRPFLLVYKEENLNE--N 246

Query: 301 LREYVSFSVSDE 312
            ++++ F +S E
Sbjct: 247 SKKFIDFIMSKE 258


>gi|110799563|ref|YP_695071.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens ATCC 13124]
 gi|110674210|gb|ABG83197.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens ATCC 13124]
          Length = 272

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 135/312 (43%), Gaps = 71/312 (22%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++ M F++    CG G+ A N I+I+GSS++ P  +  AE F +  P+  T  V   GSS
Sbjct: 13  ILAMGFLL--TGCGGGSRA-NIIKISGSSSVGPLVEAEAEVFKKEMPDI-TVEVNQLGSS 68

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G+K+   G    T++I  SSR + + EL+       S I+E  I +DG+ ++ + +   
Sbjct: 69  AGIKDAING----TVEIGISSRDLKEKELE-------SGIKEKPIAYDGMSVIINNENPV 117

Query: 126 VSLTVE---DLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREV 181
            +LT+E   D+Y                 +  W E+   D P   I +       GTR+ 
Sbjct: 118 QNLTMEQIRDIYTG--------------KITNWKEVGGEDTP---IVLVSREDGSGTRDA 160

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLS-VACTSVRQDGIAIEVDGDYTETLARIEV 240
            +                  ++  +N +++S  A  S     I   V G           
Sbjct: 161 FQ------------------EIVGFNSEEISPQAQISDGSGSIKTMVAG----------- 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G++  S+     D +  V IDG+ P+   + +  Y +SRP L   K ++ N    
Sbjct: 192 NKNAIGYISFSYVD---DSVHAVSIDGVKPTAENVQNKKYKLSRPFLLVYKEENLNE--N 246

Query: 301 LREYVSFSVSDE 312
            ++++ F +S E
Sbjct: 247 SKKFIDFIMSKE 258


>gi|182625763|ref|ZP_02953531.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens D str. JGS1721]
 gi|177909025|gb|EDT71507.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens D str. JGS1721]
          Length = 272

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 136/312 (43%), Gaps = 71/312 (22%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++ M F++    CG G+ A N I+I+GSS++ P  +  AE F +  P+  T  V   GSS
Sbjct: 13  ILAMGFLL--TGCGGGSRA-NIIKISGSSSVGPLLEAEAEVFKKDMPDI-TVEVNQLGSS 68

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G+K+   G    T++I  SSR + + EL+       S I+E  I +DG+ ++ + +   
Sbjct: 69  AGIKDAING----TVEIGISSRDLKEKELE-------SGIKEKPIAYDGMSVIINNENPV 117

Query: 126 VSLTVE---DLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREV 181
            +LT+E   D+Y                 +  W E+   D P   I +       GTR+ 
Sbjct: 118 QNLTMEQIRDIYTG--------------KITNWKEVGGEDTP---IVLVSREDGSGTRDA 160

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLS-VACTSVRQDGIAIEVDGDYTETLARIEV 240
            +                  ++  +N +++S  A  S     I   V G           
Sbjct: 161 FQ------------------EIVGFNSEEISPQAQISDGSGSIKTMVAG----------- 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G++  S+  N+   +  V IDG+ P+   + +  Y +SRP L   K ++ N    
Sbjct: 192 NKNAIGYISFSYVDNS---VHAVSIDGVKPTAENVQNKKYKLSRPFLLVYKEENLNE--N 246

Query: 301 LREYVSFSVSDE 312
            ++++ F +S E
Sbjct: 247 SKKFIDFIMSKE 258


>gi|294102660|ref|YP_003554518.1| phosphate binding protein [Aminobacterium colombiense DSM 12261]
 gi|293617640|gb|ADE57794.1| phosphate binding protein [Aminobacterium colombiense DSM 12261]
          Length = 269

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 77/332 (23%), Positives = 130/332 (39%), Gaps = 68/332 (20%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ F    +    L V   +GT     + I GS+T+ P ++  AE +    PE     V 
Sbjct: 1   MKKFIAGAVLAATLAV---SGTAFAAELVIKGSTTVLPIAQSAAEKYMTAHPEVAIT-VS 56

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
            GGS  G+K       D T DI +SSR I   E+    + G   +    I  D ++ V  
Sbjct: 57  GGGSGNGIKAII----DGTTDIADSSRFIKNEEVKAAVEKGTYPVP-FGIAMDALIPVVH 111

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI----RPDFPEVRIAIYVPSGKH 176
                  L++E L            K+    +K W ++    +P      IAI       
Sbjct: 112 PSNPVQDLSIEQL-----------KKIYMGEIKNWKDVGGSNKP------IAIVSRDTSS 154

Query: 177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
           GT E  E K+L    V  R                           + +  +G   +T+A
Sbjct: 155 GTYETWESKILHGERVDKR--------------------------ALIVASNGAMVQTVA 188

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFN 296
           +   N++  G++GL +  ++   LK   ++GI  +    ++G +P+SR L  + K     
Sbjct: 189 K---NENAVGYIGLGYLNDSVKALK---VEGISGNKENALNGTFPVSRYLYMFTKGWPSG 242

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPI 328
            +L    +++F +SDE       + + G +PI
Sbjct: 243 DIL---NFINFVLSDE---GQKLVGEAGFVPI 268


>gi|168181249|ref|ZP_02615913.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum Bf]
 gi|237793706|ref|YP_002861258.1| phosphate uptake ABC transporter phosphate-binding protein
           [Clostridium botulinum Ba4 str. 657]
 gi|182675371|gb|EDT87332.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum Bf]
 gi|229263183|gb|ACQ54216.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum Ba4 str. 657]
          Length = 303

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 71/310 (22%), Positives = 119/310 (38%), Gaps = 68/310 (21%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------RIRIAGSSTLFPYSKIIAENFSEY 50
           +     VL+   +L   CG+   + +          +I   GSSTL P      +     
Sbjct: 5   LSVMLSVLLTSALLFTACGSKQTSNSNEESSKKESGKIMCIGSSTLAPVVSKAGDTLKSK 64

Query: 51  FPEFKT-----P------FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
              +K      P       V SGGS  G+K       + T +    SR+++++E  + K+
Sbjct: 65  HGTWKKMNDKLPDENIELAVSSGGSGAGVKAAL----EKTANFGLISREVSKDEKAKMKE 120

Query: 100 HGVSDIQEVTIGHDGILL-VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI 158
           +      E+ IG+D + L V+ ++++  +       K L S  I   K+     K W ++
Sbjct: 121 Y-----NEIKIGYDALTLSVNPQNLILKN------KKGLTSEEI--QKIFSGEAKTWKDV 167

Query: 159 RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSV 218
            P  P  +I + V     G  EV +K V+ +                            V
Sbjct: 168 DPSLPANKIVLVVRDAGGGAAEVFQKAVMGD--------------------------KKV 201

Query: 219 RQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSG 278
            +D +     G  T+   ++  NKD  G+  +     N   L  + +DGI P+   I SG
Sbjct: 202 SKDAVQAPSMGALTQ---KVIENKDAIGYASVGLVDQNKGKLTPMEVDGIAPTKENITSG 258

Query: 279 LYPISRPLLF 288
            Y I+RPLL 
Sbjct: 259 KYKIARPLLL 268


>gi|255525564|ref|ZP_05392499.1| phosphate ABC transporter phosphate-binding protein [Clostridium
           carboxidivorans P7]
 gi|255510748|gb|EET87053.1| phosphate ABC transporter phosphate-binding protein [Clostridium
           carboxidivorans P7]
          Length = 304

 Score = 64.7 bits (156), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 75/334 (22%), Positives = 130/334 (38%), Gaps = 69/334 (20%)

Query: 18  CGTGTFARN-------RIRIAGSSTLFPYSKIIAENFSEYFPEFKT--------PF---V 59
           CG+   ++N       +I  +GSST+ P    I  NF+E    +          P    V
Sbjct: 22  CGSQKTSQNSGDSKETKIMFSGSSTMAPTISKIGNNFTEKNKTWNKVDSSLPDKPIQITV 81

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
            SGGS  G+K               S+  +   E+ + +K  ++  +E  IG D + +  
Sbjct: 82  SSGGSGTGVKAAVE---------KTSNFGLISMEMPKDQKSKMTKYKEFKIGMDALTIS- 131

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
               V+   ++    K L    I   K+     K WS++ P  P  +I I V     G  
Sbjct: 132 ----VNPQNSILQKKKGLTKEEI--QKIFSGEAKLWSDVDPSLPANKIVIVVRDAGGGAG 185

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           EV +K ++             + + K  +Q  S+                       +I 
Sbjct: 186 EVFDKSIMNG-----------KKISKEAIQAPSMGALG------------------QKIM 216

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            NKD  G+  +     N   +  + +DG+ P+   I+SG Y I+RPLL  +K    N  +
Sbjct: 217 ENKDAIGYASVGIVDQNKGKIVSMDVDGVTPTSENILSGKYKIARPLLI-IKDGDLN--V 273

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER 333
               ++ +  S+E +    +L   G +P+SN ++
Sbjct: 274 EENAFIKYVTSEEGLKVVKEL---GFVPVSNSKQ 304


>gi|322804662|emb|CBZ02214.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS (TC 3.A.1.7.1) [Clostridium botulinum H04402 065]
          Length = 303

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 76/334 (22%), Positives = 130/334 (38%), Gaps = 71/334 (21%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------RIRIAGSSTLFPYSKIIAENFSEY 50
           +     VL+   +L   CG+   + +          +I   GSSTL P      +     
Sbjct: 5   LSVMLSVLLTSALLFTACGSKQTSNSNEESSKKESGKIMCIGSSTLAPVVSKAGDTLKSK 64

Query: 51  FPEFKT-----P------FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
              +K      P       V SGGS  G+K       + T +    SR+++++E  + K+
Sbjct: 65  HGTWKKMNDKLPDENIELAVSSGGSGAGVKAAL----EKTANFGLISREVSKDEKAKMKE 120

Query: 100 HGVSDIQEVTIGHDGILL-VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI 158
           +      E+ IG+D + L V+ ++++  +       K L S  I   K+     K W ++
Sbjct: 121 Y-----NEIKIGYDALTLSVNPQNLILKN------KKGLTSQEI--QKIFSGEAKTWKDV 167

Query: 159 RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSV 218
            P  P  +I + V     G  EV +K V+ +                            V
Sbjct: 168 DPSLPANKIVLVVRDAGGGAAEVFQKAVMGD--------------------------KKV 201

Query: 219 RQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSG 278
            +D +     G  T+   ++  NKD  G+  +     N   L  + +DG+ P+   I +G
Sbjct: 202 SKDAVQAPSMGALTQ---KVIENKDAIGYASVGLVDQNKGKLTPMEVDGVAPTKENITNG 258

Query: 279 LYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
            Y I+RPLL  +K   F  V   + +V F  S+E
Sbjct: 259 KYKIARPLLL-IKDGKFTGV--EQTFVDFLKSEE 289


>gi|168206752|ref|ZP_02632757.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens E str. JGS1987]
 gi|170661852|gb|EDT14535.1| phosphate ABC transporter, phosphate-binding protein [Clostridium
           perfringens E str. JGS1987]
          Length = 272

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 78/312 (25%), Positives = 135/312 (43%), Gaps = 71/312 (22%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++ M F++    CG G+ A N I+I+GSS++ P  +  AE F +  P+  T  V   GSS
Sbjct: 13  ILAMGFLL--TGCGGGSRA-NIIKISGSSSVGPLVEAEAEVFKKDMPDI-TVEVNQLGSS 68

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G+K+   G    T++I  SSR + + EL+       S I+E  I +DG+ ++ + +   
Sbjct: 69  AGIKDAING----TVEIGISSRDLKEKELE-------SGIKEKPIAYDGMSVIINNENPV 117

Query: 126 VSLTVE---DLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREV 181
            +LT+E   D+Y                 +  W E+   D P   I +       GTR+ 
Sbjct: 118 QNLTMEQIRDIYTG--------------KITNWKEVGGEDTP---IVLVSREDGSGTRDA 160

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLS-VACTSVRQDGIAIEVDGDYTETLARIEV 240
            +                  ++  +N +++S  A  S     I   V G           
Sbjct: 161 FQ------------------EIVGFNSEEISPQAQISDGSGSIKTMVAG----------- 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G++  S+     D +  V IDG+ P+   + +  Y +SRP L   K ++ N    
Sbjct: 192 NKNAIGYISFSYVD---DSVHAVSIDGVKPTAENVQNKKYKLSRPFLLVYKEENLNE--N 246

Query: 301 LREYVSFSVSDE 312
            ++++ F +S E
Sbjct: 247 SKKFIDFIMSKE 258


>gi|78187107|ref|YP_375150.1| phosphate binding protein [Chlorobium luteolum DSM 273]
 gi|78167009|gb|ABB24107.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chlorobium luteolum DSM 273]
          Length = 264

 Score = 64.3 bits (155), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 73/277 (26%), Positives = 109/277 (39%), Gaps = 55/277 (19%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPE-FKTPF-VESGGSSVGLKEFCRGIGDDTID 81
           A N I I GS+T+ P    IA++F+ YF + +  P  V   GS  G K    G      D
Sbjct: 17  AGNGIVIDGSTTVGP----IAKSFAAYFTKRYGVPVTVSESGSGNGAKSLING----ACD 68

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I   SR +   E+   +K G+  +  V    DGI +V     V  S  V  L KA  + +
Sbjct: 69  IAAMSRDMKTQEIAAARKKGIQPVAHVA-ALDGIAIV-----VHPSNPVRGLTKAQIAGI 122

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
                        W E+    P  RI +       GT+E  +  V  +          + 
Sbjct: 123 YQGR------YTNWREV--GGPNSRIVVIQRESNSGTQESFKTLVTGK---------AVP 165

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
            M +   Q  + A  S                   R+       GF+G+ F  ++   ++
Sbjct: 166 IMPRAESQASNGAVKS-------------------RVSTTPSAIGFIGMGFLDSS---VR 203

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
            VP+DG+ PS+ +I SG Y +SR L FY   Q   S+
Sbjct: 204 AVPVDGVKPSVASIRSGTYKLSRKLYFYTSGQPTGSI 240


>gi|116753720|ref|YP_842838.1| phosphate binding protein [Methanosaeta thermophila PT]
 gi|116665171|gb|ABK14198.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanosaeta thermophila PT]
          Length = 281

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 128/288 (44%), Gaps = 50/288 (17%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
           +RIR++GS+T+ P +++ AE F+  + E+    V +GGS VG+ +   G      DI  S
Sbjct: 30  DRIRVSGSTTVMPLAELCAEEFNFMYREYMV-TVTAGGSGVGIIDAAEG----RADIAMS 84

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR+I  +E    ++      +E+ +G+D I++V    + + S+      ++L +  +   
Sbjct: 85  SREIKPSERALYERPD-RKFKEILVGYDAIIVVVSPQIYNSSV------RSLTATEV--K 135

Query: 146 KVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
           K+    ++ W  +  PD                 RE++         V  +  S  RD F
Sbjct: 136 KIYSGEIRNWKSVGGPD-----------------REIM--------VVGRKAGSGTRDTF 170

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                ++ +   +    G++IE   D +E    I  +    G++G S+ +    V+ L  
Sbjct: 171 ----NEIIMGSAAAETPGVSIEAL-DSSEVKTAILGSDRAIGYLGYSYVRTGG-VVPLA- 223

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           +DG+ P+M  I  G Y ++R L FY          G + ++ F +  E
Sbjct: 224 LDGVYPTMDNIRGGNYTLARKLYFYT---FGEPTAGAKAFIDFVLGPE 268


>gi|172056897|ref|YP_001813357.1| phosphate binding protein [Exiguobacterium sibiricum 255-15]
 gi|171989418|gb|ACB60340.1| phosphate binding protein [Exiguobacterium sibiricum 255-15]
          Length = 314

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 76/323 (23%), Positives = 143/323 (44%), Gaps = 57/323 (17%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           +I I GSST+FP  + + E +S   P+     V   G+  G K F  G      D+ N+S
Sbjct: 39  KIAIDGSSTVFPIMEAVGEEYSIEQPDVDV-TVGVSGTGGGFKRFVVG----ETDLSNAS 93

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDD 145
           R+I + E  E +K+ + +  ++ + +DG+ +   ++   V  +T++ L           +
Sbjct: 94  REIKEEEAAEAEKNSI-EYTKLALAYDGLTVAISKENTWVKEMTLDQL-----------E 141

Query: 146 KVVFNP-LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
           K+  +P +K W ++   +P   I  + P    GT +   +KVL++           +DM 
Sbjct: 142 KIWLDPNVKTWKDVDSSYPAEPIKFFSPGKDSGTFDFFSEKVLEK-----------KDM- 189

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                         R+D   +++  D    +  +E  K   G+ G ++Y  N D LK VP
Sbjct: 190 --------------RKD---VQLSEDDNVLVKGVEGTKGAIGYFGYAYYAENKDKLKEVP 232

Query: 265 I-----DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           +     + + P+  TI    YP+SR +  YV  +       + ++V F  ++E     S+
Sbjct: 233 LSAEGKNAVDPTPETIQDLSYPLSREIYTYVNNKSLKDKKQVADFVKF--TNENAGDLSE 290

Query: 320 LFQYGLIPIS--NEERKSVRDSI 340
              Y  +P    +E  K++ D++
Sbjct: 291 EVGYIKMPQDRYDENTKAIEDAM 313


>gi|302390899|ref|YP_003826719.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Acetohalobium arabaticum DSM 5501]
 gi|302202976|gb|ADL11654.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Acetohalobium arabaticum DSM 5501]
          Length = 274

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 68/288 (23%), Positives = 121/288 (42%), Gaps = 52/288 (18%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           R   ++ +  +V  +  G  + A + + + GSST+ P ++  AE + +  P      V  
Sbjct: 5   RNLVILSVLLMVCMMSVGVAS-ASDTLSVQGSSTVLPIAQRAAEVYMDQNPGVNIT-VRG 62

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
           GGS  G+        D  +D+ ++SR I   EL + + +G+  +    +  DGI  V   
Sbjct: 63  GGSGNGIAALV----DGAVDVADASRFIKPGELKQAEDNGIYPVPH-RVAMDGIAAVVHP 117

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
                 LT++++ KA+ +  I +          W E+  +  + RI +       GT EV
Sbjct: 118 SNSVDELTLDEI-KAIYTGEITN----------WKELGGN--DERIVVVSRDSSSGTFEV 164

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
             +  L+   V               +Q  + A  SV  D                   N
Sbjct: 165 FGEIALEGERVTPSAL----------MQASNGAVASVVAD-------------------N 195

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFY 289
           ++  G+VGL +  +N   LK V ++G+ P+  T+ SG +PI+RPL  +
Sbjct: 196 ENAIGYVGLGYLSDN---LKAVKVNGVKPTNATVASGKFPIARPLFMF 240


>gi|288573456|ref|ZP_06391813.1| phosphate binding protein [Dethiosulfovibrio peptidovorans DSM
           11002]
 gi|288569197|gb|EFC90754.1| phosphate binding protein [Dethiosulfovibrio peptidovorans DSM
           11002]
          Length = 269

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/299 (23%), Positives = 120/299 (40%), Gaps = 57/299 (19%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKI 89
           I GS+T+ P ++  AE F E   +     V  GGS  G+K       D T D+ N+SR I
Sbjct: 27  IKGSTTVLPIAQSAAEKFMESNSDVAIT-VSGGGSGNGIKAII----DGTTDVANASRFI 81

Query: 90  TQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVF 149
              E+    ++G   +    +  D ++ V         L++E L            K+  
Sbjct: 82  KNKEVKAAVENGTYPV-PFAVAMDALIPVVHPSNQIKDLSIEQL-----------KKIYK 129

Query: 150 NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQ 209
             +  W E+     + RIA+       GT EV E K++ +                    
Sbjct: 130 GEITNWKEVGGS--DARIAVVGRDTSSGTYEVWESKIMNK-------------------- 167

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV 269
                   V Q  + +  +G   +T+A+   NK   G++GL +   + + L +  ++G V
Sbjct: 168 ------DRVTQRALVVASNGAMVQTVAK---NKLAIGYIGLGYLDKSVNALTVGGVEGTV 218

Query: 270 PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPI 328
            S   ++ G YP+SR L  + K       L   ++++F +SD   A    +   G IP+
Sbjct: 219 KS---VLDGDYPVSRYLYMFTKGWPTGDTL---KFINFVLSD---AGQEIVGNTGYIPL 268


>gi|317061729|ref|ZP_07926214.1| phosphate ABC transporter [Fusobacterium sp. D12]
 gi|313687405|gb|EFS24240.1| phosphate ABC transporter [Fusobacterium sp. D12]
          Length = 276

 Score = 64.3 bits (155), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 137/326 (42%), Gaps = 61/326 (18%)

Query: 8   LMCFVVLEVYCGTGTFAR-NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           ++C   L +  G+  +A+ N +++ GS TL   S+ I E   +Y  E KT    S     
Sbjct: 6   ILCLFSLMIGLGSSLYAKSNVLQLKGSDTLLHVSQAITE---QYQKETKTRIAIS---GG 59

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G       + + T DI  SSR I   E +  K  G+  I+E  +G DGI ++ ++     
Sbjct: 60  GSGIGISALLNGTTDIAMSSRSIKAKERELAKAKGM-KIKETVLGFDGITVIVNKG---- 114

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR-PDFPEVRIAIYVPSGKHGTREVLEKK 185
                +  K + + L+   KV    +K W E+   D P   I +       GT E  ++ 
Sbjct: 115 -----NHIKNMNTRLLA--KVFRGEIKNWKELGGQDAP---IVVLSRDSSSGTHEFFKEH 164

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACT-SVRQDGIAIEVDGDYTETLARIEVNKDV 244
           +++EG  + R         +Y  + L +    +++Q+                +  NK+ 
Sbjct: 165 IIREGNSKGRQ--------EYGKKTLYLPSNEAIKQE----------------VAKNKNA 200

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G++G+ +   +   L+   IDG   S   +++  YPISR + +Y  +    +   L +Y
Sbjct: 201 IGYIGMGYVDPSVHSLE---IDGKTASAENVLNKSYPISREIYWYSNQNLSENGKSLIQY 257

Query: 305 VSFSVSDEMMAPDSQ--LFQYGLIPI 328
                    ++P  Q  + Q G +PI
Sbjct: 258 A--------LSPKGQQIIKQEGFVPI 275


>gi|304440643|ref|ZP_07400527.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304370830|gb|EFM24452.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 303

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 86/347 (24%), Positives = 136/347 (39%), Gaps = 77/347 (22%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNR---------------------IRIAGSSTLFPYSKII 43
            V+++ F +L V CG  T  +N                      I  +GSS L P ++  
Sbjct: 8   LVIVLAFALL-VACGKDTAKKNSTNEKTNTNTKTEEKSDKLEGSITASGSSALLPLAQDA 66

Query: 44  AENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS 103
           A+ F E  P      V  GGS  GLK+   G    ++DI  SS    +++LD  K   + 
Sbjct: 67  ADKFKEVEPNISIT-VNGGGSGTGLKQVFDG----SVDI-GSSDVFAEDKLDAEKAKELV 120

Query: 104 DIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFP 163
           D +   +    I+   + D   +   V DL K          K+    +K WSE+    P
Sbjct: 121 DHKVCVVTMAAIV---NND---IGEKVNDLTKDQLK------KIFTGEIKNWSEVGG--P 166

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
           + +I +       GTR +  +  L     +  ++                          
Sbjct: 167 DEKILLVTRPDSSGTRALFTEYALDGDKTQGESY-------------------------- 200

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPIS 283
            +E D +  E L  I+ NK   G+V L +  NN+DV   V IDG+ PS+ T   G YP+ 
Sbjct: 201 -LETD-NSGELLETIKSNKGAIGYVALPYIINNSDVTP-VAIDGVKPSLETTYDGSYPVW 257

Query: 284 RPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISN 330
                Y K +  N V  ++ ++ + +SDE     S + + G    SN
Sbjct: 258 GYEHMYTKGEP-NEV--VKAFIDYIMSDEYA---SHIEEQGYGATSN 298


>gi|257464208|ref|ZP_05628588.1| phosphate ABC transporter phosphate-binding protein [Fusobacterium
           sp. D12]
          Length = 279

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 76/326 (23%), Positives = 137/326 (42%), Gaps = 61/326 (18%)

Query: 8   LMCFVVLEVYCGTGTFAR-NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           ++C   L +  G+  +A+ N +++ GS TL   S+ I E   +Y  E KT    S     
Sbjct: 9   ILCLFSLMIGLGSSLYAKSNVLQLKGSDTLLHVSQAITE---QYQKETKTRIAIS---GG 62

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G       + + T DI  SSR I   E +  K  G+  I+E  +G DGI ++ ++     
Sbjct: 63  GSGIGISALLNGTTDIAMSSRSIKAKERELAKAKGM-KIKETVLGFDGITVIVNKG---- 117

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR-PDFPEVRIAIYVPSGKHGTREVLEKK 185
                +  K + + L+   KV    +K W E+   D P   I +       GT E  ++ 
Sbjct: 118 -----NHIKNMNTRLLA--KVFRGEIKNWKELGGQDAP---IVVLSRDSSSGTHEFFKEH 167

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACT-SVRQDGIAIEVDGDYTETLARIEVNKDV 244
           +++EG  + R         +Y  + L +    +++Q+                +  NK+ 
Sbjct: 168 IIREGNSKGRQ--------EYGKKTLYLPSNEAIKQE----------------VAKNKNA 203

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G++G+ +   +   L+   IDG   S   +++  YPISR + +Y  +    +   L +Y
Sbjct: 204 IGYIGMGYVDPSVHSLE---IDGKTASAENVLNKSYPISREIYWYSNQNLSENGKSLIQY 260

Query: 305 VSFSVSDEMMAPDSQ--LFQYGLIPI 328
                    ++P  Q  + Q G +PI
Sbjct: 261 A--------LSPKGQQIIKQEGFVPI 278


>gi|145219804|ref|YP_001130513.1| phosphate binding protein [Prosthecochloris vibrioformis DSM 265]
 gi|145205968|gb|ABP37011.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chlorobium phaeovibrioides DSM 265]
          Length = 268

 Score = 63.9 bits (154), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 108/269 (40%), Gaps = 57/269 (21%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPE-FKTPF-VESGGSSVGLKEFCRGIGDDTIDIVNS 85
           I I GS+T+ P    IA++F+ YF   +  P  V   GS  G K    G    T DI + 
Sbjct: 25  IAIDGSTTVGP----IAKSFAAYFKNRYAVPVTVSESGSGNGAKGLING----TCDIASM 76

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKA-LASYLIVD 144
           SR +   E+      GV+ +   TI  DGI +V     V  S  V  L +A +AS  I +
Sbjct: 77  SRAMKGREIAAAATKGVNPVAH-TIALDGIAIV-----VHPSNPVAGLTRAQIAS--IYE 128

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            +++      W  +    P  RI +       GT+    + V+ +G   +RN        
Sbjct: 129 GRII-----SWKGV--GGPNARIVVIQRESNSGTQGSFGELVMGKGVQITRN-------- 173

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                                E          R+       GF+G+ F   +   +K++ 
Sbjct: 174 --------------------AETQASNGAVKNRVSSTPGAIGFLGMGFVDRS---VKVIG 210

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
           ++G+ PS+  I +G YP+SRPL  Y   Q
Sbjct: 211 VNGVRPSLSAIRNGSYPVSRPLYMYTNGQ 239


>gi|153939068|ref|YP_001389755.1| phosphate ABC transporter phosphate-binding protein [Clostridium
           botulinum F str. Langeland]
 gi|152934964|gb|ABS40462.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum F str. Langeland]
 gi|295317844|gb|ADF98221.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum F str. 230613]
          Length = 303

 Score = 63.5 bits (153), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 115/309 (37%), Gaps = 66/309 (21%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------RIRIAGSSTLFPYSKIIAENFSEY 50
           +     VL+   +L   CG+   + +          +I   GSSTL P      +     
Sbjct: 5   LSVMLSVLLTSALLFTACGSKQTSNSNEESSKKESGKIMCIGSSTLAPVVSKAGDTLKSK 64

Query: 51  FPEFKT-----P------FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
              +K      P       V SGGS  G+K       + T +    SR+++++E  + K+
Sbjct: 65  HGTWKKMNDKLPDENIELAVSSGGSGAGVKAAL----EKTANFGLISREVSKDEKAKMKE 120

Query: 100 HGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR 159
           +      E+ IG+D + L      V+   ++    K L S  I   K+     K W ++ 
Sbjct: 121 Y-----NEIKIGYDALTL-----SVNPQNSILKNKKGLTSQEI--QKIFSGEAKTWKDVD 168

Query: 160 PDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVR 219
           P  P  +I + V     G  EV  K V+ +                            V 
Sbjct: 169 PSLPANKIVLVVRDAGGGAAEVFRKAVMGD--------------------------KKVS 202

Query: 220 QDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGL 279
           +D +     G  T+   ++  NKD  G+  +     N   L  + +DG+ P+   I SG 
Sbjct: 203 KDAVQAPSMGALTQ---KVIENKDAIGYASVGLVDQNKGKLTPMEVDGVAPTKENITSGK 259

Query: 280 YPISRPLLF 288
           Y I+RPLL 
Sbjct: 260 YKIARPLLL 268


>gi|298528292|ref|ZP_07015696.1| phosphate binding protein [Desulfonatronospira thiodismutans
           ASO3-1]
 gi|298511944|gb|EFI35846.1| phosphate binding protein [Desulfonatronospira thiodismutans
           ASO3-1]
          Length = 271

 Score = 63.5 bits (153), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 75/307 (24%), Positives = 124/307 (40%), Gaps = 60/307 (19%)

Query: 9   MCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGL 68
           +C +   V  G        I+I GS+T+ P S++++E F E  P F   F     S  G 
Sbjct: 15  LCLLAAPVKAG-------EIKINGSTTVLPVSQVVSEAFMEDNPGFN--FSI---SGGGS 62

Query: 69  KEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSL 128
                 + D T DI  +SR I  +E++   ++G+  +  V I +D I+ V   D     L
Sbjct: 63  GNGIAALIDGTTDIAQTSRWIRDSEVERAVENGIYPVPFV-IAYDSIIPVVHPDNPVDEL 121

Query: 129 TVEDLYKALASYLIVDDKVVFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL 187
           ++E+L K            ++N  +  WSE+     +  I I       GT  V   +VL
Sbjct: 122 SLEELRK------------IYNGDITNWSEV--GGTDRDITIISRDSDSGTYVVWSDEVL 167

Query: 188 QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGF 247
           +             D      Q L+        +G  ++           ++ N+   G+
Sbjct: 168 K------------GDRLTPRAQMLA-------SNGAIVQT----------VQDNRHAIGY 198

Query: 248 VGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSF 307
           +GL +     D LK V +DG++P+  T  SG YP+SR L           VL    Y+  
Sbjct: 199 IGLGYL---TDRLKSVKVDGVMPTSTTTASGEYPVSRSLWLITNNWPSGDVLRFINYIQH 255

Query: 308 SVSDEMM 314
             + E++
Sbjct: 256 PDNAELI 262


>gi|160946307|ref|ZP_02093516.1| hypothetical protein PEPMIC_00267 [Parvimonas micra ATCC 33270]
 gi|158447423|gb|EDP24418.1| hypothetical protein PEPMIC_00267 [Parvimonas micra ATCC 33270]
          Length = 310

 Score = 63.5 bits (153), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 68/277 (24%), Positives = 113/277 (40%), Gaps = 63/277 (22%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFK-----------TPFVESGGSSVGLKEFCRGI 75
           +I  +GSSTL P    IA +F E +  +            T FV SGGS  G+K     +
Sbjct: 47  QISFSGSSTLAPVINKIATDFIEKYTTWDKVDSSLPKENITIFVSSGGSGAGVK----AV 102

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
            D   +    +R I  +E     K  V D++  T+G D + +  + D         ++ K
Sbjct: 103 LDKVANFGMLARDIKDSE-----KEKVKDLESYTLGLDALCICVNPD--------NNILK 149

Query: 136 ALASYLIVDD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVR 193
           A    L  ++  K+     K W ++ P  P+  I +       G  EV +KK++++    
Sbjct: 150 AKNGNLTKEEIIKIFSGEYKTWKQVDPSLPDEEIVVVTRDLGGGAHEVFQKKIMKD---- 205

Query: 194 SRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFY 253
                                   VR+D I     G     +++I  NK+  G+   S+ 
Sbjct: 206 ----------------------VKVREDAIQAPSMGAL---VSKIIENKNAIGYA--SYG 238

Query: 254 KNNADVLKLVP--IDGIVPSMGTIVSGLYPISRPLLF 288
             N +  KL+P  +D + P+   I++  Y ISRPL+ 
Sbjct: 239 ITNQNQGKLIPMKVDNVEPTEENILNNSYYISRPLII 275


>gi|226349695|ref|YP_002776809.1| putative phosphate ABC transporter phosphate-binding protein
           [Rhodococcus opacus B4]
 gi|226245610|dbj|BAH55957.1| putative phosphate ABC transporter phosphate-binding protein
           [Rhodococcus opacus B4]
          Length = 322

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 70/269 (26%), Positives = 110/269 (40%), Gaps = 49/269 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + I GSST+ P S   AE F    P+     V + G+  G ++FC G      DI ++SR
Sbjct: 43  VVIDGSSTVEPLSSAAAELFMGEHPDANV-TVGTSGTGGGFEKFCAG----ETDISDASR 97

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS-LTVEDLYKALASYLIVDDK 146
            I  +E+  C+ + +     + + +D + +V + D      LTV  L K  A    V++ 
Sbjct: 98  PIKDSEIAVCQSNNIQ-YSPLVVANDALSVVVNNDNTWTDCLTVAQLNKIWAPGSTVNN- 155

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                   W+++ P FP+  + ++      GT +   + V         N ++      Y
Sbjct: 156 --------WNQVDPSFPDEPLQLFGAGSDSGTFDYFTQAV---------NGTEGESRTDY 198

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
           N             D I          T+  +   K   G+ G S+ + NAD +K V ID
Sbjct: 199 N---------PTEDDNI----------TVQGVSATKGALGYFGYSYLEANADKVKGVKID 239

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYV 290
                I PS  T   G Y P+SR L  YV
Sbjct: 240 SGGGCIAPSTQTAQDGTYKPLSRELFIYV 268


>gi|254425605|ref|ZP_05039322.1| hypothetical protein S7335_171 [Synechococcus sp. PCC 7335]
 gi|196188028|gb|EDX82993.1| hypothetical protein S7335_171 [Synechococcus sp. PCC 7335]
          Length = 360

 Score = 63.2 bits (152), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 76/300 (25%), Positives = 127/300 (42%), Gaps = 60/300 (20%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENF-SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           R  + IAGS  + P  + +AE F  E F    T  VE      G   FC+   +   DIV
Sbjct: 86  RGDLIIAGSDAMAPLVEAVAERFIDEGFSGDLT--VERISFEEGFSVFCK---EGKADIV 140

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV--SDRDMVSVSLTVEDLYKALASYL 141
             SR I  +E  +C       +  + +G D + +V  +D D ++V +T  +L + L +  
Sbjct: 141 IVSRAIGASERQDCAAINRRPVA-LAVGSDALAIVVGTDNDFLTV-ITQAELAQILTAQF 198

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQ---EGCVRSRNFS 198
                        WS++RP++PE  I   +P       ++   KV     E  ++S N  
Sbjct: 199 -------------WSDVRPEWPERTIRRTLPDPDSSALQLFVNKVFDGDLEPLLKSSN-- 243

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
              D F  +            +D +A        ++LA   V+ D   F+  ++Y+ N D
Sbjct: 244 --SDFFSED------------EDFLA--------QSLA---VDPDAIAFISYTYYETNRD 278

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS--DEMMAP 316
            L+LV I+G  P+ G      YP  + L  YV      S   +  +++F ++  +E M+P
Sbjct: 279 QLRLVSINGNSPTRGD-----YPFIQTLFLYVDANTLRSSSPVSIFLNFFLTHVNEQMSP 333


>gi|168177729|ref|ZP_02612393.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum NCTC 2916]
 gi|182670368|gb|EDT82342.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum NCTC 2916]
          Length = 303

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 115/309 (37%), Gaps = 66/309 (21%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------RIRIAGSSTLFPYSKIIAENFSEY 50
           +     VL+   +L   CG+   + +          +I   GSSTL P      +     
Sbjct: 5   LSVMLSVLLTSALLFTACGSKQTSNSNEESSKKESGKIMCIGSSTLAPVVSKAGDTLKSK 64

Query: 51  FPEFKT-----P------FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
              +K      P       V SGGS  G+K       + T +    SR+++++E  + K+
Sbjct: 65  HGTWKKMNDKLPDENIELAVSSGGSGAGVKAAL----EKTANFGLISREVSKDEKAKMKE 120

Query: 100 HGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR 159
           +      E+ IG+D + L      V+    +    K L S  I   K+     K W ++ 
Sbjct: 121 Y-----NEIKIGYDALTL-----SVNPQNPILKNKKGLTSEEI--QKIFSGEAKTWKDVD 168

Query: 160 PDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVR 219
           P  P  +I + V     G  EV +K V+ +                            V 
Sbjct: 169 PSLPANKIVLVVRDAGGGAAEVFQKAVMGD--------------------------KKVS 202

Query: 220 QDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGL 279
           +D +     G  T+   ++  NKD  G+  +     N   L  + +DG+ P+   I SG 
Sbjct: 203 KDAVQAPSMGALTQ---KVIENKDAIGYASVGLVDQNKGKLTPMEVDGVAPTKENITSGK 259

Query: 280 YPISRPLLF 288
           Y I+RPLL 
Sbjct: 260 YKIARPLLL 268


>gi|148378387|ref|YP_001252928.1| ABC transporter, solute-binding protein [Clostridium botulinum A
           str. ATCC 3502]
 gi|148287871|emb|CAL81937.1| ABC transporter, solute-binding protein [Clostridium botulinum A
           str. ATCC 3502]
          Length = 303

 Score = 63.2 bits (152), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 115/309 (37%), Gaps = 66/309 (21%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------RIRIAGSSTLFPYSKIIAENFSEY 50
           +     VL+   +L   CG+   + +          +I   GSSTL P      +     
Sbjct: 5   LSVMLSVLLTSALLFTACGSKQTSNSNEESSKKESGKIMCIGSSTLAPVVSKAGDTLKSK 64

Query: 51  FPEFKT-----P------FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
              +K      P       V SGGS  G+K       + T +    SR+++++E  + K+
Sbjct: 65  HGTWKKMNDKLPDENIELAVSSGGSGAGVKAAL----EKTANFGLISREVSKDEKAKMKE 120

Query: 100 HGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR 159
           +      E+ IG+D + L      V+    +    K L S  I   K+     K W ++ 
Sbjct: 121 Y-----NEIKIGYDALTL-----SVNPQNPILKNKKGLTSEEI--QKIFSGEAKTWKDVD 168

Query: 160 PDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVR 219
           P  P  +I + V     G  EV +K V+ +                            V 
Sbjct: 169 PSLPANKIVLVVRDAGGGAAEVFQKAVMGD--------------------------KKVS 202

Query: 220 QDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGL 279
           +D +     G  T+   ++  NKD  G+  +     N   L  + +DG+ P+   I SG 
Sbjct: 203 KDAVQAPSMGALTQ---KVIENKDAIGYASVGLVDQNKGKLTPMEVDGVAPTKENITSGK 259

Query: 280 YPISRPLLF 288
           Y I+RPLL 
Sbjct: 260 YKIARPLLL 268


>gi|115375673|ref|ZP_01462928.1| phosphate-binding protein [Stigmatella aurantiaca DW4/3-1]
 gi|310821162|ref|YP_003953520.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Stigmatella aurantiaca DW4/3-1]
 gi|115367321|gb|EAU66301.1| phosphate-binding protein [Stigmatella aurantiaca DW4/3-1]
 gi|309394234|gb|ADO71693.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           [Stigmatella aurantiaca DW4/3-1]
          Length = 274

 Score = 62.8 bits (151), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 75/324 (23%), Positives = 126/324 (38%), Gaps = 60/324 (18%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           +V     VL +    GT     + + GS T+   ++  AE F +  P  K   V  GGS 
Sbjct: 9   LVAFGLTVLPLTAQAGT-----VTVKGSDTMVILAQRWAEAFMKKNPATKLQ-VTGGGSG 62

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            GL     G    T DI  SSR++ + E ++ ++   +    V++  DG+    +     
Sbjct: 63  TGLAALQNG----TTDIAMSSREMKEAEEEKLRQRYNTPPTSVSVAKDGVTFYVNESNPV 118

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR-PDFPEVRIAIYVPSGKHGTREVLEK 184
            +LT+E L             +       W  +  PD P   I +Y      GT   +++
Sbjct: 119 QALTLEQL-----------KDIYLGDTTSWKAVGGPDAP---IVLYSRENSSGTYAFVKE 164

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
           KVL              D +  N Q L    T+   + +A E +G               
Sbjct: 165 KVLD------------GDDYASNAQTLP--GTAAVANAVAKEKNG--------------- 195

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G+ G ++ K   ++      D   P+   + SG YP+SR L FY++ +        + +
Sbjct: 196 IGYGGAAYAKGIKELKVKKDNDAFAPTAENVKSGKYPLSRDLFFYLRNKPSGET---KAF 252

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPI 328
           + F++S E  A  SQ+   G  P+
Sbjct: 253 IDFALSPEGQAIVSQV---GYFPV 273


>gi|308234016|ref|ZP_07664753.1| phosphate transport system substrate-binding protein [Atopobium
           vaginae DSM 15829]
 gi|328944485|ref|ZP_08241947.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Atopobium vaginae DSM 15829]
 gi|327491069|gb|EGF22846.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Atopobium vaginae DSM 15829]
          Length = 297

 Score = 62.4 bits (150), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 70/306 (22%), Positives = 126/306 (41%), Gaps = 67/306 (21%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           +  I +AGS+++    + ++E F E +P  +   VE  GSS G++    G+     +I N
Sbjct: 45  QGSISLAGSTSMEKMCEALSEGFMETYPNVRVS-VEYTGSSAGIESLTSGL----CNIAN 99

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR+++Q E    K  G+  +  V +  DGI ++ ++     S+T   L           
Sbjct: 100 SSRELSQAE----KSSGI--VGNV-VALDGIAVIVNKANTCTSITKSQL----------- 141

Query: 145 DKVVFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV-LQEGCVRSRNFSKMRD 202
            K +F   +  WS++     +  I +       GTR   E+ V ++  CV ++       
Sbjct: 142 -KQIFTRSITSWSDV--GGADAAIVVIGRENASGTRSAFEELVDVKNSCVYAQ------- 191

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                  E+D      LA++       G++ L    ++ + L L
Sbjct: 192 -----------------------ELD-STGAVLAKVASTPGAIGYISLDALSDSVNALVL 227

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
              DG+ P+  TI S  YP+ RP +   K         ++ + S+  SDE +    Q+ Q
Sbjct: 228 ---DGVAPTADTIASQQYPLVRPFIMATKGAVSEQSALVQAWFSYIESDEGI----QIIQ 280

Query: 323 -YGLIP 327
             G++P
Sbjct: 281 RAGVMP 286


>gi|82617414|emb|CAI64325.1| phosphate ABC transporter, phosphate-binding protein [uncultured
           archaeon]
          Length = 298

 Score = 62.4 bits (150), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 78/304 (25%), Positives = 125/304 (41%), Gaps = 72/304 (23%)

Query: 1   MRFFFVVLMCFVVLEVYCGTG-------------TFARNRIRIAGSSTLFPYSKIIAENF 47
           +R   ++LM  V+     G+G             T A  +++IAGS+T+ P ++  A  F
Sbjct: 16  VRMNMILLMLAVISLSLFGSGCIDNTNNGAETHDTLADIKLQIAGSTTVLPVAEECARVF 75

Query: 48  SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELD---ECKKHGVSD 104
            E  P  +  FV  GGSS G+K     + D T+DI  +SR +   E D   +   HGV+ 
Sbjct: 76  MENHPGSRI-FVSGGGSSHGVK----AVADGTVDIGTASRDLKSTEKDAHPDLVAHGVA- 129

Query: 105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPE 164
                   DG+ +          LT+E L             +    +  W ++     E
Sbjct: 130 -------KDGVAVTVHPSNPVTDLTMEQLQG-----------IYTGTITNWKDVGGTDSE 171

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
           + +          TRE        EG       S  RD F+  V +   A   +   GI 
Sbjct: 172 IMVV---------TRE--------EG-------SGTRDCFEQAVMKPIKA--EITDHGII 205

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISR 284
            + +G   +T A +  +    GF+ L +   N+DV + V +DGI P++ +++ G Y ISR
Sbjct: 206 QDSNG---KTRATVAGSDQAIGFLSLGYV--NSDV-RAVRLDGIEPTVESVIDGSYAISR 259

Query: 285 PLLF 288
            L  
Sbjct: 260 TLWM 263


>gi|116754775|ref|YP_843893.1| phosphate binding protein [Methanosaeta thermophila PT]
 gi|116666226|gb|ABK15253.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanosaeta thermophila PT]
          Length = 274

 Score = 62.4 bits (150), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 114/268 (42%), Gaps = 55/268 (20%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +R++GS+T+ P + + AE+F+    E++        +  G       +G+   DI  +SR
Sbjct: 25  VRVSGSTTVMPLASVCAESFNSEQSEYRVTV-----TGGGTGVGIADLGEGRSDIAMASR 79

Query: 88  KITQNELDECKKHGVSD--IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           +IT+ E     K+  +D    E+ + +DGI+       V+VS     +Y A    L  + 
Sbjct: 80  EITETER---SKYETADRKFNEILVAYDGIV-------VAVS---PQIYDAGVRELTKEQ 126

Query: 146 --KVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
             K+    +  W E+  PD                 R++          +  R  S  RD
Sbjct: 127 VRKIYAGEISNWKEVGGPD-----------------RQIY--------AIARRAGSGTRD 161

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
            F     ++ +        G+A E   D +E    I+ +    G++G S+  +    +K 
Sbjct: 162 TF----NEIIMGSKEAETPGVATEA-ADNSEVKTAIKGSDKAIGYLGYSYATDG--TVKG 214

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYV 290
           V +DG+ P+M  I SG YP++R L FY 
Sbjct: 215 VALDGVYPTMENIKSGEYPLARKLYFYT 242


>gi|170757827|ref|YP_001780039.1| phosphate ABC transporter phosphate-binding protein [Clostridium
           botulinum B1 str. Okra]
 gi|169123039|gb|ACA46875.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum B1 str. Okra]
          Length = 303

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 71/309 (22%), Positives = 114/309 (36%), Gaps = 66/309 (21%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------RIRIAGSSTLFPYSKIIAENFSEY 50
           +     VL+   +L   CG    + +          +I   GSSTL P      +     
Sbjct: 5   LSVVLSVLLTSALLFTACGGKQTSNSNEESSKKESGKIMCIGSSTLAPVVSKAGDTLKSK 64

Query: 51  FPEFKT-----P------FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
              +K      P       V SGGS  G+K       + T +    SR+++++E  + K+
Sbjct: 65  HGTWKKMNDKLPDENIELAVSSGGSGAGVKAAL----EKTANFGLISREVSKDEKAKMKE 120

Query: 100 HGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR 159
           +      E+ IG+D + L      V+    +    K L S  I   K+     K W ++ 
Sbjct: 121 Y-----NEIKIGYDALTL-----SVNPQNPILKNKKGLTSEEI--QKIFSGEAKTWKDVD 168

Query: 160 PDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVR 219
           P  P  +I + V     G  EV +K V+ +                            V 
Sbjct: 169 PSLPANKIVLVVRDAGGGAAEVFQKAVMGD--------------------------KKVS 202

Query: 220 QDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGL 279
           +D +     G  T+   ++  NKD  G+  +     N   L  + +DGI P+   I SG 
Sbjct: 203 KDAVQAPSMGALTQ---KVIENKDAIGYASVGLVDQNKGKLTPMEVDGIAPTKENITSGK 259

Query: 280 YPISRPLLF 288
           Y I+RPLL 
Sbjct: 260 YKIARPLLL 268


>gi|310779965|ref|YP_003968297.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Ilyobacter polytropus DSM 2926]
 gi|309749288|gb|ADO83949.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Ilyobacter polytropus DSM 2926]
          Length = 277

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 67/315 (21%), Positives = 127/315 (40%), Gaps = 57/315 (18%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           V CG        ++I GS T    ++ ++E + E   + +   V  GGS VG+     G 
Sbjct: 15  VACGQDKVKSEVVQITGSDTCLNVTQQLSETYMESHEDARIA-VTGGGSGVGIAAAING- 72

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
              T DI  +SR   + EL   +  G   ++EV  G DG+ +++        L+ E    
Sbjct: 73  ---TTDIAMASRNAKEKELKSAEDAG-RLLEEVVFGWDGLSVITHPSNPVNVLSKE---- 124

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS- 194
                  V  K+    +K W EI     + +I +       GT    ++ V++ G  +S 
Sbjct: 125 -------VIGKIFSGEIKNWKEI--GGKDAKIILLSRDSSSGTHVYFKEDVVRGGDKKSN 175

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
           + ++        N   +  A T                        N++  G+VG+++  
Sbjct: 176 KEYADETLFLPSNTAIVQEAAT------------------------NENSIGYVGMAYMD 211

Query: 255 NNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
              + +K + ++G+ P++  + S  YPI+R L +YV  +    +  + E+V        +
Sbjct: 212 ---ETVKAISVNGVEPTVENVASKQYPIARELFWYVPAERSQVISNIVEFV--------L 260

Query: 315 APDSQ--LFQYGLIP 327
           +P+ Q  +   G +P
Sbjct: 261 SPEGQAIVADEGFVP 275


>gi|189500172|ref|YP_001959642.1| phosphate binding protein [Chlorobium phaeobacteroides BS1]
 gi|189495613|gb|ACE04161.1| phosphate binding protein [Chlorobium phaeobacteroides BS1]
          Length = 271

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 65/296 (21%), Positives = 112/296 (37%), Gaps = 63/296 (21%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPE---FKTPFVESG 62
           V + CF         G      I + GS+T+ P    IA++F+ YF +    +    ESG
Sbjct: 11  VAVCCF------AAAGPAQAETIVMDGSTTVGP----IAKSFAAYFTKNTGVQVSVSESG 60

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
            S  G K    G      DI N SR +   E D  K  G++ ++ + +  DG+ +V    
Sbjct: 61  -SGNGAKSLING----ACDIANMSRPMKSKEADAAKAKGINAVEHI-VALDGLSVVVHPS 114

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
               +L +E +             +    +  WS++    P  +I +       GT++  
Sbjct: 115 NYVTALKIEQIRD-----------IYVGKVTNWSKV--GGPNAKIVVIQRESNSGTQDSF 161

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            K V+ +G   ++                              E         +R+    
Sbjct: 162 RKLVVGKGNPVTKR----------------------------AETQASNGAVKSRVASTP 193

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
              GF+GL F  N+   +K + ++G+ PS  T+  G YP++RPL  Y   +   +V
Sbjct: 194 AAIGFIGLGFLDNS---VKPLIVNGVAPSEETVKDGSYPVARPLFMYTDGEPTGNV 246


>gi|289582016|ref|YP_003480482.1| ABC transporter periplasmic phosphate-binding protein [Natrialba
           magadii ATCC 43099]
 gi|289531569|gb|ADD05920.1| ABC transporter periplasmic phosphate-binding protein [Natrialba
           magadii ATCC 43099]
          Length = 342

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 61/273 (22%), Positives = 115/273 (42%), Gaps = 48/273 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+ +GS+T+ P ++I AE+F   +       VE  G+  G +EFCR          ++SR
Sbjct: 44  IQASGSNTVAPITQIAAEDFEAEYSGVGVN-VEPEGTGAGFQEFCRA----NSAFQSASR 98

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILL-VSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           +IT+ E+D C ++ V +    T+G D + + V++ +     +T+++L +           
Sbjct: 99  EITEEEIDLCGENDV-EYTHYTVGQDTLAVGVNEDNDWCEQITLDELNQIWE-------- 149

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
              + +++WS++R ++P+  IA++      GT                         F Y
Sbjct: 150 -FESDVQQWSDVRDEWPDEDIALHARDSASGT-------------------------FDY 183

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             + ++    ++R D  A     +  + +A  E      G   L   +     LK V ++
Sbjct: 184 FTENINGEMGNIRDDYSATSQTDEIWDAVADNEYALGWGGVGHLRSLQEQDGTLKTVAVE 243

Query: 267 GIV------PSMGTIVSGLY-PISRPLLFYVKR 292
             +      P    I  G Y P++RPL FY   
Sbjct: 244 SELDGDFYPPEEQYIEGGEYSPLARPLFFYFNH 276


>gi|312898758|ref|ZP_07758147.1| phosphate binding protein [Megasphaera micronuciformis F0359]
 gi|310620189|gb|EFQ03760.1| phosphate binding protein [Megasphaera micronuciformis F0359]
          Length = 296

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 72/302 (23%), Positives = 117/302 (38%), Gaps = 60/302 (19%)

Query: 2   RFFFVV-LMCFVVLEVYCGTG-TFARNRIRIA--GSSTLFPYSKIIAENFSEYFPEFKT- 56
           RF  V+ L   +V    CG G   A+ +  I   GSSTL P        F+E + ++   
Sbjct: 5   RFLAVLALGASLVFTAACGNGGNTAKEKTDITFFGSSTLAPVVTKAGTAFTEQYGKWNKV 64

Query: 57  ----P------FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
               P       V SGGS  G+K       D T D    +R++  +E ++ K +     Q
Sbjct: 65  NSSLPDADIVINVTSGGSGAGIKALL----DGTADFGLVAREVKSSEKEKIKNY-----Q 115

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
           E  +G D + +      V+ +  +  +   L S  I   K+     K W+E+ P  P   
Sbjct: 116 EYKVGIDALTIA-----VNPNNPIAKIKDNLTSDQI--KKIFSGEYKTWNEVDPSLPATE 168

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           I +       G  EV ++K++ +  V  +            +Q  S+             
Sbjct: 169 IVVVTRDLGGGAHEVFQEKIMGDTKVTDK-----------AIQAPSMGA----------- 206

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPL 286
                   +A+I  N++  G+      K N   +  + +DG+  +  TIV G Y I RPL
Sbjct: 207 -------LVAKIIENENAVGYASYGVAKQNEGKIFALKVDGVAATPETIVDGSYKIQRPL 259

Query: 287 LF 288
           L 
Sbjct: 260 LI 261


>gi|310779964|ref|YP_003968296.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Ilyobacter polytropus DSM 2926]
 gi|309749287|gb|ADO83948.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Ilyobacter polytropus DSM 2926]
          Length = 287

 Score = 62.0 bits (149), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 68/301 (22%), Positives = 125/301 (41%), Gaps = 53/301 (17%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +++ GS T    ++ I E + +   + +   V  GGS VG+     G    T DI  +SR
Sbjct: 37  VQVVGSDTCLNVTQHITETYMKGHKDARIA-VTGGGSGVGIAAAING----TTDIAMASR 91

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
               +E+ + + +G   ++EV  G DGI ++ +++     L+ E           V  K+
Sbjct: 92  SAKSSEMGKAEANG-KKLEEVVFGWDGIGVIVNKNNPINVLSKE-----------VIGKI 139

Query: 148 VFNPLKKWSEIR-PDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
               +  W E+   D P   I I       GT    +K V++ G  +S+         +Y
Sbjct: 140 FEGKITNWKEVGGKDAP---IVILSRDSSSGTHSYFKKDVVRGGDKKSKK--------EY 188

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
           +   L +   S                 +     N++  G+VG+ +     D  K + ++
Sbjct: 189 SETSLFLPSNSA---------------IVQETASNENAIGYVGMGYLD---DTTKALGVN 230

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLI 326
           GI P++  + S  YPI+R L +YV  +    +  +   V F++S E     S + + G +
Sbjct: 231 GIEPTVANVSSKAYPIARELFWYVPAERSQVITNI---VKFALSSE---GQSIVAKEGFV 284

Query: 327 P 327
           P
Sbjct: 285 P 285


>gi|301059407|ref|ZP_07200329.1| phosphate binding protein [delta proteobacterium NaphS2]
 gi|300446488|gb|EFK10331.1| phosphate binding protein [delta proteobacterium NaphS2]
          Length = 272

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 73/312 (23%), Positives = 132/312 (42%), Gaps = 55/312 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   + ++ F+   ++  +  +A   I I GS+T+ P ++  AE + +     + P V+
Sbjct: 1   MKIKGIAVLAFIAATLFAASMVWA-GSIVIKGSTTVLPIAQKTAEVYMK-----QNPDVK 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
              S  G     + + D + DI +SSR I   E+    + GV  +    + +D I+ V  
Sbjct: 55  ISISGGGSGNGMKALIDGSTDIADSSRFIKGKEVSLAVEKGVYPV-PFAVAYDCIVPVVH 113

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                V++T+  L             +    +K W +I  D P+  + +       GT E
Sbjct: 114 PSNPIVNITMAQL-----------KDIYMGKVKNWKDI--DGPDQPVVVISRDTSSGTYE 160

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V  KKV+           K   +F   + Q S               +G  ++ +A+   
Sbjct: 161 VWNKKVM-----------KKERVFPGALLQAS---------------NGAVSQAVAK--- 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G++GL +   N DV  L+ ++ I  S  T ++G YPISRPL  +        VL 
Sbjct: 192 NKNAIGYIGLGYV--NKDVKGLM-VNRIAGSAETTLNGTYPISRPLFMFTPGWPKGDVL- 247

Query: 301 LREYVSFSVSDE 312
              +++F ++ E
Sbjct: 248 --NFINFVINPE 257


>gi|291532220|emb|CBL05333.1| phosphate ABC transporter substrate-binding protein, PhoT family
           (TC 3.A.1.7.1) [Megamonas hypermegale ART12/1]
          Length = 294

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 69/277 (24%), Positives = 111/277 (40%), Gaps = 52/277 (18%)

Query: 36  LFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELD 95
           L P +K  A+ F E  PE        GGS  GLK+    + D ++DI NS       +LD
Sbjct: 50  LLPLAKDAADKFKELHPEVSITL-NGGGSGTGLKQ----VADGSVDIGNSDVA-ADTKLD 103

Query: 96  ECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW 155
           +    G+ D +   +    +  V ++D+ +         K+L    + D  +    +  W
Sbjct: 104 KAVADGLVDHKVCVVT---MAPVVNKDIAAT-------VKSLTKQQLTD--IFTAKITNW 151

Query: 156 SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVAC 215
            E+    P+  I +       GTR + ++  L  G   + N S                 
Sbjct: 152 KEVGG--PDEEIVLITRPSTSGTRALFKEFALG-GAEEASNKS----------------- 191

Query: 216 TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTI 275
                    +E D D    L  I+ NK   G+V LS+  NN DV   V +DG+ P++   
Sbjct: 192 ---------LETD-DSGTLLQSIKDNKGAIGYVALSYLVNNQDV-ATVSVDGVAPTLENT 240

Query: 276 VSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
            +G YP+      Y K +   +V   + Y+ F +SDE
Sbjct: 241 YNGTYPVWGYEHMYTKGEPNATV---KAYLDFIMSDE 274


>gi|294055784|ref|YP_003549442.1| phosphate binding protein [Coraliomargarita akajimensis DSM 45221]
 gi|293615117|gb|ADE55272.1| phosphate binding protein [Coraliomargarita akajimensis DSM 45221]
          Length = 271

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 81/309 (26%), Positives = 128/309 (41%), Gaps = 65/309 (21%)

Query: 9   MCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE----SGGS 64
           + F        T   A   + I GS TL   +K++ +  SE F + K P V     + GS
Sbjct: 9   LLFTAAAFSLATVLNAAETLVIKGSDTLG--AKMVPQ-LSEAF-KAKNPGVAFEIAAEGS 64

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
           S G+        D T  I  SSR   + EL + K  GV D+  +T+  DGI ++ +    
Sbjct: 65  STGVASVI----DATAQIGMSSRDPKEKELAKAKSKGV-DMNAITVAKDGIAIIVNEANP 119

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
              ++VE++       LI    V       WS I        I+ Y  +   GT  V +K
Sbjct: 120 LTEISVEEI------ELIFSGDVT-----DWSGISTQTGS--ISAYTRNTSSGTYAVFQK 166

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
                  + SR++         N Q             IA EV             N + 
Sbjct: 167 L-----GMNSRDYGSETQKMAGNEQ-------------IAAEV-----------AKNPNG 197

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYV-KRQHFNSVLGLRE 303
            G+VGL++   N   +K++P++GI P  GT     YP++RPL + V K +  +S     +
Sbjct: 198 IGYVGLAYI--NTPGVKVLPVNGIAPDAGT-----YPLARPLYYLVDKNKKLSST--AND 248

Query: 304 YVSFSVSDE 312
           +++F++S E
Sbjct: 249 FIAFTLSPE 257


>gi|194336741|ref|YP_002018535.1| phosphate binding protein [Pelodictyon phaeoclathratiforme BU-1]
 gi|194309218|gb|ACF43918.1| phosphate binding protein [Pelodictyon phaeoclathratiforme BU-1]
          Length = 276

 Score = 61.2 bits (147), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 65/273 (23%), Positives = 111/273 (40%), Gaps = 51/273 (18%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
           N I + GS+T+ P +K  A  F++ +    T  V   GS  G K    G    +  I   
Sbjct: 31  NSIVLDGSTTVGPLAKTFASYFTKKYGVRVT--VSESGSGNGAKSLING----SCTIAAM 84

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR +   E+   +  GV+ +  V +  DG+ ++     V  +  V  L KA  S      
Sbjct: 85  SRAMKAAEIAAARTKGVNPVAHV-VALDGLAMI-----VHPANPVRSLSKAQIS------ 132

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +    +  W E+    P  RI +       GT+E  ++ V  +G               
Sbjct: 133 NIYRGTITNWREV--GGPNARIVVIQRESNSGTQESFKELVSGKGV-------------- 176

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
               Q++ +  +   +G             +R+       GFVGL F   +   +K+V +
Sbjct: 177 ----QITGSAETQSSNG----------SVKSRVSTTLSAIGFVGLGFVDRS---VKVVAV 219

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           +G++P++  + +G YP++RPL FY   Q   SV
Sbjct: 220 NGVLPTLSMVKNGTYPVTRPLFFYTNGQPAGSV 252


>gi|303258017|ref|ZP_07344026.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Burkholderiales bacterium 1_1_47]
 gi|302859360|gb|EFL82442.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Burkholderiales bacterium 1_1_47]
          Length = 273

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 129/312 (41%), Gaps = 58/312 (18%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           + + + L+    + V   +   A+  + ++GS+T+ P  + I+E+  +     K P V  
Sbjct: 3   KNYLISLLALSAMTVSASS--MAKENVTVSGSTTVLPVMQKISEHLMQ-----KDPSVVI 55

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
             S  G     + + +    I  SSRKI   E+   ++ GV    E+ +  D I+ + + 
Sbjct: 56  ELSGGGSGSGIKALNEKLTQIAMSSRKIKGKEVKAAEEKGVKPF-EIPVAVDAIVPIVNP 114

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR-PDFPEVRIAIYVPSGKHGTRE 180
                 L+++DL K           +    +K W E+  PD P   I +       GT E
Sbjct: 115 KNTLNGLSLDDLRK-----------IYKGEIKNWKEVGGPDAP---IVLVSRDSSSGTFE 160

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E  V++   V  R                     ++ Q+      +G   +T+++   
Sbjct: 161 SWESLVMKNQRVSPR---------------------ALLQNS-----NGTVVQTVSK--- 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N +  G+VGL +    A ++K V I+GI  +  T   G +P+SR L  Y  RQ   +V  
Sbjct: 192 NPNAIGYVGLGYV---APIIKAVEINGIKATPLTAKEGKWPLSRDLYLYTNRQPQGAV-- 246

Query: 301 LREYVSFSVSDE 312
            ++   F +S+E
Sbjct: 247 -KKVTDFCLSEE 257


>gi|325958235|ref|YP_004289701.1| phosphate binding protein [Methanobacterium sp. AL-21]
 gi|325329667|gb|ADZ08729.1| phosphate binding protein [Methanobacterium sp. AL-21]
          Length = 281

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 133/315 (42%), Gaps = 62/315 (19%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           +++   V++  Y      + +++ + GS+++ P ++ +A  + +  P  K   V+ GG++
Sbjct: 9   IIIALVVIVGAYMVVAPGSGSKVTVVGSTSVQPVAEKLATAYMKEHPNVKIT-VQGGGTA 67

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
           VG+K       D T +I  +S+ ++ N+     ++        T+G DG++ +   +   
Sbjct: 68  VGIKSAQ----DGTANIGTASKALSTNDSQGLTQY--------TLGQDGVVAIVSPNNNL 115

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
             LT +D  K + S  I +          W+++    P+ +I + V     GTR+  +  
Sbjct: 116 TGLT-KDQLKGIFSGNITN----------WNQV--GGPDAKINVIVREEGSGTRDAFQDI 162

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACT-SVRQDGIAIEVDGDYTETLARIEVNKDV 244
           VL     +  N +K+  +    VQ  + A   +V QD  AI                   
Sbjct: 163 VLG----KLSNGTKVSFVSSAIVQSSTQAVQQAVSQDPNAI------------------- 199

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            GF   +   N+    K + I+GI  S  TI  G Y I RP LF VK      V   + +
Sbjct: 200 -GFCSFADLGNDT---KALSINGISASASTIADGTYTIQRPFLFLVKGDAKGEV---KNF 252

Query: 305 VSFSVSDEMMAPDSQ 319
           +     D +M P+ Q
Sbjct: 253 I-----DWVMGPEGQ 262


>gi|313893808|ref|ZP_07827374.1| phosphate binding protein [Veillonella sp. oral taxon 158 str.
           F0412]
 gi|313441372|gb|EFR59798.1| phosphate binding protein [Veillonella sp. oral taxon 158 str.
           F0412]
          Length = 296

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 65/294 (22%), Positives = 116/294 (39%), Gaps = 61/294 (20%)

Query: 12  VVLEVYCGTGTFARN-RIRIAGSSTLFPYSKIIAENFSEYFPEFK-----------TPFV 59
           +++ V CG+   +++ ++   GSSTL P    IA +F+E    +            T +V
Sbjct: 18  MLITVGCGSNQSSQSTQLTYNGSSTLAPVISKIATDFTEKNKTWNHADSALPDKDITIYV 77

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
            SGGS  G+K    G  D           +   E+ + +K  + D  E+ +G D +    
Sbjct: 78  SSGGSGTGIKAVIDGTAD---------FGLVAREVKDSEKAKIKDYNEIKVGIDAL---- 124

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
                ++++  E+   A+   L  ++  K+     K W+++ P  PE  I +       G
Sbjct: 125 -----TIAVNPENPLYAVKDNLTKEEIIKIFSGEYKTWNQVDPSLPEQEIIVVTRDLGGG 179

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
             EV ++K++  G V        +D  +     + V  T V+++  AI            
Sbjct: 180 AHEVFQQKIM--GSVEV-----TKDAIQ--APSMGVLVTKVKENPYAI------------ 218

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVK 291
                   G+        N   +    ++G+ P+  TI  G Y I RPLL   K
Sbjct: 219 --------GYASYGMLGQNKGQIVAFKVNGVAPTDETITDGSYMIQRPLLIVGK 264


>gi|182414361|ref|YP_001819427.1| phosphate binding protein [Opitutus terrae PB90-1]
 gi|177841575|gb|ACB75827.1| phosphate binding protein [Opitutus terrae PB90-1]
          Length = 268

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 75/326 (23%), Positives = 142/326 (43%), Gaps = 69/326 (21%)

Query: 10  CFVVL-EVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE----SGGS 64
            FV+L  V   T  FA+ ++ I GS TL   +K++ +   EY  + + P V     + GS
Sbjct: 4   TFVLLTAVLAATPVFAQ-KLVIKGSDTLG--AKLVPQLAEEY--KARHPGVAFEIAAEGS 58

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
           + G+        D T  I  SSR+    E+   +  GVS ++   + +DGI ++ + +  
Sbjct: 59  TTGIAAII----DGTAQIGMSSRRAKPTEMSAAQAKGVS-MKPTIVAYDGIAVIVNENNP 113

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFPEVRIAIYVPSGKHGTREVL 182
             SL+   +           +++    +  WS +  +P     RI+IY  +   GT    
Sbjct: 114 LSSLSKRQI-----------EQIFTGDVTDWSAVGGQPG----RISIYTRNTSSGT---- 154

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
                         +S  +D+    +++   A +S +  G          +  A +  N 
Sbjct: 155 --------------YSDFKDL---AMKKRDYASSSQKMAG--------NEQIAAEVGRNP 189

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           +  G+VGL++  + A  +K++ IDG  PS  ++++  YP +RP  +Y   +         
Sbjct: 190 NGIGYVGLAY--DQAPGIKVIAIDGATPSKESVLAKKYPYARPTFYYTNGEPSGEAA--- 244

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPI 328
           ++V F++SD+     SQ+   G +P+
Sbjct: 245 KFVEFTLSDDGQRIASQV---GFVPV 267


>gi|325110669|ref|YP_004271737.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Planctomyces brasiliensis DSM 5305]
 gi|324970937|gb|ADY61715.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Planctomyces brasiliensis DSM 5305]
          Length = 289

 Score = 60.8 bits (146), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 71/293 (24%), Positives = 122/293 (41%), Gaps = 68/293 (23%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           ++ + GSST+ P    IA  F E  P  +   V++GG+  G+ +   G+ D    I  +S
Sbjct: 39  KLTLTGSSTIAPLITEIARRFEELHPGLRID-VQTGGTGKGIADTRIGVAD----IGMAS 93

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           R +  +E         S++    I  DG+ L+V D + +   LT E +            
Sbjct: 94  RPLKPDE---------SELTAHQIAADGVGLIVHDSNPIE-GLTGEQVIS---------- 133

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +  N    W+E+  D  E+ + ++   G+  T EV                        
Sbjct: 134 -IYLNQANNWNEVGGDEDEITV-VHKAEGR-ATLEVF----------------------- 167

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV-----L 260
             ++Q S+  T V+ D I     G+    +  +   K+  G+V  S     AD+     +
Sbjct: 168 --LKQFSIDNTKVKADVIV----GENEHAIKTVAGTKNAIGYV--SIGTAEADIQAGVRI 219

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
           +L+P+DGI  S  T+ SG +P+SRPL      +   + L   E++ F  S E+
Sbjct: 220 RLLPLDGIEASTATVSSGEFPMSRPLNLITADEPSQTAL---EFIRFCQSTEV 269


>gi|313891407|ref|ZP_07825023.1| phosphate binding protein [Dialister microaerophilus UPII 345-E]
 gi|313120182|gb|EFR43358.1| phosphate binding protein [Dialister microaerophilus UPII 345-E]
          Length = 287

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 73/311 (23%), Positives = 127/311 (40%), Gaps = 58/311 (18%)

Query: 6   VVLMCFVVLEVYCGTG--TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           V  +   VL   CG+G  T   + +  +GSS L P +K  A  F E  P+  +  + +GG
Sbjct: 11  VAALGISVLLAGCGSGESTQKGSTVTGSGSSALLPLAKKAASAFKEKNPDV-SIILNAGG 69

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S VGLK+   G  D     V++S K++  +  E + H V                    +
Sbjct: 70  SGVGLKQVSEGSVDIGNSDVDASMKLSSEKAKELQDHKVC-------------------I 110

Query: 124 VSVSLTV-EDLYKALASYLIVDDKVVF-NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           V+V+  V +D+Y+ + +      + +F + +K W E+    P+  I +       GTR +
Sbjct: 111 VTVAAVVNKDIYQDVKNITKEQLRDIFTSKIKNWKEVGG--PDEEIVLITRPKTSGTRML 168

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
             K  L +G   + N                 A      +G  IE           +   
Sbjct: 169 FTKYAL-DGTDETAN-----------------ATLETDDNGTLIE----------NVSQT 200

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL 301
           K   G+V L + + N+  + ++ IDG+ P++    +G YP+      Y K +   +V   
Sbjct: 201 KGAIGYVALPYVR-NSKFVNVLAIDGVEPTVENTYNGKYPVWGYEHMYTKGEAKGAV--- 256

Query: 302 REYVSFSVSDE 312
           + Y+ F  S+E
Sbjct: 257 KNYLDFFTSEE 267


>gi|226947617|ref|YP_002802708.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum A2 str. Kyoto]
 gi|226843750|gb|ACO86416.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum A2 str. Kyoto]
          Length = 303

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 70/309 (22%), Positives = 114/309 (36%), Gaps = 66/309 (21%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------RIRIAGSSTLFPYSKIIAENFSEY 50
           +     VL+   +L   CG+   + +          +I   GSSTL P      +     
Sbjct: 5   LSVMLSVLLTSALLFTACGSKQTSNSNEESSKKESGKIMCIGSSTLAPVVSKAGDTLKSK 64

Query: 51  FPEFKT-----P------FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
              +K      P       V SGGS  G+K       + T +    SR+++++E  + K+
Sbjct: 65  HGTWKKMNDKLPDENIELAVSSGGSGAGVKAAL----EKTANFGLISREVSKDEKAKMKE 120

Query: 100 HGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR 159
           +      E+ IG+D + L      V+    +    K L S  I   K+     K W ++ 
Sbjct: 121 Y-----NEIKIGYDALTL-----SVNPQNPILKNKKGLTSQEI--QKIFSGEAKTWKDVD 168

Query: 160 PDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVR 219
              P  +I + V     G  EV +K V+ +                            V 
Sbjct: 169 TSLPANKIVLVVRDAGGGAAEVFQKAVMGD--------------------------KKVS 202

Query: 220 QDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGL 279
           +D +     G  T+   ++  NKD  G+  +     N   L  + +DGI P+   I SG 
Sbjct: 203 KDAVQAPSMGALTQ---KVIENKDAIGYASVGLVDQNKGKLTPMEVDGIAPTKENITSGK 259

Query: 280 YPISRPLLF 288
           Y I+RPLL 
Sbjct: 260 YKIARPLLL 268


>gi|332296829|ref|YP_004438751.1| phosphate binding protein [Treponema brennaborense DSM 12168]
 gi|332179932|gb|AEE15620.1| phosphate binding protein [Treponema brennaborense DSM 12168]
          Length = 289

 Score = 60.5 bits (145), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 68/276 (24%), Positives = 108/276 (39%), Gaps = 60/276 (21%)

Query: 17  YCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIG 76
           Y G+ TF        GS+T+ P +  I E  +   P+ K  + E  GS  GLK+   G  
Sbjct: 39  YSGSYTFG-------GSTTVQPIANGIIEALTAVNPDLKISY-EGVGSGTGLKQLSAG-- 88

Query: 77  DDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKA 136
             T+ +  SSR + Q+ELD         +    I  DGI +V ++D+   +++  DL   
Sbjct: 89  --TLSLAGSSRDLKQSELD-------GGLVPTVIAKDGIAIVVNKDVSVANVSKADLA-- 137

Query: 137 LASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
                    K+    +  W+ +     ++R+                        +    
Sbjct: 138 ---------KIFSGEITNWNSLGGKDEQIRL------------------------INRDE 164

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
            S     FK  V  L  A T   ++ I  + +G   E  A++       G+VGL F    
Sbjct: 165 ASGTYASFKEIV--LDPAKTEFSKNAIVAKENG---EVAAKVASTPGAIGYVGLGFVGEI 219

Query: 257 ADV-LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVK 291
                K + IDGI  S  T+++G YP+SR L    K
Sbjct: 220 TKAGGKSLLIDGIEASSKTVLAGTYPVSRALYVATK 255


>gi|312793342|ref|YP_004026265.1| phosphate binding protein [Caldicellulosiruptor kristjanssonii
           177R1B]
 gi|312180482|gb|ADQ40652.1| phosphate binding protein [Caldicellulosiruptor kristjanssonii
           177R1B]
          Length = 272

 Score = 60.1 bits (144), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 72/293 (24%), Positives = 120/293 (40%), Gaps = 64/293 (21%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           ++N I +AGS+++ P +  +A+ F E  P+ K   V+ GGS VG+K    G+     DI 
Sbjct: 32  SKNSITVAGSTSVQPLADDLAKAFMEKHPDTKIE-VQGGGSGVGIKSARDGVA----DIG 86

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
            SSR++   E           + E  I  DGI +V        +L+VE +    A     
Sbjct: 87  TSSRELKPEE---------KGLHEYKIAIDGIAVVVHPSNPIDNLSVEQIRDIYA----- 132

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
                   +K W ++     + +I +       GTR   E+ V+ E  +           
Sbjct: 133 ------GKIKNWKDV--GGKDAQIVVVTREEGSGTRGAFEELVMGESSISDSAV------ 178

Query: 204 FKYNVQQLSVAC-TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
               VQ  + A   SV QD  AI                    G++ +    ++   +K 
Sbjct: 179 ----VQPSTGAVKQSVSQDPNAI--------------------GYISMGVLDSS---VKA 211

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           V IDG+  +   + +G Y + RP LF  K +    V   +E++ F++S+E  A
Sbjct: 212 VKIDGVEATEDNVKNGKYKLQRPFLFLTKDEPQGLV---KEFIDFALSNEGQA 261


>gi|114778776|ref|ZP_01453586.1| phosphate-binding protein [Mariprofundus ferrooxydans PV-1]
 gi|114551027|gb|EAU53590.1| phosphate-binding protein [Mariprofundus ferrooxydans PV-1]
          Length = 277

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 73/301 (24%), Positives = 131/301 (43%), Gaps = 48/301 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I  AGS+T+ P  K  ++ + +   + +   +  GGSS G+K   RG     +DI  +SR
Sbjct: 24  ITSAGSTTVQPAMKACSQAYKKTHADMQF-IIAGGGSSKGVKTIARG----KVDIGRASR 78

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            I   EL         +++   +  DG++LV     V+ + T+ DL  A    L      
Sbjct: 79  AIKDKELA-----AYPEMKTFKLATDGVVLV-----VNAANTISDLSSAQVEQLFK---- 124

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
               +  W  +      V + I + + +HGT E+       +G     N      +F + 
Sbjct: 125 --GAVSNWQAVGGANAAVNL-ISLGT-EHGTYELFSHHFHLKGEEVDGNL-----VFDHG 175

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
              ++ +   +  D +A +VD     T A + V  +        F +N +  +KL+ +DG
Sbjct: 176 HAWIAFS-QDIALDKVAHDVD---AITFASVGVAGE--------FSRNGS--VKLLRLDG 221

Query: 268 IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIP 327
           I P+   +V+G Y +SRPLL   + +    V   ++++ +  +DE  A   +L   G IP
Sbjct: 222 IEPTTANVVNGTYKLSRPLLLLTRGEPVGEV---KDFIDYMQADECQAIVKKL---GYIP 275

Query: 328 I 328
           +
Sbjct: 276 L 276


>gi|297570586|ref|YP_003691930.1| phosphate ABC transporter substrate-binding protein
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296926501|gb|ADH87311.1| putative phosphate ABC transporter substrate-binding protein
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 301

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 65/286 (22%), Positives = 111/286 (38%), Gaps = 56/286 (19%)

Query: 31  AGSSTLFPYSKIIAENFSEYFPEFKT-----PF------VESGGSSVGLKEFCRGIGDDT 79
           AGSSTL      I E F+  +  +       P       V +GGS  G     R + D T
Sbjct: 43  AGSSTLAVVIAQIGEQFTRTYATWDQVDATLPAEKIRINVITGGSGAG----ARAVLDGT 98

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            D     R++  +E     +  +S+ Q +T+G D +LL + +D   ++    DL  A   
Sbjct: 99  ADFGMVGREVRDSE-----RTAMSNYQSLTVGIDALLLATHQDN-PLAGRRHDLTAAEVR 152

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
                 ++    +  W E  P+ P   I + V     G   V +  V+ +  V +R    
Sbjct: 153 ------RIFSGEISHWQEFNPELPAEEIVLLVRDVGGGAHSVFQNSVMGQTEVSNRA--- 203

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
                   VQ  ++                  T  + R+  N+   G+   S  +     
Sbjct: 204 --------VQAPTM------------------TALVPRLAGNRRAIGYASYSVAEAYGKQ 237

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           L +  +DG+ PS+  I++G YP+SRPL+     +   +   L +Y+
Sbjct: 238 LAVFSLDGVEPSVENIINGDYPVSRPLILLWNHELSVAERALLDYI 283


>gi|302872011|ref|YP_003840647.1| phosphate binding protein [Caldicellulosiruptor obsidiansis OB47]
 gi|302574870|gb|ADL42661.1| phosphate binding protein [Caldicellulosiruptor obsidiansis OB47]
          Length = 272

 Score = 59.7 bits (143), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 66/292 (22%), Positives = 125/292 (42%), Gaps = 62/292 (21%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           ++N I +AGS+++ P +  +A+ F E  P+ K   V+ GGS VG+K    G+ D    I 
Sbjct: 32  SKNSITVAGSTSVQPLADDLAKAFMEKHPDTKIE-VQGGGSGVGIKSARDGVAD----IG 86

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
            SSR++   E           + E  I  DGI +V        +LT++ +          
Sbjct: 87  TSSRELKPEE---------KGLHEYRIAIDGIAVVVHPSNPIENLTIDQIRD-------- 129

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
              +    +K W ++     E+ +          TRE        EG       S  R  
Sbjct: 130 ---IYIGKIKNWKDVGGKNAEIVVV---------TRE--------EG-------SGTRGA 162

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
           F    Q+L +  +S+    +     G   +++++   + +  G++ +    ++   +K V
Sbjct: 163 F----QELVMGGSSISDSAVVQPSTGAVKQSVSQ---DPNAIGYISMGVLDSS---VKAV 212

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
            I+G+  +   + +G+Y + RP LF  K +    V   +E++ F++S+E  A
Sbjct: 213 KIEGVEATEDNVKNGMYKLQRPFLFLTKDEPKGLV---KEFIDFTLSEEGQA 261


>gi|312622596|ref|YP_004024209.1| phosphate binding protein [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312203063|gb|ADQ46390.1| phosphate binding protein [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 272

 Score = 59.7 bits (143), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 70/292 (23%), Positives = 121/292 (41%), Gaps = 62/292 (21%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
           ++N I +AGS+++ P +  +A+ F E  P+ K   V+ GGS VG+K    G+     DI 
Sbjct: 32  SKNSITVAGSTSVQPLADDLAKAFMEKHPDTKIE-VQGGGSGVGIKSARDGVA----DIG 86

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
            SSR++   E           + E  I  DGI +V        +LT++ +          
Sbjct: 87  TSSRELKPEE---------KGLHEYKIAVDGIAIVVHPSNPIENLTIKQI---------- 127

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
              +    +K W ++     + +I +       GTR   E+ V+          S + D 
Sbjct: 128 -KDIYTGKIKSWKDV--GGKDAQIVVVTREEGSGTRGAFEELVM--------GGSSISDS 176

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                 Q +V   SV QD  AI                    G++ +    ++   +K V
Sbjct: 177 AVVQPSQGAVK-QSVSQDPNAI--------------------GYISIGVLDSS---VKAV 212

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
            I+G+ P+   + +G Y + RP LF  K +    V   +E++ F++S+E  A
Sbjct: 213 KIEGVEPTDANVKNGKYKLQRPFLFLTKDEPKGLV---KEFIDFTLSEEGQA 261


>gi|169832097|ref|YP_001718079.1| phosphate binding protein [Candidatus Desulforudis audaxviator
           MP104C]
 gi|169638941|gb|ACA60447.1| phosphate binding protein [Candidatus Desulforudis audaxviator
           MP104C]
          Length = 283

 Score = 59.7 bits (143), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 69/288 (23%), Positives = 115/288 (39%), Gaps = 60/288 (20%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           +  I IAGS+++ P S+ +A+ F    P+  T  V++GGS  G+K    GI     DI  
Sbjct: 43  QGSITIAGSTSVQPVSEELAKAFMAKHPKV-TVSVQAGGSGQGIKAAIDGIA----DIGA 97

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR +  +E         + + +  I  DGI ++         LT+E + +  A      
Sbjct: 98  SSRPLKDDE--------AAQVHQTQICSDGIAVIVHPSNEVSGLTLEQVKRIYA------ 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                  +  W E+     +  IA+       GTR   E+ V+ +         + R   
Sbjct: 144 -----GEITNWKEV--GGRDKAIAVVTREEGSGTRGAFEEMVMGK---------EARISV 187

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           +  VQ  S         G+   V G           N +  G+  + +       +K V 
Sbjct: 188 RAIVQPSS--------GGVKAAVAG-----------NPNAIGYTSIGYLDTT---VKTVE 225

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           +DG+ P+   I +G Y ISRP L+  + +    V   +EY+ F +  E
Sbjct: 226 VDGVAPTAENIRNGTYKISRPFLYLTRGEPSGLV---KEYIDFCLGPE 270


>gi|312877064|ref|ZP_07737037.1| phosphate binding protein [Caldicellulosiruptor lactoaceticus 6A]
 gi|311796205|gb|EFR12561.1| phosphate binding protein [Caldicellulosiruptor lactoaceticus 6A]
          Length = 272

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 72/292 (24%), Positives = 119/292 (40%), Gaps = 64/292 (21%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           +N I +AGS+++ P +  +A+ F E  PE K   V+ GGS VG+K    G+     DI  
Sbjct: 33  KNSITVAGSTSVQPLADDLAKAFMEKHPETKIE-VQGGGSGVGIKSARDGVA----DIGT 87

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR++   E           + E  I  DGI +V        +L+VE +    A      
Sbjct: 88  SSRELKPEE---------KGLHEYKIAIDGIAVVVHPSNPIDNLSVEQIRDIYA------ 132

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                  +K W ++     + +I +       GTR   E+ V+ E  +            
Sbjct: 133 -----GKIKNWKDV--GGKDAQIVVVTREEGSGTRGAFEELVMGESSISDSAV------- 178

Query: 205 KYNVQQLSVAC-TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              VQ  + A   SV QD  AI                    G++ +    ++   +K V
Sbjct: 179 ---VQPSTGAVKQSVSQDPNAI--------------------GYISMGVLDSS---VKAV 212

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
            I+G+  +   + +G Y + RP LF  K +    V   +E++ F++S+E  A
Sbjct: 213 KIEGVEATEDNVKNGKYKLQRPFLFLTKDEPQGLV---KEFIDFALSNEGQA 261


>gi|269791713|ref|YP_003316617.1| phosphate binding protein [Thermanaerovibrio acidaminovorans DSM
           6589]
 gi|269099348|gb|ACZ18335.1| phosphate binding protein [Thermanaerovibrio acidaminovorans DSM
           6589]
          Length = 272

 Score = 59.3 bits (142), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 81/322 (25%), Positives = 130/322 (40%), Gaps = 62/322 (19%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR    VL C  +L    G    A   I + GS+TL P+++  AE F +       P V+
Sbjct: 1   MRSILRVL-CAALLVGVLGGAAMA-GEIVMNGSTTLLPFAQSAAEAFMK-----ANPGVK 53

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
              S  G     + + D T  I NSSR++   E+++ K  GV+ ++ V +  D I+ +  
Sbjct: 54  ISVSGGGSGNGIKALIDGTTHIANSSREMKSEEIEKAKTKGVTPVKHV-VAFDCIIPIVH 112

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTR 179
                 +LTV+ L             +    ++ W E+  PD P   I +       GT 
Sbjct: 113 PSNPVSNLTVDQL-----------KNIYTGKVRNWKEVGGPDKP---IVVLSRDTSSGTY 158

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           EV E+KVL++  V  R  +         V        +V ++ +AI  DG          
Sbjct: 159 EVWEQKVLRKEPVSPRALT---------VASSGAMIQTVAKNPLAIGYDG---------- 199

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
                 G+V   F K     LK+  +DG  P+  T  +G +P +R L  Y   +    V 
Sbjct: 200 -----IGYVDQRFVKP----LKINGVDG-TPT--TARNGKFPTARELYMYTNGEPKGEV- 246

Query: 300 GLREYVSFSVSDEMMAPDSQLF 321
             + ++ F     M  P+ Q +
Sbjct: 247 --KAFIDF-----MKGPNGQRY 261


>gi|150401767|ref|YP_001325533.1| phosphate binding protein [Methanococcus aeolicus Nankai-3]
 gi|150014470|gb|ABR56921.1| phosphate binding protein [Methanococcus aeolicus Nankai-3]
          Length = 272

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 69/304 (22%), Positives = 128/304 (42%), Gaps = 65/304 (21%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I +AG + + P ++  A+ F +  P  K   V  GGS  G+ E    IG+  IDI  + R
Sbjct: 32  ISMAGGTAVVPIAQETAKIFMKSNPNVKIEVV-GGGSGFGINE----IGEKRIDIGMAGR 86

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            I  +E+++       D+    I  DG+ LV +++ +  +LT E L K  +       K 
Sbjct: 87  NIKSSEMEKY-----PDLIAYKIAVDGVALVVNKENIINNLTTEQLQKIYS-------KT 134

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
           + N    W E+                  G  E +      E        S  RD F   
Sbjct: 135 ITN----WKEV-----------------GGNDEPINTYTRDE-------LSGTRDTF--- 163

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
             +L++   ++    + +  +G   E  A++  +K+  G++ + +     + +K V +DG
Sbjct: 164 -WKLALNKNNISDKALVVASNG---EMKAKVSADKNGIGYISVGYID---ESVKPVALDG 216

Query: 268 IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ--LFQYGL 325
           + P+   I  G Y + RPL+     +    V   +EY+ +     +++P+ Q  +   G 
Sbjct: 217 VSPTKENIKKGDYKVYRPLILITNGKPEPIV---KEYIDY-----ILSPEGQKIIVNKGF 268

Query: 326 IPIS 329
           +PI+
Sbjct: 269 LPIN 272


>gi|134299952|ref|YP_001113448.1| phosphate binding protein [Desulfotomaculum reducens MI-1]
 gi|134052652|gb|ABO50623.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Desulfotomaculum reducens MI-1]
          Length = 284

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 76/292 (26%), Positives = 119/292 (40%), Gaps = 60/292 (20%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
           G      I IAGS+++ P S+ +A+ F        T  V+ GGSS G+K    G      
Sbjct: 39  GAGLSGSITIAGSTSVQPLSEELAKAFMTKNSGV-TVNVQGGGSSAGVKAANEG----AA 93

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
            I  SSR + ++E    K  G++   E  I  DGI +V +       LT+E + K     
Sbjct: 94  QIGASSRDLKESE----KGMGLT---ETKIALDGIAVVVNPKNQVADLTMEQVAK----- 141

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
                 +    +K W E+     +  I +       GTR   E+ VL E  + S+     
Sbjct: 142 ------IFSGEIKNWKEV--GGKDAAINVVTREEGSGTRGAFEEIVLGEAKMDSK----- 188

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                        A T      +   V GD           ++  G++ L     N +V 
Sbjct: 189 -------------AITQPSTGSVKTTVAGD-----------ENAIGYISLGSL--NEEV- 221

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           K V +DG+ P++  + +G + ISRP L Y+ +   N V   + YV F +S+E
Sbjct: 222 KGVKVDGVKPTVDNVKAGAFKISRPFL-YLTKGEMNEV--TKAYVDFVMSEE 270


>gi|160936138|ref|ZP_02083511.1| hypothetical protein CLOBOL_01034 [Clostridium bolteae ATCC
           BAA-613]
 gi|158440948|gb|EDP18672.1| hypothetical protein CLOBOL_01034 [Clostridium bolteae ATCC
           BAA-613]
          Length = 339

 Score = 59.3 bits (142), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 66/297 (22%), Positives = 117/297 (39%), Gaps = 62/297 (20%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSE----------YFPEFK-TPFVESGGSSVGLKEFCR 73
           ++ I   GS++L+P    +A +F+E           FP+   + +V  GGS VG+     
Sbjct: 67  QSSILFCGSTSLYPILSSLASSFTEKYVTWDAVDSSFPDSNISVYVAPGGSGVGVSAAID 126

Query: 74  GIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDL 133
           G    T D    +R I  +E++   +H     Q+  +          +D ++VS+  E+ 
Sbjct: 127 G----TADFGMLARDIKDSEIEALGEH----YQDFVVA---------KDALTVSVNAENP 169

Query: 134 YKALASYLIVDD--KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGC 191
              +   + V+   ++    +  W ++    P   I +Y+     G  EV +K V+ +  
Sbjct: 170 ICGIMDDMPVETIRQIFAGEIATWDQVDSTLPAEAINVYIRDLSGGAYEVFQKSVMGDSE 229

Query: 192 VRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLS 251
           V +                   A  S     +A  + GD           K   G+ G  
Sbjct: 230 VTAS------------------ATQSASMTELATNIAGD-----------KWGIGYAGFG 260

Query: 252 FY-KNNAD--VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
            Y K NAD  VL  + +DG+  +   I+SG Y I RP++F    +   S     +Y+
Sbjct: 261 AYNKANADGQVLTAMKVDGVEATAENIISGAYTIQRPVMFVTGAEITPSEQAFIDYI 317


>gi|90411750|ref|ZP_01219759.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Photobacterium profundum 3TCK]
 gi|90327312|gb|EAS43676.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Photobacterium profundum 3TCK]
          Length = 274

 Score = 59.3 bits (142), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 72/309 (23%), Positives = 119/309 (38%), Gaps = 68/309 (22%)

Query: 9   MCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEY----FPEFKTPFVESGGS 64
           M F V  V       A   I + GSS++ P  ++  E +S+     F E + P     GS
Sbjct: 15  MAFSVAAV-------ANETISVVGSSSVTPLMEVFGETYSQANSNIFVEVQGP-----GS 62

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
           S G+    R   D + D+  SSR +  +E  +       D++E+ +  DGI +V +    
Sbjct: 63  SAGV----RAATDGSADLGMSSRNLKDSEKSD-------DLKEIVVARDGIAVVVNNKNP 111

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR-PDFPEVRIAIYVPSGKHGTREVLE 183
              L+ ED+ K           +    +  W+++   D P V +     SG  G  E   
Sbjct: 112 ITDLSKEDVTK-----------IYKGEITNWNQVGGEDKPIVVVTRDTASGTRGAFE--- 157

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
                             D+     +   +  +++ Q       +G    T+A    N  
Sbjct: 158 ------------------DIMSLKKKINDIKVSAISQRAQVTSGNGQLKTTVAN---NPF 196

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G++ L       D LK + IDG VPS+  I SG Y + RP L   K    N     + 
Sbjct: 197 AIGYISLGTVD---DSLKALSIDGHVPSVAAIKSGEYQVQRPFLVLYKASKINPT--TQS 251

Query: 304 YVSFSVSDE 312
           ++ +S++ E
Sbjct: 252 FLDWSLTTE 260


>gi|54308587|ref|YP_129607.1| putative phosphate ABC transporter, periplasmicphosphate-binding
           protein [Photobacterium profundum SS9]
 gi|46913016|emb|CAG19805.1| putative phosphate ABC transporter, periplasmicphosphate-binding
           protein [Photobacterium profundum SS9]
          Length = 274

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 70/293 (23%), Positives = 111/293 (37%), Gaps = 66/293 (22%)

Query: 9   MCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEY----FPEFKTPFVESGGS 64
           M F V  V       A   I + GSS++ P  ++  E +S+     F E + P     GS
Sbjct: 15  MAFSVAAV-------ANETISVVGSSSVTPLMEVFGETYSQAHSNVFVEVQGP-----GS 62

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
           S G+    R   D + D+  SSR +  +E  +       D++E+ +  DGI +V +    
Sbjct: 63  SAGV----RAATDGSADLGMSSRNLKDSEKSD-------DLKEIVVARDGIAVVVNNKNP 111

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR-PDFPEVRIAIYVPSGKHGTREVLE 183
              L+ ED+ K           +    +  W+++   D P V +     SG  G  E   
Sbjct: 112 ITDLSKEDVTK-----------IYKGEITNWNQVGGEDKPIVVVTRDTASGTRGAFE--- 157

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
                             D+     +   +  +++ Q       +G    T+A    N  
Sbjct: 158 ------------------DIMSLKKKINDITVSAISQRAQVTSGNGQLKTTVAN---NPF 196

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFN 296
             G++ L       D LK + IDG VPS+  I SG Y + RP L   K    N
Sbjct: 197 AIGYISLGTVD---DSLKALSIDGHVPSVAAIKSGEYQVQRPFLVLYKTSKIN 246


>gi|224367302|ref|YP_002601465.1| PstS2 [Desulfobacterium autotrophicum HRM2]
 gi|223690018|gb|ACN13301.1| PstS2 [Desulfobacterium autotrophicum HRM2]
          Length = 84

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 26/72 (36%), Positives = 41/72 (56%)

Query: 270 PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPIS 329
           P+   I    YP+SRPL FYVK++H + + G+RE++    S++    +  L   GLIP+ 
Sbjct: 3   PTFDAIADSSYPVSRPLFFYVKKEHVDKIPGIREFLKEFTSEKAWGNEGYLTDKGLIPMP 62

Query: 330 NEERKSVRDSIA 341
            EER     ++A
Sbjct: 63  KEERARFVKAVA 74


>gi|115377150|ref|ZP_01464364.1| phosphate-binding protein [Stigmatella aurantiaca DW4/3-1]
 gi|310822863|ref|YP_003955221.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Stigmatella aurantiaca DW4/3-1]
 gi|115365859|gb|EAU64880.1| phosphate-binding protein [Stigmatella aurantiaca DW4/3-1]
 gi|309395935|gb|ADO73394.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           [Stigmatella aurantiaca DW4/3-1]
          Length = 273

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 73/310 (23%), Positives = 121/310 (39%), Gaps = 60/310 (19%)

Query: 5   FVVLMCFVV-LEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
            +VL  FV+  E   GT       + + GS T+   S+  AE F +     K   V  GG
Sbjct: 8   LLVLFPFVLPTEAQAGT-------LSVKGSDTMVILSQRWAEEFMKKNAATKVQ-VTGGG 59

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  GL     G    T DI  SSR I + E ++ +    +  ++V +  DG+    +   
Sbjct: 60  SGTGLAALING----TTDIAMSSRPIKEAETEKIRTQFKATAEQVAVAKDGVTFYVNEKN 115

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              +LTVE L             +    +  W E+     +  I +Y      GT   ++
Sbjct: 116 PLNALTVEQL-----------KGIYLGDITNWKEV--GGADASIVLYSRENSSGTYVFVK 162

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             +L              +   Y  Q  ++  T+   + I  E +G              
Sbjct: 163 DHLL--------------NGEDYAAQAQTLPGTAAVVNAITQEKNG-------------- 194

Query: 244 VFGFVGLSFYKNNADVLKLVPIDG-IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
             G+ G ++ K   + LK+    G + P+   I SG YP+SR L FY++ +    V   +
Sbjct: 195 -IGYGGAAYAKGIKE-LKIKTSSGEVAPTAENIKSGKYPLSRDLYFYLRGKPTGEV---K 249

Query: 303 EYVSFSVSDE 312
            ++ F++SDE
Sbjct: 250 TFIDFALSDE 259


>gi|21673724|ref|NP_661789.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Chlorobium tepidum TLS]
 gi|21646847|gb|AAM72131.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Chlorobium tepidum TLS]
          Length = 253

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 64/270 (23%), Positives = 103/270 (38%), Gaps = 55/270 (20%)

Query: 28  IRIAGSSTLFPYS-----KIIAENFSEYFPEFK-TPFVESGGSSVGLKEFCRGIGDDTID 81
           IR  G  TL  YS      ++A  F  +  ++  T  V   GS  G K    G      D
Sbjct: 2   IRHRGRFTLLFYSLRGNTPLLAARFFLFIKKYGVTVSVSESGSGNGAKSLING----ECD 57

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I + SR +   E++  ++ GV+ +Q + I  DGI +V      + +LT   L        
Sbjct: 58  IADMSRPMKPMEIEAARRKGVNPVQHI-IALDGIAVVVHPANPTRALTKAQL-------- 108

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
                +    +  W ++    P  RI +       GT+   E+  L +G           
Sbjct: 109 ---ASIYLGRVTNWKQV--GGPNARIVVIQRESNSGTQSSFEEMALGKG----------- 152

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                    + V  T+        E         +R+    +  GFVGL +   +   LK
Sbjct: 153 ---------MRVVRTA--------ETAASNGAVKSRVASTPNAIGFVGLGYVDRSVKPLK 195

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVK 291
              IDG++P++  + S  YP++RPL  Y K
Sbjct: 196 ---IDGVLPNVAAVKSRAYPLARPLFMYSK 222


>gi|150400097|ref|YP_001323864.1| phosphate binding protein [Methanococcus vannielii SB]
 gi|150012800|gb|ABR55252.1| phosphate binding protein [Methanococcus vannielii SB]
          Length = 273

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 75/337 (22%), Positives = 136/337 (40%), Gaps = 77/337 (22%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNR------IRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           F+ +++  +++   C +G  +         I+ AG + L P  K I++   EY  E +  
Sbjct: 3   FYNLIISLLIISTLCLSGCISTESSGETVSIKTAGGTALIPIMKDISK---EYMHENRNV 59

Query: 58  FVE--SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
            VE   GGS  G+KE     G+  + I  + R +   E     K    ++    IG DGI
Sbjct: 60  QVEVTGGGSGFGIKE----TGEGRLTIGMAGRDLKSEE-----KEKYPNMVVYKIGLDGI 110

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRP-DFPEVRIAIYVPSG 174
            +++ ++     LT ++L            K+    +  W+EI   + P   I IY    
Sbjct: 111 AIITHKENPVSDLTTKEL-----------QKIYSGEITNWNEIGGGNNP---INIYTREE 156

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
           + GT E      L EG            + K N+   S+  +S               E 
Sbjct: 157 ESGTHETF----LNEG------------LLKGNISPRSLMVSS-------------NGEM 187

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQH 294
            ++I ++K+  G++ + +     D +K +  +G+ P+   +  G+Y I RPL      + 
Sbjct: 188 KSKISLDKNGIGYISIGYVD---DSVKTLMFNGVEPTQENVKEGIYKIYRPLNILTNGKP 244

Query: 295 FNSVLGLREYVSFSVSDEMMAPDSQ--LFQYGLIPIS 329
            NSV    EY+        + P+ Q  +   G +P++
Sbjct: 245 ENSVQNFIEYI--------LGPNGQKIIENNGFLPVN 273


>gi|24217358|ref|NP_714841.1| phosphate-binding protein PstS [Leptospira interrogans serovar Lai
           str. 56601]
 gi|45655808|ref|YP_003617.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Leptospira interrogans serovar Copenhageni str. Fiocruz
           L1-130]
 gi|24202436|gb|AAN51856.1| ABC-type phosphate transport system protein PstS [Leptospira
           interrogans serovar Lai str. 56601]
 gi|45602779|gb|AAS72254.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Leptospira interrogans serovar Copenhageni str. Fiocruz
           L1-130]
          Length = 299

 Score = 58.9 bits (141), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 72/315 (22%), Positives = 134/315 (42%), Gaps = 52/315 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+  F++L+  +++          +  I + GS T+    ++I   ++      +   V+
Sbjct: 1   MKLKFIILVAIILI-----GNCKPKETITVTGSETMHVMLQMIGLEYTRKKSGIQV-VVQ 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
            GGS  G+++  +G      DI  +SR +T+ EL E    G    + +TI +DGI ++  
Sbjct: 55  GGGSIEGIEKLFQG----KTDIAAASRPLTETELKEFDSKG--KFESLTIAYDGIAII-- 106

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFPEVRIAIYVPSGKHGT 178
              V  S  +  +   +AS      K+    +  WS+I  +P     +I + + + K GT
Sbjct: 107 ---VHPSNPIRKISLEIAS------KIFSGEISDWSKIGGKPG----KIDVIIRNDKSGT 153

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
               E  VL++  + S+NF   +     NV    +A      D +A E+D          
Sbjct: 154 ASYFETHVLKQKDLGSKNFETRK-----NVIYSKMAKIVSDNDSMAAEIDS--------- 199

Query: 239 EVNKDVFGFVGL--SFYKNNADVLKL-VPIDG----IVPSMGTIVSGLYPISRPLLFYVK 291
             N +  GF+G+  + ++N   V  L   + G    +VPS+  + +  Y +SR L  +  
Sbjct: 200 --NPNAIGFMGMGSALFENKGRVRALEYSLSGKDPFVVPSIENVYNRKYELSRGLYLFYL 257

Query: 292 RQHFNSVLGLREYVS 306
             H   +     YV+
Sbjct: 258 SDHGQKIDDFITYVT 272


>gi|193212577|ref|YP_001998530.1| phosphate binding protein [Chlorobaculum parvum NCIB 8327]
 gi|193086054|gb|ACF11330.1| phosphate binding protein [Chlorobaculum parvum NCIB 8327]
          Length = 271

 Score = 58.5 bits (140), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 68/268 (25%), Positives = 104/268 (38%), Gaps = 64/268 (23%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPF-VESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           I I GS+T+ P SK  A  F +   ++K P  V   GS  G K    G    + DI + S
Sbjct: 28  IMIDGSTTVGPISKSFAALFMK---KYKVPVTVSESGSGNGAKSLING----SCDIADMS 80

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLT---VEDLYKALASYLIV 143
           R +   EL   K  G++ +  V    DGI +V        SLT   + D+Y    +    
Sbjct: 81  RSMKPQELAAAKAKGINPVAHVA-ALDGIAMVVHPSNPVRSLTKTQIADIYTGRVT---- 135

Query: 144 DDKVVFNPLKKWSEIR-PDFPEVRIAIYVPSGKHGTREVLEKKVL-QEGCVRSRNFSKMR 201
                      W ++  P+FP V I         GT+E   + VL +   VRS       
Sbjct: 136 ----------NWRQVGGPNFPVVVIQR---ESNSGTQETFRELVLDKRKVVRSAETQASN 182

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
              K  V Q                               +   GF+GL +  ++   +K
Sbjct: 183 GAVKNRVSQ------------------------------TRGAIGFLGLGYVDSS---VK 209

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFY 289
            + ++ ++PS+ T+ +  YP+SRPL  Y
Sbjct: 210 PIAVNKVMPSVATVKNNTYPLSRPLFMY 237


>gi|166031597|ref|ZP_02234426.1| hypothetical protein DORFOR_01297 [Dorea formicigenerans ATCC
           27755]
 gi|166028574|gb|EDR47331.1| hypothetical protein DORFOR_01297 [Dorea formicigenerans ATCC
           27755]
          Length = 302

 Score = 58.5 bits (140), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 71/281 (25%), Positives = 113/281 (40%), Gaps = 52/281 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I  AGSS L P +   A++F    P+     +++GGS  GLK+   G    T+DI NS  
Sbjct: 48  ITAAGSSALKPLADDAADSFLNENPDVSIT-IDAGGSGEGLKQVSEG----TVDIGNSDV 102

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD-- 145
              +++LD  K   + D Q        + +++   +V+     ED+ KA    L  D   
Sbjct: 103 -AAEDKLDADKAKELVDHQ--------VCVITMAPIVN-----EDVAKAGVKSLTKDQLI 148

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +       W E+    P+  I +    G  GTR   +K  L +G   + N S       
Sbjct: 149 SIFTGKTTNWKEVGG--PDEDIVLVTRPGSSGTRATFQKYAL-DGNEEASNAS------- 198

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                              +E D D    L  ++  K   G+V LS+   +A V + V I
Sbjct: 199 -------------------METD-DSGVLLTNVKDTKGAIGYVALSYLTGDAGV-ETVAI 237

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
           DG+ P++    SG YP+      Y K +    V    +Y++
Sbjct: 238 DGVEPTLENTYSGEYPVWTFEHMYTKGEPNEVVSAFLDYIT 278


>gi|126180216|ref|YP_001048181.1| phosphate binding protein [Methanoculleus marisnigri JR1]
 gi|125863010|gb|ABN58199.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanoculleus marisnigri JR1]
          Length = 285

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 78/315 (24%), Positives = 132/315 (41%), Gaps = 70/315 (22%)

Query: 7   VLMCFVVLEVYCG---TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           +L+ F++     G   +G+    +I + GS+T+ P ++   E F E +   +   V  GG
Sbjct: 17  ILVVFLMAAGCVGGQSSGSPTSEQITVTGSTTVLPIAEKAREAFEEEYTSAEI-MVSGGG 75

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SSVG+K     +G+ T DI  +SR +   E+      G   I    +  D ILL+ +   
Sbjct: 76  SSVGIK----AVGEGTADIGMTSRDLKPAEI-----AGYPGIVRHHVADDAILLIVNPGN 126

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
              SLT++++            + ++N     W+++     + +I +       GTRE  
Sbjct: 127 SVESLTLDEV------------RGIYNGTYTNWNQVGGS--DQQIVVVGRDSASGTREFF 172

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYN--VQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            + VL     ++ +F K ++ F  N  +QQ                          ++  
Sbjct: 173 SEYVL-----KNEDFVKTQEEFNSNGGIQQ--------------------------KVSR 201

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDG--IVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
                G+VGL  Y     VL L  +DG  + P++  I S  YPISRPL      +     
Sbjct: 202 TPGAIGYVGLG-YTEGVKVLSL-DVDGTPVEPTLEKIKSKHYPISRPLFMLTNGEPD--- 256

Query: 299 LGL-REYVSFSVSDE 312
            GL R+Y+ F +S E
Sbjct: 257 -GLARQYLDFIMSAE 270


>gi|291524403|emb|CBK89990.1| phosphate ABC transporter substrate-binding protein, PhoT family
           (TC 3.A.1.7.1) [Eubacterium rectale DSM 17629]
          Length = 293

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 117/290 (40%), Gaps = 62/290 (21%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + +AGS+++    + + E+F E  P   T  VE  GS  G++    G    ++DI +SSR
Sbjct: 53  LSLAGSTSMEKLCEALKESFMEKNPGV-TVTVEYTGSGSGIESVTAG----SVDIGDSSR 107

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            +T +E    K +GV   +E  +  DGI +++D+D     LT +DL            K+
Sbjct: 108 ALTDDE----KANGV---EENIVAIDGIAVITDKDNSVTELTSDDLK-----------KI 149

Query: 148 VFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGT-REVLEKKVLQEGCVRSRNFSKMRDMFK 205
               +  W ++   D   V I     SG  G   E+L+                ++D  K
Sbjct: 150 YTGEISNWKDLGGKDEAIVAIGREAASGTRGAFEELLD----------------VKDQCK 193

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
           Y  Q+L                       LA++       G+V L       D +  + I
Sbjct: 194 Y-AQELDSTGA-----------------VLAKVGSTPGAIGYVSLDVLD---DTVTAMKI 232

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           DG+  +   IV+G Y +SRP +   K +       ++ +  +  SDE  A
Sbjct: 233 DGVEATEENIVAGKYLLSRPFVMATKGKIDEQNDIVKAWFDYVNSDEGQA 282


>gi|329121392|ref|ZP_08250017.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Dialister micraerophilus DSM 19965]
 gi|327469682|gb|EGF15149.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Dialister micraerophilus DSM 19965]
          Length = 342

 Score = 58.2 bits (139), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 70/311 (22%), Positives = 124/311 (39%), Gaps = 58/311 (18%)

Query: 6   VVLMCFVVLEVYCGTGTFAR--NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           V  +   VL   CG+G      + +  +GSS L P +K  A  F E  P+  +  + +GG
Sbjct: 66  VAALGISVLLAGCGSGESQHKGSTVTGSGSSALLPLAKKAASAFKEKNPDV-SIILNAGG 124

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S VGLK+   G  D     V++S K+   +  E + H V                    +
Sbjct: 125 SGVGLKQVSEGSVDIGNSDVDASMKLPSEKAKELQDHKVC-------------------I 165

Query: 124 VSVSLTV-EDLYKALASYLIVDDKVVF-NPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           V+V+  V +D+Y+ + +      + +F + +K W E+    P+  I +       GTR +
Sbjct: 166 VTVAAVVNKDIYQDVKNITKEQLRDIFTSKIKNWKEVGG--PDEEIVLITRPKTSGTRML 223

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
             K  L                    + + + A      +G  IE           +   
Sbjct: 224 FTKYALD------------------GMDETANATLETDDNGTLIE----------NVSQT 255

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL 301
           K   G+V L + + N+  + ++ IDG+ P++    +G YP+      Y K +   +V   
Sbjct: 256 KGAIGYVALPYVR-NSKFVNVLAIDGVEPTVENTYNGKYPVWGYEHMYTKGEAKGAV--- 311

Query: 302 REYVSFSVSDE 312
           + Y+ F  S+E
Sbjct: 312 KNYIDFFTSEE 322


>gi|150402273|ref|YP_001329567.1| phosphate binding protein [Methanococcus maripaludis C7]
 gi|150033303|gb|ABR65416.1| phosphate binding protein [Methanococcus maripaludis C7]
          Length = 281

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 64/263 (24%), Positives = 115/263 (43%), Gaps = 61/263 (23%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            ++I+GS+T+ P ++  A+ F      +    V  GGS +G+KE     G++  DI  +S
Sbjct: 40  NLKISGSTTVLPIAEEAAKQFMMANKNYMIE-VTGGGSGLGVKES----GENLNDIGMAS 94

Query: 87  RKITQNELD---ECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           R+I  +ELD   E   +G        I  DG+ ++   +    SLT E +   +A Y   
Sbjct: 95  REIKSSELDTYPELIAYG--------IAKDGVAIIVHPENPVSSLTQEQI---IAIY--- 140

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
                   +  W+E+  D  +  I +Y    + GTREV  +K L +G     N +K    
Sbjct: 141 -----SGKITNWNEVGGD--DAPITVYTRDEESGTREVFFEKALNKG-----NITK---- 184

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                Q + VA     +  +  +V+G                G++ + +  ++   +K  
Sbjct: 185 -----QAVVVASNGAMKSSVKADVNG---------------IGYLSIGYLDSS---VKGC 221

Query: 264 PIDGIVPSMGTIVSGLYPISRPL 286
             +G++P+   +V+G Y +SR L
Sbjct: 222 EYEGVIPTEANVVAGTYKVSRTL 244


>gi|308273633|emb|CBX30235.1| hypothetical protein N47_D30440 [uncultured Desulfobacterium sp.]
          Length = 276

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 75/331 (22%), Positives = 138/331 (41%), Gaps = 61/331 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   +V+   ++  ++     FA N I I GS+T+ P ++ +AE F +  P+ K     
Sbjct: 5   MKRSKLVMGAVLLAAIFTSGIAFAGN-ISINGSTTVLPIAQKVAEAFMKEHPDVKISV-- 61

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
              S  G     + + D + DI ++SR +   E++  K  G + + E  + +D I+ V  
Sbjct: 62  ---SGGGSGNGIKALIDGSTDIADASRAMKDKEVEMAKGKGANPV-EFIVAYDCIVPVVH 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFN-PLKKWSEIRP-DFPEVRIAIYVPSGKHGT 178
            D    ++TV+ L            K ++   +K W E    D P V I+    S   GT
Sbjct: 118 PDNPIKNITVDQL------------KAIYKGEVKNWKEFGGLDKPIVVISRDTSS---GT 162

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
            EV E+KV+++                            V    +    +G   +T+++ 
Sbjct: 163 YEVWEEKVMKK--------------------------ERVYPGALLTASNGAIVQTVSK- 195

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
             N +  G++G+ +  ++   L +  I G   S  T ++  +PISRPL  Y + Q    +
Sbjct: 196 --NINAIGYIGVGYADSSVKALTVNSIKG---SKETTLNKTFPISRPLYMYTRIQPAGDI 250

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPIS 329
               +YV      + +  +S     G IP++
Sbjct: 251 KAFMDYVLNKKKGQNLVEES-----GFIPLT 276


>gi|21226680|ref|NP_632602.1| phosphate-binding protein [Methanosarcina mazei Go1]
 gi|20904964|gb|AAM30274.1| Phosphate-binding protein [Methanosarcina mazei Go1]
          Length = 315

 Score = 57.8 bits (138), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 122/295 (41%), Gaps = 56/295 (18%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T +     I + GS T+ P ++  AE F       + P      +  G       + D  
Sbjct: 58  TSSTESQSISLKGSDTVLPLAQAEAEEFM-----LENPDKSVTVTGGGSGVGITALIDGE 112

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
           +DI  +SR+I   E++  + + ++ + E TI +DGI +V +       LT + L      
Sbjct: 113 VDIATASREIKAEEIEAAQSNVITPV-ETTIAYDGISVVVNPGNPVSELTFDQL------ 165

Query: 140 YLIVDDKVVFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                 + ++N  +  W ++  +  +  I +       GT E  +++VLQ          
Sbjct: 166 ------RGIYNGTISNWQDVGGE--DAEIVVISRDSSSGTYEYFKEEVLQ---------- 207

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
              D ++ +      A T     GI           +  +  N +  G++G+++   +  
Sbjct: 208 --GDEYRPD------ALTQPATGGI-----------VGEVSQNTNAIGYIGIAYLDQSVK 248

Query: 259 VLKLVPIDG-IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL-REYVSFSVSD 311
            L L   +G +VPS   ++SG YP+SR L FY   +      GL +E+V F +S+
Sbjct: 249 ALNLDGGNGPVVPSSENVLSGAYPLSRSLYFYTNGEPS----GLTKEFVDFVLSE 299


>gi|91772771|ref|YP_565463.1| phosphate ABC transporter phosphate-binding protein
           [Methanococcoides burtonii DSM 6242]
 gi|91711786|gb|ABE51713.1| Phosphate import ABC transporter, phosphate binding protein
           [Methanococcoides burtonii DSM 6242]
          Length = 285

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 62/301 (20%), Positives = 118/301 (39%), Gaps = 55/301 (18%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GS T+ P ++  AE F   +P+             G       + D  IDI  +SR
Sbjct: 38  IMIKGSDTVLPLAQAEAEVFMMEYPDTSVSI-----IGGGSGVGIAALIDGEIDIAMTSR 92

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
           ++  +E++  + +G+  +++ TI  DGI +V + +     +T E +             +
Sbjct: 93  EMKGSEIENAQANGIDPVEQ-TIAWDGISVVVNPENPVSEMTFEQI-----------KAI 140

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
               +  W+E+  +  +  I +       GT E  + +VL+                   
Sbjct: 141 YVGDVSNWNEVGGE--DREIVVLSRDSSSGTYEYFKDEVLE------------------- 179

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                      R D +     G   +T+++   N++  G+VG+++       L +    G
Sbjct: 180 -------GNEYRADALITPSTGAIIQTVSQ---NQNAIGYVGVAYLDGTTKALAVDNGSG 229

Query: 268 IV-PSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLI 326
              P+   I++G YP++RPL FY   +     L   E++S    +E       +F+ G  
Sbjct: 230 AEEPTSENILAGTYPLARPLYFYTNGEPTGLALEFIEFISSETGEET------IFEVGYF 283

Query: 327 P 327
           P
Sbjct: 284 P 284


>gi|170758273|ref|YP_001785723.1| phosphate ABC transporter phosphate-binding protein [Clostridium
           botulinum A3 str. Loch Maree]
 gi|169405262|gb|ACA53673.1| phosphate uptake ABC transporter, PhoT family, phosphate-binding
           protein [Clostridium botulinum A3 str. Loch Maree]
          Length = 303

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 75/333 (22%), Positives = 124/333 (37%), Gaps = 69/333 (20%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------RIRIAGSSTLFPYSKIIAENFSEY 50
           +     VL+   +L   CG+   + +          +I   GSSTL P      +     
Sbjct: 5   LSVMLSVLLTSALLFTACGSKQTSNSNEESSKKESGKIMCIGSSTLAPVVSKAGDTLKSK 64

Query: 51  FPEFKT-----P------FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
              +K      P       V SGGS  G+K       + T +    SR+++++E  + K+
Sbjct: 65  HGTWKKMNDKLPDESIELAVSSGGSGAGVKAAL----EKTANFGLISREVSKDEKAKMKE 120

Query: 100 HGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR 159
           +      E+ IG+D + L      V+    +    K L S  I   K+     K W ++ 
Sbjct: 121 Y-----NEIKIGYDALTL-----SVNPENPILKNKKGLTSEEI--QKIFSGEAKTWKDVD 168

Query: 160 PDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVR 219
              P  +I + V     G  EV +K V+ +                            V 
Sbjct: 169 TSLPANKIVLVVRDAGGGAAEVFQKAVMGD--------------------------KKVS 202

Query: 220 QDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGL 279
           +D +     G  T+   ++  NKD  G+  +     N   L  + +D I P+   I SG 
Sbjct: 203 KDAVQAPSMGALTQ---KVIENKDAIGYASVGLVDQNKGKLTPMEVDSIAPTKENITSGK 259

Query: 280 YPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           Y I+RPLL  +K  +   V   + +V F  S+E
Sbjct: 260 YKIARPLLL-IKDGNLTGV--EQTFVDFLKSEE 289


>gi|116332641|ref|YP_802358.1| PstS ABC-type phosphate transport system protein [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|116127508|gb|ABJ77600.1| PstS ABC-type phosphate transport system protein [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
          Length = 301

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 71/318 (22%), Positives = 128/318 (40%), Gaps = 56/318 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN-----RIRIAGSSTLFPYSKIIAENFSEYFPEFK 55
           M+F F++L   V        GT   N      I + GS T+    ++I   +S    EF+
Sbjct: 1   MKFKFMILTAIV--------GTLVGNCKPKETITVTGSETMHVMLQMIGLEYSRKKSEFQ 52

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
              V  GGS  G+++  +    D  DI  +SR +T+ EL E    G    + + + +DGI
Sbjct: 53  V-LVHGGGSIEGIEKLFQ----DKTDIAAASRPLTEAELKEFNSKG--KFESLVVAYDGI 105

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
            ++         +++E+  K  A             +  WS++       +I + + + K
Sbjct: 106 AIIVHPSNPVRRISLEEASKIFAG-----------EITDWSKVGGKSE--KIDVLIRNDK 152

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GT    E  VL++  +  +NF   ++              SV      I  D D     
Sbjct: 153 SGTAAYFETHVLKQKDLGIKNFEARKN--------------SVYSKTAKIVADND--AMT 196

Query: 236 ARIEVNKDVFGFVGL--SFYKNNADVLKL-VPIDG----IVPSMGTIVSGLYPISRPLLF 288
           A I+ N +  GF+G+  + ++N   V  L   + G    ++P++  + +  Y +SR L  
Sbjct: 197 AAIDSNPNTIGFMGMGSALFENKGKVRALEYSLSGKGPFVIPNIENVYNRKYQLSRGLYL 256

Query: 289 YVKRQHFNSVLGLREYVS 306
           +    H   +     YV+
Sbjct: 257 FYLSDHGQKIDNFITYVT 274


>gi|291527580|emb|CBK93166.1| phosphate ABC transporter substrate-binding protein, PhoT family
           (TC 3.A.1.7.1) [Eubacterium rectale M104/1]
          Length = 293

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/290 (24%), Positives = 116/290 (40%), Gaps = 62/290 (21%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + +AGS+++    + + E+F E  P   T  VE  GS  G++    G    ++DI +SSR
Sbjct: 53  LSLAGSTSMEKLCEALKESFMEKNPGV-TVTVEYTGSGSGIESVTAG----SVDIGDSSR 107

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            +T +E    K +GV   +E  +  DGI +++D D     LT +DL            K+
Sbjct: 108 ALTDDE----KANGV---EENIVAIDGIAVITDNDNSVTELTSDDLK-----------KI 149

Query: 148 VFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGT-REVLEKKVLQEGCVRSRNFSKMRDMFK 205
               +  W ++   D   V I     SG  G   E+L+                ++D  K
Sbjct: 150 YTGEISNWKDLGGKDEAIVAIGREAASGTRGAFEELLD----------------VKDQCK 193

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
           Y  Q+L                       LA++       G+V L       D +  + I
Sbjct: 194 Y-AQELDSTGA-----------------VLAKVGSTPGAIGYVSLDVLD---DTVTAMKI 232

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           DG+  +   IV+G Y +SRP +   K +       ++ +  +  SDE  A
Sbjct: 233 DGVEATEENIVAGKYLLSRPFVMATKGKIDEQNGIVKAWFDYVNSDEGQA 282


>gi|238925303|ref|YP_002938820.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Eubacterium rectale ATCC 33656]
 gi|238876979|gb|ACR76686.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Eubacterium rectale ATCC 33656]
          Length = 323

 Score = 57.4 bits (137), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 70/289 (24%), Positives = 115/289 (39%), Gaps = 60/289 (20%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           + +AGS+++    + + E+F E  P   T  VE  GS  G++    G    ++DI +SSR
Sbjct: 83  LSLAGSTSMEKLCEALKESFMEKNPGV-TVTVEYTGSGSGIESVTAG----SVDIGDSSR 137

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            +T +E    K +GV   +E  +  DGI +++D+D     LT +DL            K+
Sbjct: 138 ALTDDE----KANGV---EENIVAIDGIAVITDKDNSVTELTSDDLK-----------KI 179

Query: 148 VFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
               +  W ++   D   V I     SG  G  E L                 ++D  KY
Sbjct: 180 YTGEISNWKDLGGKDEAIVAIGREAASGTRGAFEEL---------------LDVKDQCKY 224

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
             Q+L                       LA++       G+V L       D +  + ID
Sbjct: 225 -AQELDSTGA-----------------VLAKVGSTPGAIGYVSLDVLD---DTVTAMKID 263

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           G+  +   IV+G Y +SRP +   K +       ++ +  +  SDE  A
Sbjct: 264 GVEATEENIVAGKYLLSRPFVMATKGKIDEQNDIVKAWFDYVNSDEGQA 312


>gi|222445874|ref|ZP_03608389.1| hypothetical protein METSMIALI_01520 [Methanobrevibacter smithii
           DSM 2375]
 gi|261349581|ref|ZP_05974998.1| phosphate ABC transporter, phosphate-binding protein
           [Methanobrevibacter smithii DSM 2374]
 gi|222435439|gb|EEE42604.1| hypothetical protein METSMIALI_01520 [Methanobrevibacter smithii
           DSM 2375]
 gi|288861539|gb|EFC93837.1| phosphate ABC transporter, phosphate-binding protein
           [Methanobrevibacter smithii DSM 2374]
          Length = 269

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 71/291 (24%), Positives = 127/291 (43%), Gaps = 67/291 (23%)

Query: 24  ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIV 83
             +++++AGS+++ P ++ + E + E  P+ +   V+ GGSSVG+K    G    + DI 
Sbjct: 29  GSSKVQVAGSTSVQPVAEKLVEVYKESHPDAQIN-VQGGGSSVGIKSAEDG----SADIG 83

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILL-VSDRDMVSVSLTVEDLYKALASYLI 142
             S+ +  N          S +Q+  +G DGI++ ++ ++ VS  L+ E L         
Sbjct: 84  MCSKALDNN----------SSLQQYELGKDGIVIAINTQNQVS-DLSDEQLQ-------- 124

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
               +    +  W+++     E+ + I    G  GT +  E  V+ +        SK++D
Sbjct: 125 ---GIFSGKITNWNQVGGSDGEINV-ITREEG-SGTLDAFESIVMGD--------SKIKD 171

Query: 203 MFKYNVQQLSVAC-TSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                VQ  + A   SV QD  AI                    GFV    Y + +D +K
Sbjct: 172 --DAVVQSSTEAVKQSVSQDPNAI--------------------GFVS---YAHMSDDIK 206

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
            V ++G+ PS  TI  G Y + RP LF    +        + ++ + +SD+
Sbjct: 207 AVNVNGVAPSDATIADGTYELQRPFLFLTNGEPTGET---KNFIDWVLSDD 254


>gi|77164108|ref|YP_342633.1| extracellular solute-binding protein [Nitrosococcus oceani ATCC
           19707]
 gi|254436006|ref|ZP_05049513.1| Bacterial extracellular solute-binding protein, putative
           [Nitrosococcus oceani AFC27]
 gi|76882422|gb|ABA57103.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Nitrosococcus oceani ATCC 19707]
 gi|207089117|gb|EDZ66389.1| Bacterial extracellular solute-binding protein, putative
           [Nitrosococcus oceani AFC27]
          Length = 268

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 73/318 (22%), Positives = 128/318 (40%), Gaps = 67/318 (21%)

Query: 1   MRFFF-VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           MR     +L+ F +          A NR+ + GSST+ P +  IA+ F    P  +   V
Sbjct: 1   MRVLLKTLLLSFTLTAALLSQA--ADNRLTLTGSSTVAPLASEIAKRFESKHPGVRID-V 57

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           + GGSS G+ +   G+ D  I +V+ + K T+            D+    I  DGI L+ 
Sbjct: 58  QMGGSSRGINDARMGLAD--IGMVSRALKPTEQ-----------DLSAFLIAMDGIGLI- 103

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI-RPDFPEVRIAIYVPSGKHGT 178
                   L   +    L++  I+D  +    +  W ++  PD P     I V +   G 
Sbjct: 104 --------LHKSNAVNTLSNTQIID--IYIGKITHWKQVGGPDLP-----ITVVNKAEG- 147

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
           R  LE        +    F+      K +V                  V GD  + +  +
Sbjct: 148 RSTLE--------LFLHYFALKNSQIKAHV------------------VVGDNQQGIKTV 181

Query: 239 EVNKDVFGFVGLS---FYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHF 295
             N    G+V +    + ++    +KL+P+ G   ++  +  G YP+SRPL   +K+   
Sbjct: 182 SGNPGAIGYVSIGTAEYEEDRGTPIKLLPMAGQPATVEAVAKGGYPLSRPLNLVIKKTRS 241

Query: 296 NSVLGLREYVSFSVSDEM 313
             V   +++++F+ S E+
Sbjct: 242 GLV---KDFIAFAQSAEV 256


>gi|21228107|ref|NP_634029.1| phosphate-binding protein [Methanosarcina mazei Go1]
 gi|20906548|gb|AAM31701.1| Phosphate-binding protein [Methanosarcina mazei Go1]
          Length = 302

 Score = 57.0 bits (136), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 68/287 (23%), Positives = 120/287 (41%), Gaps = 56/287 (19%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I + GS T+ P ++  AE F       + P      +  G       + D  +DI  +SR
Sbjct: 53  ITLKGSDTVLPLAQAEAEEFM-----LENPDKSVTVTGGGSGVGITALIDGEVDIAAASR 107

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
           +I   E++  + +G++ + E TI +DGI +V +       LT + L            + 
Sbjct: 108 EIKAEEIEAAQSNGITPV-ETTIAYDGISVVVNPGNPVSELTFDQL------------RG 154

Query: 148 VFN-PLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
           ++N  +  W ++  +  + +I +       GT E  +++VLQ             D ++ 
Sbjct: 155 IYNGSISNWKDVGGE--DRKIVVISRDSSSGTYEYFKEEVLQ------------GDEYRP 200

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
           +      A T     GI  EV             N +  G++G+++   +   L L   +
Sbjct: 201 D------ALTQPATGGIVGEVS-----------QNPNAIGYIGVAYLDQSVKALSLDAGN 243

Query: 267 GI-VPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL-REYVSFSVSD 311
           G   PS   I+SG YP+SR L FY   +      GL +E+V F +S+
Sbjct: 244 GPETPSPENILSGAYPLSRSLYFYTNGEPS----GLTKEFVDFVLSE 286


>gi|134045532|ref|YP_001097018.1| phosphate binding protein [Methanococcus maripaludis C5]
 gi|132663157|gb|ABO34803.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanococcus maripaludis C5]
          Length = 281

 Score = 56.6 bits (135), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 61/261 (23%), Positives = 111/261 (42%), Gaps = 59/261 (22%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE--SGGSSVGLKEFCRGIGDDTIDIVNS 85
           ++I+GS+T+ P   I  E   ++  + K   +E   GGS +G+KE     G++  DI  +
Sbjct: 41  LKISGSTTVLP---IAEEAAKQFMIQNKNYMIEVTGGGSGLGVKES----GENLNDIGMA 93

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR +  +E +E        +Q   I  DG+ ++   D     LT E +    A       
Sbjct: 94  SRDVKSSEFEEYPS-----LQVFGIAKDGVAIIVHPDNSVSGLTQEQIVAIYAG------ 142

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                 +  W+E+  +  +  I +Y    + GTREV  +K L +G     N +K      
Sbjct: 143 -----EITNWNEVGGE--DAPITVYTRDEESGTREVFFEKALNKG-----NITK------ 184

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
              Q + VA     +  +  +V+G                G++ + +  ++   +K    
Sbjct: 185 ---QAVVVASNGAMKSSVKADVNG---------------IGYLSIGYLDSS---VKGCEY 223

Query: 266 DGIVPSMGTIVSGLYPISRPL 286
           +G++P+   +VSG Y +SR L
Sbjct: 224 EGVLPTEANVVSGTYKVSRTL 244


>gi|270296458|ref|ZP_06202658.1| phosphate ABC transporter [Bacteroides sp. D20]
 gi|270273862|gb|EFA19724.1| phosphate ABC transporter [Bacteroides sp. D20]
          Length = 273

 Score = 56.6 bits (135), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 71/306 (23%), Positives = 122/306 (39%), Gaps = 58/306 (18%)

Query: 29  RIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRK 88
           RI GS T+ P ++  AE F    P  +        +  G       + D T DI  +SR 
Sbjct: 23  RIKGSDTVLPIAQQTAERFMTLNPSARV-----TVTGGGTGVGISALLDQTTDIAMASRA 77

Query: 89  ITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVV 148
           I  +E  + K  G  D+ EV I +D + +V         LT + L           + + 
Sbjct: 78  IKFSEKMKAK