BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780707|ref|YP_003065120.1| putative phosphate-binding
periplasmic protein [Candidatus Liberibacter asiaticus str. psy62]
         (346 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|23502986|ref|NP_699113.1| phosphate ABC transporter phosphate-binding protein [Brucella suis
           1330]
 gi|161620048|ref|YP_001593935.1| hypothetical protein BCAN_A2182 [Brucella canis ATCC 23365]
 gi|260567392|ref|ZP_05837862.1| phosphate ABC transporter [Brucella suis bv. 4 str. 40]
 gi|23349024|gb|AAN31028.1| phosphate ABC transporter, phosphate-binding protein [Brucella suis
           1330]
 gi|161336859|gb|ABX63164.1| Hypothetical protein BCAN_A2182 [Brucella canis ATCC 23365]
 gi|260156910|gb|EEW91990.1| phosphate ABC transporter [Brucella suis bv. 4 str. 40]
          Length = 348

 Score =  294 bits (752), Expect = 1e-77,   Method: Composition-based stats.
 Identities = 163/345 (47%), Positives = 229/345 (66%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M           +  V   +   AR++I+IAGSST+ PY+KI+AE F E +P FKTP VE
Sbjct: 1   MNKMISSTAALAIAAVLSVSAAQARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFC+G+G++TIDI N+SR +  +EL  C   GV D+QEV  G+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCKGVGENTIDIANASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  LT ED+YKALA+ L+VD K+V NP  KW+++ P+ P+  IA Y+P  KHGTRE
Sbjct: 121 AKGPDWKLTPEDIYKALAARLVVDGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KVL +GC  S    ++R     + +  + AC +VR+DG A+++DGDY ETLARI  
Sbjct: 181 VFEEKVLADGCKHSGALDEIRK-TGLDDKAAASACIAVRKDGKAVDIDGDYVETLARIAS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GL F++NNAD LK+  ++G+ PS  T+ SG YP+SRPL FYVK+ H   + G
Sbjct: 240 NKTGVGVFGLYFFENNADKLKVATVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+EYV F ++D+M+ PD  L +YGL+P  + ER++ R + + GK+
Sbjct: 300 LKEYVEFFLNDQMIGPDGPLAEYGLVPAPDAEREAQRTAFSEGKT 344


>gi|306842751|ref|ZP_07475393.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           BO2]
 gi|306287095|gb|EFM58600.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           BO2]
          Length = 348

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 162/345 (46%), Positives = 229/345 (66%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M           +  V   +   AR++I+IAGSST+ PY+KI+AE F E +P FKTP VE
Sbjct: 1   MNKMISSTAALAIAAVLSVSAAQARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFC+G+G++TIDI N+SR +  +EL  C   GV D+QEV  G+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCKGVGENTIDIANASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  LT ED+YKALA+ L+VD K+V NP  KW+++ P+ P+  IA Y+P  KHGTRE
Sbjct: 121 AKGPDWKLTPEDIYKALAARLVVDGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KVL +GC  S    +++     + +  + AC +VR+DG A+++DGDY ETLARI  
Sbjct: 181 VFEEKVLADGCKHSGALDEIKK-TGLDDKAAASACIAVRKDGKAVDIDGDYAETLARIAS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GL F++NNAD LK+  ++G+ PS  T+ SG YP+SRPL FYVK+ H   + G
Sbjct: 240 NKTGVGVFGLYFFENNADKLKVATVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+EYV F ++D+M+ PD  L +YGL+P  + ER++ R + + GK+
Sbjct: 300 LKEYVEFFLNDQMIGPDGPLAEYGLVPAPDAEREAQRTAFSEGKT 344


>gi|306843557|ref|ZP_07476158.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           BO1]
 gi|306276248|gb|EFM57948.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           BO1]
          Length = 348

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 162/345 (46%), Positives = 228/345 (66%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M           +  V   +   AR++I+IAGSST+ PY+KI+AE F E +P FKTP VE
Sbjct: 1   MNKMISSTAALAIAAVLSVSAAQARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFC+G+G++TIDI N+SR +  +EL  C   GV D+QEV  G+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCKGVGENTIDIANASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  LT ED+YKAL + L+VD K+V NP  KW+++ P+ P+  IA Y+P  KHGTRE
Sbjct: 121 AKGPDWKLTPEDIYKALVARLVVDGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KVL +GC  S    ++R     + +  + AC +VR+DG A+++DGDY ETLARI  
Sbjct: 181 VFEEKVLADGCKHSGALDEIRK-TGLDDKAAASACIAVRKDGKAVDIDGDYAETLARIAS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GL F++NNAD LK+  ++G+ PS  T+ SG YP+SRPL FYVK+ H   + G
Sbjct: 240 NKTGVGVFGLYFFENNADKLKVATVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+EYV F ++D+M+ PD  L +YGL+P  + ER++ R + + GK+
Sbjct: 300 LKEYVEFFLNDQMIGPDGPLAEYGLVPAPDAEREAQRTAFSEGKT 344


>gi|62290977|ref|YP_222770.1| phosphate ABC transporter phosphate-binding protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82700887|ref|YP_415461.1| hypothetical protein BAB1_2141 [Brucella melitensis biovar Abortus
           2308]
 gi|163844153|ref|YP_001628558.1| hypothetical protein BSUIS_A1977 [Brucella suis ATCC 23445]
 gi|189025190|ref|YP_001935958.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           abortus S19]
 gi|225626508|ref|ZP_03784547.1| phosphate ABC transporter, phosphate-binding protein [Brucella ceti
           str. Cudo]
 gi|225853565|ref|YP_002733798.1| hypothetical protein BMEA_A2199 [Brucella melitensis ATCC 23457]
 gi|237816481|ref|ZP_04595474.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           abortus str. 2308 A]
 gi|254690272|ref|ZP_05153526.1| hypothetical protein Babob68_08887 [Brucella abortus bv. 6 str.
           870]
 gi|254694759|ref|ZP_05156587.1| hypothetical protein Babob3T_08878 [Brucella abortus bv. 3 str.
           Tulya]
 gi|254696387|ref|ZP_05158215.1| hypothetical protein Babob28_01393 [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254700769|ref|ZP_05162597.1| hypothetical protein Bsuib55_07912 [Brucella suis bv. 5 str. 513]
 gi|254707344|ref|ZP_05169172.1| hypothetical protein BpinM_10305 [Brucella pinnipedialis
           M163/99/10]
 gi|254709114|ref|ZP_05170925.1| hypothetical protein BpinB_02372 [Brucella pinnipedialis B2/94]
 gi|254713460|ref|ZP_05175271.1| hypothetical protein BcetM6_08914 [Brucella ceti M644/93/1]
 gi|254716184|ref|ZP_05177995.1| hypothetical protein BcetM_07081 [Brucella ceti M13/05/1]
 gi|254718178|ref|ZP_05179989.1| hypothetical protein Bru83_01291 [Brucella sp. 83/13]
 gi|254731301|ref|ZP_05189879.1| hypothetical protein Babob42_08915 [Brucella abortus bv. 4 str.
           292]
 gi|256030640|ref|ZP_05444254.1| hypothetical protein BpinM2_08302 [Brucella pinnipedialis
           M292/94/1]
 gi|256045744|ref|ZP_05448622.1| hypothetical protein Bmelb1R_14660 [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256060101|ref|ZP_05450283.1| hypothetical protein Bneo5_07051 [Brucella neotomae 5K33]
 gi|256112463|ref|ZP_05453384.1| hypothetical protein Bmelb3E_07253 [Brucella melitensis bv. 3 str.
           Ether]
 gi|256158642|ref|ZP_05456525.1| hypothetical protein BcetM4_07216 [Brucella ceti M490/95/1]
 gi|256254046|ref|ZP_05459582.1| hypothetical protein BcetB_07058 [Brucella ceti B1/94]
 gi|256258525|ref|ZP_05464061.1| hypothetical protein Babob9C_14492 [Brucella abortus bv. 9 str.
           C68]
 gi|256262951|ref|ZP_05465483.1| phosphate ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|256370534|ref|YP_003108045.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           microti CCM 4915]
 gi|260169544|ref|ZP_05756355.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           F5/99]
 gi|260546241|ref|ZP_05821981.1| phosphate ABC transporter [Brucella abortus NCTC 8038]
 gi|260563040|ref|ZP_05833526.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. 16M]
 gi|260755811|ref|ZP_05868159.1| phosphate ABC transporter [Brucella abortus bv. 6 str. 870]
 gi|260759034|ref|ZP_05871382.1| phosphate ABC transporter [Brucella abortus bv. 4 str. 292]
 gi|260760759|ref|ZP_05873102.1| phosphate ABC transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260884836|ref|ZP_05896450.1| phosphate ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|261215086|ref|ZP_05929367.1| phosphate ABC transporter [Brucella abortus bv. 3 str. Tulya]
 gi|261217957|ref|ZP_05932238.1| phosphate ABC transporter [Brucella ceti M13/05/1]
 gi|261221186|ref|ZP_05935467.1| phosphate ABC transporter [Brucella ceti B1/94]
 gi|261314827|ref|ZP_05954024.1| phosphate ABC transporter [Brucella pinnipedialis M163/99/10]
 gi|261316614|ref|ZP_05955811.1| phosphate ABC transporter [Brucella pinnipedialis B2/94]
 gi|261321193|ref|ZP_05960390.1| phosphate ABC transporter [Brucella ceti M644/93/1]
 gi|261324077|ref|ZP_05963274.1| phosphate ABC transporter [Brucella neotomae 5K33]
 gi|261751278|ref|ZP_05994987.1| phosphate ABC transporter [Brucella suis bv. 5 str. 513]
 gi|261759071|ref|ZP_06002780.1| phosphate ABC transporter [Brucella sp. F5/99]
 gi|265983135|ref|ZP_06095870.1| phosphate ABC transporter [Brucella sp. 83/13]
 gi|265987686|ref|ZP_06100243.1| phosphate ABC transporter [Brucella pinnipedialis M292/94/1]
 gi|265992160|ref|ZP_06104717.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. Rev.1]
 gi|265993898|ref|ZP_06106455.1| phosphate ABC transporter [Brucella melitensis bv. 3 str. Ether]
 gi|265997147|ref|ZP_06109704.1| phosphate ABC transporter [Brucella ceti M490/95/1]
 gi|294851366|ref|ZP_06792039.1| phosphate transport system substrate-binding protein [Brucella sp.
           NVSL 07-0026]
 gi|297247364|ref|ZP_06931082.1| phosphate transport system substrate-binding protein [Brucella
           abortus bv. 5 str. B3196]
 gi|306837693|ref|ZP_07470562.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           NF 2653]
 gi|62197109|gb|AAX75409.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           abortus bv. 1 str. 9-941]
 gi|82616988|emb|CAJ12097.1| unnamed protein product [Brucella melitensis biovar Abortus 2308]
 gi|163674876|gb|ABY38987.1| Hypothetical protein BSUIS_A1977 [Brucella suis ATCC 23445]
 gi|189020762|gb|ACD73484.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           abortus S19]
 gi|225618165|gb|EEH15208.1| phosphate ABC transporter, phosphate-binding protein [Brucella ceti
           str. Cudo]
 gi|225641930|gb|ACO01844.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457]
 gi|237788548|gb|EEP62763.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           abortus str. 2308 A]
 gi|256000697|gb|ACU49096.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           microti CCM 4915]
 gi|260096348|gb|EEW80224.1| phosphate ABC transporter [Brucella abortus NCTC 8038]
 gi|260153056|gb|EEW88148.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. 16M]
 gi|260669352|gb|EEX56292.1| phosphate ABC transporter [Brucella abortus bv. 4 str. 292]
 gi|260671191|gb|EEX58012.1| phosphate ABC transporter [Brucella abortus bv. 2 str. 86/8/59]
 gi|260675919|gb|EEX62740.1| phosphate ABC transporter [Brucella abortus bv. 6 str. 870]
 gi|260874364|gb|EEX81433.1| phosphate ABC transporter [Brucella abortus bv. 9 str. C68]
 gi|260916693|gb|EEX83554.1| phosphate ABC transporter [Brucella abortus bv. 3 str. Tulya]
 gi|260919770|gb|EEX86423.1| phosphate ABC transporter [Brucella ceti B1/94]
 gi|260923046|gb|EEX89614.1| phosphate ABC transporter [Brucella ceti M13/05/1]
 gi|261293883|gb|EEX97379.1| phosphate ABC transporter [Brucella ceti M644/93/1]
 gi|261295837|gb|EEX99333.1| phosphate ABC transporter [Brucella pinnipedialis B2/94]
 gi|261300057|gb|EEY03554.1| phosphate ABC transporter [Brucella neotomae 5K33]
 gi|261303853|gb|EEY07350.1| phosphate ABC transporter [Brucella pinnipedialis M163/99/10]
 gi|261739055|gb|EEY27051.1| phosphate ABC transporter [Brucella sp. F5/99]
 gi|261741031|gb|EEY28957.1| phosphate ABC transporter [Brucella suis bv. 5 str. 513]
 gi|262551615|gb|EEZ07605.1| phosphate ABC transporter [Brucella ceti M490/95/1]
 gi|262764879|gb|EEZ10800.1| phosphate ABC transporter [Brucella melitensis bv. 3 str. Ether]
 gi|263003226|gb|EEZ15519.1| phosphate ABC transporter [Brucella melitensis bv. 1 str. Rev.1]
 gi|263092825|gb|EEZ17000.1| phosphate ABC transporter [Brucella melitensis bv. 2 str. 63/9]
 gi|264659883|gb|EEZ30144.1| phosphate ABC transporter [Brucella pinnipedialis M292/94/1]
 gi|264661727|gb|EEZ31988.1| phosphate ABC transporter [Brucella sp. 83/13]
 gi|294819955|gb|EFG36954.1| phosphate transport system substrate-binding protein [Brucella sp.
           NVSL 07-0026]
 gi|297174533|gb|EFH33880.1| phosphate transport system substrate-binding protein [Brucella
           abortus bv. 5 str. B3196]
 gi|306407251|gb|EFM63461.1| phosphate ABC transporter, phosphate-binding protein [Brucella sp.
           NF 2653]
 gi|326410137|gb|ADZ67202.1| phosphate ABC transporter, phosphate-binding protein [Brucella
           melitensis M28]
 gi|326539857|gb|ADZ88072.1| conserved hypothetical protein [Brucella melitensis M5-90]
          Length = 348

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 163/345 (47%), Positives = 229/345 (66%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M           +  V   +   AR++I+IAGSST+ PY+KI+AE F E +P FKTP VE
Sbjct: 1   MNKMISSTAALAIAAVLSVSAAQARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFC+G+G++TIDI N+SR +  +EL  C   GV D+QEV  G+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCKGVGENTIDIANASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  LT ED+YKALA+ L+VD K+V NP  KW+++ P+ P+  IA Y+P  KHGTRE
Sbjct: 121 AKGPDWKLTPEDIYKALAARLVVDGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KVL +GC  S    ++R     + +  + AC +VR+DG A+++DGDY ETLARI  
Sbjct: 181 VFEEKVLADGCKHSGALDEIRK-TGLDDKAAASACIAVRKDGKAVDIDGDYAETLARIAS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GL F++NNAD LK+  ++G+ PS  T+ SG YP+SRPL FYVK+ H   + G
Sbjct: 240 NKTGVGVFGLYFFENNADKLKVATVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+EYV F ++D+M+ PD  L +YGL+P  + ER++ R + + GK+
Sbjct: 300 LKEYVEFFLNDQMIGPDGPLAEYGLVPAPDAEREAQRTAFSEGKT 344


>gi|254705139|ref|ZP_05166967.1| hypothetical protein Bsuib36_14706 [Brucella suis bv. 3 str. 686]
 gi|261755843|ref|ZP_05999552.1| phosphate ABC transporter [Brucella suis bv. 3 str. 686]
 gi|261745596|gb|EEY33522.1| phosphate ABC transporter [Brucella suis bv. 3 str. 686]
          Length = 348

 Score =  294 bits (751), Expect = 2e-77,   Method: Composition-based stats.
 Identities = 162/345 (46%), Positives = 228/345 (66%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M           +  V   +   AR++I+IAGSST+ PY+KI+AE F E +P FKTP VE
Sbjct: 1   MNKMISSTAALAIAAVLSVSAAQARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFC+G+G++TIDI N+SR +  +EL  C   GV D+QEV  G+DGI+  + 
Sbjct: 61  SGGSGAGIKEFCKGVGENTIDIANASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATG 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  LT ED+YKALA+ L+VD K+V NP  KW+++ P+ P+  IA Y+P  KHGTRE
Sbjct: 121 AKGPDWKLTPEDIYKALAARLVVDGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KVL +GC  S    ++R     + +  + AC +VR+DG A+++DGDY ETLARI  
Sbjct: 181 VFEEKVLADGCKHSGALDEIRK-TGLDDKAAASACIAVRKDGKAVDIDGDYVETLARIAS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GL F++NNAD LK+  ++G+ PS  T+ SG YP+SRPL FYVK+ H   + G
Sbjct: 240 NKTGVGVFGLYFFENNADKLKVATVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+EYV F ++D+M+ PD  L +YGL+P  + ER++ R + + GK+
Sbjct: 300 LKEYVEFFLNDQMIGPDGPLAEYGLVPAPDAEREAQRTAFSEGKT 344


>gi|148559644|ref|YP_001259936.1| phosphate ABC transporter phosphate-binding protein [Brucella ovis
           ATCC 25840]
 gi|148370901|gb|ABQ60880.1| phosphate ABC transporter, phosphate-binding protein [Brucella ovis
           ATCC 25840]
          Length = 348

 Score =  293 bits (748), Expect = 4e-77,   Method: Composition-based stats.
 Identities = 163/345 (47%), Positives = 229/345 (66%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M           +  V   +   AR++I+IAGSST+ PY+KI+AE F E +P FKTP VE
Sbjct: 1   MNKMISSTAALAIAAVLSVSAAQARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFC+G+G++TIDI N+SR +  +EL  C   GV D+QEV  G+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCKGVGENTIDIANASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  LT ED+YKALA+ L+VD K+V NP  KW+++ P+ P+  IA Y+P  KHGTRE
Sbjct: 121 AKGPDWKLTPEDIYKALAARLVVDGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KVL +GC  S    ++R     + +  + AC +VR+DG A+++DGDY ETLARI  
Sbjct: 181 VFEEKVLADGCKHSGALDEIRK-TGLDDKAAASACIAVRKDGKAVDIDGDYAETLARIAS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GL F++NNAD LK+  ++G+ PS  T+ SG YP+SRPL FYVK+ H   + G
Sbjct: 240 NKTGVGVFGLYFFENNADKLKVATVNGVKPSAETVASGGYPVSRPLYFYVKKAHLGVIPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+EYV F ++D+M+ PD  L +YGL+P  + ER++ R + + GK+
Sbjct: 300 LKEYVEFFLNDQMIGPDGPLAEYGLVPAPDAEREAQRTAFSEGKT 344


>gi|17988272|ref|NP_540906.1| phosphate-binding periplasmic protein [Brucella melitensis bv. 1
           str. 16M]
 gi|17984042|gb|AAL53170.1| phosphate-binding periplasmic protein [Brucella melitensis bv. 1
           str. 16M]
          Length = 345

 Score =  288 bits (737), Expect = 7e-76,   Method: Composition-based stats.
 Identities = 162/342 (47%), Positives = 228/342 (66%), Gaps = 1/342 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
                    +  V   +   AR++I+IAGSST+ PY+KI+AE F E +P FKTP VESGG
Sbjct: 1   MISSTAALAIAAVLSVSAAQARDQIQIAGSSTVLPYAKIVAETFGETYPNFKTPVVESGG 60

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G+KEFC+G+G++TIDI N+SR +  +EL  C   GV D+QEV  G+DGI+  +D   
Sbjct: 61  SGAGIKEFCKGVGENTIDIANASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATDAKG 120

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
               LT ED+YKALA+ L+VD K+V NP  KW+++ P+ P+  IA Y+P  KHGTREV E
Sbjct: 121 PDWKLTPEDIYKALAARLVVDGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTREVFE 180

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KVL +GC  S    ++R     + +  + AC +VR+DG A+++DGDY ETLARI  NK 
Sbjct: 181 EKVLADGCKHSGALDEIRK-TGLDDKAAASACIAVRKDGKAVDIDGDYAETLARIASNKT 239

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GL F++NNAD LK+  ++G+ PS  T+ SG YP+SRPL FYVK+ H   + GL+E
Sbjct: 240 GVGVFGLYFFENNADKLKVATVNGVKPSAETVASGEYPVSRPLYFYVKKAHLGVIPGLKE 299

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           YV F ++D+M+ PD  L +YGL+P  + ER++ R + + GK+
Sbjct: 300 YVEFFLNDQMIGPDGPLAEYGLVPAPDAEREAQRTAFSEGKT 341


>gi|153008107|ref|YP_001369322.1| phosphate ABC transporter phosphate-binding protein [Ochrobactrum
           anthropi ATCC 49188]
 gi|151559995|gb|ABS13493.1| phosphate ABC transporter, phosphate-binding protein [Ochrobactrum
           anthropi ATCC 49188]
          Length = 348

 Score =  288 bits (736), Expect = 9e-76,   Method: Composition-based stats.
 Identities = 161/345 (46%), Positives = 227/345 (65%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M           +  V   +   AR++I++AGSST+ PY+KI+AE F E FP FKTP VE
Sbjct: 1   MNKMISSTAALAIAAVMSVSAAQARDQIQVAGSSTVLPYAKIVAETFGETFPNFKTPVVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFC+G+G++TIDI N+SR +  +EL  C   GV D+QEV  G+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCKGVGENTIDIANASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  L  ED+YKALA+ L+VD K+V NP  KW+++ P+ P+  IA Y+P  KHGTRE
Sbjct: 121 AKGPDWKLKPEDVYKALAAKLVVDGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KVL +GC  S    +++     + +  + AC +VR+DG A+++DGDY ETLARI+ 
Sbjct: 181 VFEEKVLADGCKHSGALDEIKK-TGLDDKAAASACIAVRKDGKAVDIDGDYAETLARIDS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GL F++NNAD LK+  ++ I PS  T+ SG YP+SRPL FYVK+ H   + G
Sbjct: 240 NKTGVGVFGLYFFENNADKLKVATVNDITPSAETVASGEYPVSRPLFFYVKKAHLGVIPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+EYV F ++D+M+ PD  L +YGL+P  + ER++ R +   GK+
Sbjct: 300 LKEYVEFFLNDQMIGPDGPLAEYGLVPAPDAEREAQRAAFTEGKT 344


>gi|239833188|ref|ZP_04681517.1| phosphate ABC transporter, phosphate-binding protein [Ochrobactrum
           intermedium LMG 3301]
 gi|239825455|gb|EEQ97023.1| phosphate ABC transporter, phosphate-binding protein [Ochrobactrum
           intermedium LMG 3301]
          Length = 348

 Score =  286 bits (732), Expect = 3e-75,   Method: Composition-based stats.
 Identities = 160/345 (46%), Positives = 228/345 (66%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M           +  V   +   AR++I++AGSST+ PY+KI+AE F E FP FKTP VE
Sbjct: 1   MNKMISSTAALAIAAVMSVSAAQARDQIQVAGSSTVLPYAKIVAETFGETFPNFKTPVVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFC+G+G++TIDI N+SR +  +EL  C   GV D+QEV  G+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCKGVGENTIDIANASRAMKDSELKSCIDAGVKDVQEVRFGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  L  ED+YKALA+ L+VD K+V NP  KW+++ P+ P+  IA Y+P  KHGTRE
Sbjct: 121 AKGPDWKLKPEDVYKALAAKLVVDGKLVDNPNTKWNQVNPNLPDWDIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KVL +GC  S    +++     + +  + AC +VR+DG A+++DGDY ETLARI+ 
Sbjct: 181 VFEEKVLADGCKHSGALDEIKK-TGLDDKAAASACIAVRKDGKAVDIDGDYAETLARIDS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GL F++NNAD LK+  ++ + PS  T+ SG YP+SRPL FYVK+ H   + G
Sbjct: 240 NKTGVGVFGLYFFENNADKLKVATVNDVTPSAATVASGEYPVSRPLFFYVKKAHLGVIPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+EYV F ++D+M+ PD  L +YGL+P  + ER++ R + + GK+
Sbjct: 300 LKEYVEFFLNDQMIGPDGPLAEYGLVPAPDAEREAQRAAFSEGKT 344


>gi|301063444|ref|ZP_07203976.1| phosphate binding protein [delta proteobacterium NaphS2]
 gi|300442383|gb|EFK06616.1| phosphate binding protein [delta proteobacterium NaphS2]
          Length = 349

 Score =  283 bits (722), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 114/348 (32%), Positives = 186/348 (53%), Gaps = 9/348 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+     ++  +V  V       AR+ + I GSST++P++ ++AE F +   +F TP +E
Sbjct: 1   MKRI--CVLALMVAFVLSAGVAVARDTVAIVGSSTVYPFATVVAEQFGK-TSKFNTPKIE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  GLK FC G+G +  DI N+SR+I  +E   C+K+GV D+ EV IG+DGI+L + 
Sbjct: 58  STGSGGGLKLFCAGVGVEHPDITNASRRIKVSECVMCEKNGVKDVIEVKIGYDGIVLANS 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVD---DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           +      LT  D++ ALA  +      +K+V NP K W ++ P+ P ++I +  P    G
Sbjct: 118 KKTAPFKLTQRDIFLALAKDVPDPSGAEKLVLNPNKTWKDVNPELPAIKIEVLGPPPTSG 177

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           TR+   +  ++ G      F  ++ M + + +Q    C ++R+DG  +E   +    + +
Sbjct: 178 TRDAFVELGMEPGGKS---FKWIKAMKRKDKKQYKAICHTIREDGAYVEAGENDNLIVQK 234

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           +  N D  G  G SF   N D ++   ID + P+  +I  G YP+SRPL FYVK+ H   
Sbjct: 235 LNANPDALGIFGFSFLDQNTDKIQGSFIDNVPPTFDSIADGSYPLSRPLFFYVKKAHIQV 294

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           + G +EY+    S++   PD  L   G+IP+  EER+  R  +    +
Sbjct: 295 IPGTKEYLEEFTSEKAWGPDGYLADKGMIPMPEEEREYYRKVVQSLTT 342


>gi|222084779|ref|YP_002543308.1| phosphate ABC transporter [Agrobacterium radiobacter K84]
 gi|221722227|gb|ACM25383.1| phosphate ABC transporter [Agrobacterium radiobacter K84]
          Length = 344

 Score =  279 bits (712), Expect = 5e-73,   Method: Composition-based stats.
 Identities = 171/340 (50%), Positives = 225/340 (66%), Gaps = 1/340 (0%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
               +  +V  V       AR++I+I+GSST+FPY+KI+AE F E F  +KTP VESGGS
Sbjct: 4   LKSSIAALVASVTFAGAAMARDQIQISGSSTVFPYAKIVAETFGETFTNYKTPVVESGGS 63

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             GLKEFC+G+G D+IDI NSSR I  +E+D CK  GV+DIQ+V IG+DGI+   D+   
Sbjct: 64  GAGLKEFCKGVGPDSIDIANSSRPIKGSEVDACKAAGVADIQQVKIGYDGIVFAYDKSNP 123

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
            +     DLYKALA+ ++V+ K+V NP KKWSEI P  P+  IA Y+P  KHGTREV E+
Sbjct: 124 DIRFVPTDLYKALAAEVVVNGKLVANPYKKWSEINPALPDFEIAAYIPGEKHGTREVFEE 183

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
           KVL  GC  S     ++     +  + +  C +VR+DG+A+++DGDY ETLARI  NK  
Sbjct: 184 KVLAAGCKDSGALDVIKAAV-PDAGKQAEKCIAVRKDGVAVDIDGDYPETLARINANKHG 242

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G  GL FY+NNAD LK+  + GIVPS  TI  G YP+SRPL FYVK+ H   + GL+EY
Sbjct: 243 VGVFGLYFYQNNADKLKVATVGGIVPSGQTIADGTYPVSRPLFFYVKKAHLGVIPGLKEY 302

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           V F  SD+M+ PDS L +YGL+P  + ER  +R  +A GK
Sbjct: 303 VDFFTSDQMIGPDSPLAEYGLVPAPDAERDQIRKDVANGK 342


>gi|254780707|ref|YP_003065120.1| putative phosphate-binding periplasmic protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040384|gb|ACT57180.1| putative phosphate-binding periplasmic protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 346

 Score =  275 bits (702), Expect = 8e-72,   Method: Composition-based stats.
 Identities = 346/346 (100%), Positives = 346/346 (100%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE
Sbjct: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD
Sbjct: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE
Sbjct: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV
Sbjct: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG
Sbjct: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG
Sbjct: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346


>gi|240849904|ref|YP_002971293.1| periplasmic phosphate binding protein [Bartonella grahamii as4aup]
 gi|240267027|gb|ACS50615.1| periplasmic phosphate binding protein [Bartonella grahamii as4aup]
          Length = 348

 Score =  274 bits (700), Expect = 1e-71,   Method: Composition-based stats.
 Identities = 157/343 (45%), Positives = 223/343 (65%), Gaps = 1/343 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M     + +  +   +    G  AR++I+I GSST+ PY KI+AE F E +P FK P +E
Sbjct: 1   MSRVLSIGVGLIFALLLSANGGNARDQIQITGSSTVLPYQKIVAETFGEIYPHFKVPVIE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGG+  G+KEFCRGIG++T+DIVN+SR +  +EL  C   GV D++E+ IG+DGI+  +D
Sbjct: 61  SGGTGAGIKEFCRGIGENTVDIVNASRAMKPSELQSCFDAGVKDVEEIRIGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  L   D+YKALA+ +I+D K+  N + KWS +    P+  IA Y+P  KHGTRE
Sbjct: 121 IKGPDWKLKPVDVYKALAARIIIDGKLQPNNVLKWSAVNSALPDWTIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+K+L EGC  S     M+ +   + +++  AC +VR+DG A+++DGDY+ET AR+  
Sbjct: 181 VFEEKLLTEGCKESGAVEVMKSL-GMDDKEIHTACIAVRKDGKAVDIDGDYSETFARLTS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GLSFY+NNAD LK+  I+G  P++ TI SG YP+SRPL FY+K+ H + V G
Sbjct: 240 NKTGVGIFGLSFYQNNADRLKVADINGFAPTVETISSGQYPVSRPLFFYIKKAHLDIVSG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           LREYV F +SD+M+ PD  L +YGLI    +ER++ R   + G
Sbjct: 300 LREYVDFFLSDQMIGPDGPLAEYGLIVSPEKERQAQRSDFSTG 342


>gi|121602675|ref|YP_989480.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Bartonella bacilliformis KC583]
 gi|120614852|gb|ABM45453.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Bartonella bacilliformis KC583]
          Length = 348

 Score =  273 bits (698), Expect = 2e-71,   Method: Composition-based stats.
 Identities = 160/342 (46%), Positives = 221/342 (64%), Gaps = 1/342 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M     V +  + +       + AR+RI+IAGSST+ PY KI+AE F E +P F+ P VE
Sbjct: 1   MSKLSSVGVGLIFMVTSLVDVSNARDRIQIAGSSTVLPYVKIVAETFGEVYPNFRIPVVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFCRGIG  TIDIVN+SR +  +EL  C   GV DI+EV IG+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCRGIGKSTIDIVNTSRAMKPSELRSCFDAGVKDIEEVRIGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  L   D+YKALA+ ++V+ K+  N ++KWS +    P+  IA+Y+P  KHGTRE
Sbjct: 121 ISGPDWELRPIDIYKALAAQVMVNGKLQPNKVRKWSAVNSALPDWVIAVYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+K+L EGC  S     M+ +   N ++++ AC +VR+DG AI++DGDY+ET AR+  
Sbjct: 181 VFEEKLLIEGCKDSGAVKAMKAL-GMNDKEINAACIAVRKDGKAIDIDGDYSETFARLTS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +K   G    SFY+NNAD +K+V I+ + P   TI SG YP+SRPL FYVK++H   V G
Sbjct: 240 HKTGIGVFSWSFYENNADKIKVVRINDVEPITETIFSGQYPVSRPLFFYVKKEHLGIVPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           L EYV F +S+EM+ PD  L +YGL+    +ER+  RDS + 
Sbjct: 300 LWEYVDFFLSEEMIGPDGPLAEYGLVIAPEKERQEQRDSFSA 341


>gi|254487390|ref|ZP_05100595.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. GAI101]
 gi|214044259|gb|EEB84897.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. GAI101]
          Length = 359

 Score =  273 bits (696), Expect = 4e-71,   Method: Composition-based stats.
 Identities = 156/339 (46%), Positives = 222/339 (65%), Gaps = 3/339 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              +    + +   C T   AR+++++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 16  LVKLTTSALAISAVCATAAVARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 74

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TIDI N+SRKI  +E + C  +GV+DI EV IG+DGI+  SD D 
Sbjct: 75  SSAGLKRFCEGVGENTIDIANASRKIKSSEQEVCASNGVTDIIEVQIGYDGIVFASDIDG 134

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            +   T ED YKAL++ ++VD  +V NP K WSE+   FP+  I  Y+P  KHGTREV E
Sbjct: 135 NTFEFTPEDWYKALSAEVVVDGAIVANPYKNWSEVNASFPDQPIQAYIPGTKHGTREVFE 194

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  + +F   +     + +    AC ++R DG ++++DGDYTETLARIE NKD
Sbjct: 195 EKVILAGCEATGDFEAFKAANGDDKKAAEKACIALRTDGASVDIDGDYTETLARIESNKD 254

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GL+FY+NN D L +  + G+ P++ TI +G YP+SRPL FYVK+ H   + GL+E
Sbjct: 255 GIGVFGLAFYENNTDKLSVATMSGVEPTVETISTGDYPVSRPLFFYVKKAHIGVIPGLKE 314

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           +  F V+DE+  PD  L +YGL+  S+ E  +V+D++A 
Sbjct: 315 FAEFFVADEIAGPDGPLAEYGLV--SDPELATVQDTVAN 351


>gi|90418936|ref|ZP_01226847.1| periplasmic phosphate-binding protein, ABC-type transporter
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90337016|gb|EAS50721.1| periplasmic phosphate-binding protein, ABC-type transporter
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 350

 Score =  272 bits (694), Expect = 7e-71,   Method: Composition-based stats.
 Identities = 153/344 (44%), Positives = 207/344 (60%), Gaps = 1/344 (0%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           +     L     L +       +  ++++AGSST+ PY++I+AENF E FP+F TP VES
Sbjct: 3   KKLIASLALGTALALTGQAAAQSNEQVQVAGSSTVLPYAQIVAENFGEVFPDFPTPIVES 62

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
           GGSS GLK+FC+G+G DTID+ N+SR I  +EL  C   GV+D+QEV  G+DGI+  SD 
Sbjct: 63  GGSSAGLKQFCQGVGPDTIDVANASRAIRPSELKACADAGVTDVQEVRFGYDGIVFASDA 122

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
                +LT E ++KA+A+ ++ D KVV NP   WSEI    P+ +I  ++P+  HGTREV
Sbjct: 123 AGPDFALTPEMVFKAMAAKIVQDGKVVDNPYGNWSEIDASLPDQKITAFIPASNHGTREV 182

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
            E+KVL  GC  S            +       C  +R D    E+ GDYTETL+RI+ +
Sbjct: 183 FEEKVLAAGCEASGAIEAF-TASGMDEDAAEDQCLQIRNDNTVSEISGDYTETLSRIDAD 241

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL 301
           K   G  GL+FY+ N D LK+  I+ IVPS   I SG YP+SRPL FYVK+ H   V GL
Sbjct: 242 KQAIGVFGLAFYEQNQDKLKVATINDIVPSADAIASGEYPVSRPLYFYVKKAHIGVVPGL 301

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
            EYV F +SD+M  PDS L +YGL+P    ER+  R +   G +
Sbjct: 302 SEYVQFFLSDQMTGPDSPLVEYGLVPAPEAEREEQRSTFEAGDT 345


>gi|319781149|ref|YP_004140625.1| phosphate ABC transporter phosphate-binding protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
 gi|317167037|gb|ADV10575.1| phosphate ABC transporter, phosphate-binding protein [Mesorhizobium
           ciceri biovar biserrulae WSM1271]
          Length = 342

 Score =  271 bits (693), Expect = 9e-71,   Method: Composition-based stats.
 Identities = 167/345 (48%), Positives = 229/345 (66%), Gaps = 4/345 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ F        +          AR++I++AGSST+ PY+KI+AE F E F  FKTP VE
Sbjct: 1   MKKFLYTASAAALALAASSGFAAARDQIQVAGSSTVLPYAKIVAEQFGETFTNFKTPVVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFC+G+G+DTIDI NSSR I  +EL  C   GV ++QEV IG+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCKGVGEDTIDIANSSRPIKADELKSCAAAGVKEVQEVRIGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                 +L   D+YKALA+ L+VD K+V NP  KWS++ P  P+  IA Y+P  KHGTRE
Sbjct: 121 IKGPDWALVPADIYKALAAKLVVDGKLVDNPNTKWSQVNPKLPDWDIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E K+L  GC +    + ++     + +++   C ++R+DG A+++DGDYTETLARI+ 
Sbjct: 181 VFETKLLDAGCDK----AALKAAGVADDKEIGKTCIAIRKDGKAVDIDGDYTETLARIDS 236

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GL+FY+NNAD LK+  ++GIVPS  TI SG YP+SRPL FYVK+ H   V G
Sbjct: 237 NKTGVGVFGLAFYENNADKLKVATVEGIVPSTETIASGKYPVSRPLFFYVKKAHLGVVPG 296

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+EYV F + D+M+ P+S L +YGL+   + ER++ RD+ A GKS
Sbjct: 297 LKEYVEFFLDDQMVGPESPLAEYGLVAAPDAERQAQRDAFAAGKS 341


>gi|53804700|ref|YP_113429.1| phosphate binding protein [Methylococcus capsulatus str. Bath]
 gi|53758461|gb|AAU92752.1| putative phosphate binding protein [Methylococcus capsulatus str.
           Bath]
          Length = 351

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 119/351 (33%), Positives = 185/351 (52%), Gaps = 11/351 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA--RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           M+  F + +         G       R+ I I GSST++P++ ++AE+F +   +FKTP 
Sbjct: 1   MKKIFSIGLAVSATVFGAGASAAGGGRDTISIVGSSTVYPFATVVAEHFGKG-GKFKTPK 59

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           VES G+  G+K FC G G D  DI N+SR++   E  +CKK+GV DI EV IG DGI+L 
Sbjct: 60  VESTGTGGGIKLFCAGEGVDHPDIANASRRMKDTEFQQCKKNGVKDIVEVKIGFDGIVLA 119

Query: 119 SDRDMVSVSLTVEDLYKALASYLIV-----DDKVVFNPLKKWSEIRPDFPEVRIAIYVPS 173
             +    + L+ +D+Y ALA  +        D ++ NP K W+E+ P  P  +I +  P 
Sbjct: 120 RSKKSKPMELSRKDIYLALAKQIPDPDCGGCDNLIDNPYKTWNEVNPALPATKIEVLGPP 179

Query: 174 GKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTE 233
              GTR+   +  L+ GC   + F  +  + K N  +    C +VR+DG  +E   +   
Sbjct: 180 PTSGTRDAFAELALEGGC---KEFKWIAALKKDNEPEYKKVCHTVREDGAYVEAGENDNL 236

Query: 234 TLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
            + ++  N +  G  G SF + NAD +    I+G+ PS  +I  G Y ISRPL FYVK+ 
Sbjct: 237 IVQKLVANPNAVGIFGYSFLEENADKVAAAKIEGVDPSFESIADGSYSISRPLYFYVKKS 296

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           H   + G+ EY++   S++    D  L + GL+P+  +ERK + +     K
Sbjct: 297 HVGMIPGIVEYIAEFTSEKAWGEDGYLSERGLVPLPADERKEMAEDAKKLK 347


>gi|163867535|ref|YP_001608734.1| periplasmic phosphate binding protein [Bartonella tribocorum CIP
           105476]
 gi|161017181|emb|CAK00739.1| periplasmic phosphate binding protein [Bartonella tribocorum CIP
           105476]
          Length = 348

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 155/345 (44%), Positives = 222/345 (64%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M     + +  V   +       AR++I++ GSST+ PY KI+AE F E +P FK P +E
Sbjct: 1   MSRVLSIGVGLVFALLLSVNVGNARDQIQVTGSSTVLPYQKIVAETFGEIYPHFKVPVIE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGG+  G+KEFCRGIG++T+DIVN+SR +  +EL  C   GV D++E+ IG+DGI+  +D
Sbjct: 61  SGGTGAGIKEFCRGIGENTVDIVNASRAMKSSELQSCFDAGVKDVEEIRIGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  L   D+YKALA+ +IVD K+  N + KW+ +    P+  IA Y+P  KHGTRE
Sbjct: 121 IKGPDWRLQPIDVYKALAARVIVDGKLQSNHVSKWNAVNSALPDWTIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+K+L  GC  S     M+ +   N +++  AC +VR+DG A+++DGDY+ET AR+  
Sbjct: 181 VFEEKLLAVGCKESGAVKVMKSL-GMNDKEIHAACIAVRKDGKAVDIDGDYSETFARLTA 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GLSFY+NNAD LK+  I+G  P++ TI SG YP+SRPL FY+K+ H + V G
Sbjct: 240 NKTGVGIFGLSFYQNNADRLKVADINGFAPTVETISSGQYPVSRPLFFYIKKAHLDIVPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           LREYV F +SD+M+ P+  L +YGLI    +ER++ R   + G+ 
Sbjct: 300 LREYVDFFLSDQMIGPEGPLAEYGLIVAPEKERQAQRSDFSSGQV 344


>gi|258404597|ref|YP_003197339.1| periplasmic phosphate binding protein [Desulfohalobium retbaense
           DSM 5692]
 gi|257796824|gb|ACV67761.1| periplasmic phosphate binding protein [Desulfohalobium retbaense
           DSM 5692]
          Length = 337

 Score =  271 bits (692), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 115/343 (33%), Positives = 181/343 (52%), Gaps = 15/343 (4%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+      +   ++         AR++IRI GSST+FP++  +AE F     ++ TP +E
Sbjct: 1   MKRVLYCALALAMVLTIGLGTASARDQIRIVGSSTVFPFASYVAEEFGATT-DYPTPVIE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G+K F +G+G DT DI N+SR+I  +E   C+++GV DI +V IG+DGI +  +
Sbjct: 60  STGSGGGMKLFSQGVGLDTPDISNASRQIKVSEFKRCQENGVEDIVQVVIGYDGIAIAHN 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            D   ++LT E+L  A+A+ +  D K+V NP   W +I  D P   I +Y P    GTR+
Sbjct: 120 IDNPELALTREELTLAVAAEVPQDGKLVKNPYTHWDQINGDLPNREILVYGPPTSSGTRD 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E+ V++                  ++       T +RQDG+ +    +    + +++ 
Sbjct: 180 AFEELVMEAASE--------------DIDGYGGEYTKIRQDGVYVPAGENDNLIVQKLDK 225

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N +  G  G SF + N+D ++   IDG+ P    I SG YP+SR L FYVK+ H   V G
Sbjct: 226 NTEALGIFGYSFLEENSDRIQGALIDGVAPKPAAISSGEYPVSRSLFFYVKKAHLGEVDG 285

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           + EYV   +S++M+     L   GLIP+  EER++ R +    
Sbjct: 286 MEEYVDLFLSEKMIGDMGYLKGIGLIPLPKEEREAQRANWENR 328


>gi|163797109|ref|ZP_02191064.1| phosphate ABC transporter, periplasmic binding protein [alpha
           proteobacterium BAL199]
 gi|159177625|gb|EDP62178.1| phosphate ABC transporter, periplasmic binding protein [alpha
           proteobacterium BAL199]
          Length = 345

 Score =  271 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 118/343 (34%), Positives = 183/343 (53%), Gaps = 5/343 (1%)

Query: 1   MRFFFVVLMCFVVLEVYC-GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M   F  +     L V        AR++IRI GSST+FP++ ++AENF +    +KTP +
Sbjct: 1   MTSSFGKVAAIAALGVIAMAAQAEARDQIRIVGSSTVFPFATVVAENFGKVTS-YKTPVI 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES GS  GLK FC+G+G +  DI NSSR+I ++E++ C  +GV++I E+ +G DGI+L +
Sbjct: 60  ESTGSGGGLKLFCQGVGTEHPDITNSSRRIKKSEIELCATNGVAEITEIKVGFDGIVLAN 119

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            +      LT E ++ ALA  + VD K+V NP  KWS+I    P+  I +  P    GTR
Sbjct: 120 SKKAKHYDLTREQIFLALAKEVPVDGKLVANPYTKWSQIDKSLPDEPIEVLGPPPTSGTR 179

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   + V++       N + ++D+   +  +      S+R+DG  IE   +    + ++E
Sbjct: 180 DAFVELVMEHAAE---NIAFLKDLKNSDKNKFKQVYGSMREDGKFIEAGENDNLIVQKLE 236

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            N    G  G SF   NAD ++   ++G  P+   I  G YP+SR L FYVK  H   + 
Sbjct: 237 ANPAALGIFGFSFLDQNADKIQGSTVEGNNPTFEKIADGAYPVSRSLYFYVKNAHVGVIP 296

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           G++EYV+   S +    +  L   GLIP+   +RK    + A 
Sbjct: 297 GIQEYVAEFTSTKAAGQEGYLTDKGLIPLPEADRKKYEAAGAN 339


>gi|49473892|ref|YP_031934.1| periplasmic phosphate binding protein [Bartonella quintana str.
           Toulouse]
 gi|49239395|emb|CAF25733.1| Periplasmic phosphate binding protein [Bartonella quintana str.
           Toulouse]
          Length = 348

 Score =  271 bits (691), Expect = 1e-70,   Method: Composition-based stats.
 Identities = 159/343 (46%), Positives = 224/343 (65%), Gaps = 1/343 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    V +  V + +       AR++I+I GSST+ PY KI+AE F E +P  K P +E
Sbjct: 1   MKKLLSVGVGLVFVVLLSVNVGNARDQIQITGSSTVLPYQKIVAEIFGEIYPHLKIPVIE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFCRGIG+ TIDIVNSSR +  +EL  C   GV D++E+ IG+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCRGIGESTIDIVNSSRAMRPSELQSCFDAGVKDVEEIRIGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +     L   D+Y+ALA+ ++V+ K+  N + KW  I+   P+  IA Y+P  KHGTRE
Sbjct: 121 INGPDWKLEPIDVYRALAAQVVVNGKLQSNKISKWKAIKSTLPDWPIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+K+L  GC  S     M+ +   + + +  AC +VR+DG  I++DGDY+ET AR+  
Sbjct: 181 VFEEKLLVAGCKASGAVEAMKFL-GMDDKAIHAACIAVRKDGKVIDIDGDYSETFARLTS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GLSFY+NNAD LK+  I+G  P++ TI SG YPISRPL FYVK+ H N + G
Sbjct: 240 NKTGIGVFGLSFYENNADRLKVADINGFAPTVETISSGKYPISRPLFFYVKKAHLNIIPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           LREYV F +SD+M+ P+S L +YGL+  S++ER++ R + + G
Sbjct: 300 LREYVDFFLSDQMIGPNSPLAEYGLVVASDKERQAQRSAFSAG 342


>gi|304394454|ref|ZP_07376375.1| phosphate ABC transporter periplasmic-binding protein [Ahrensia sp.
           R2A130]
 gi|303293364|gb|EFL87743.1| phosphate ABC transporter periplasmic-binding protein [Ahrensia sp.
           R2A130]
          Length = 345

 Score =  270 bits (689), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 121/343 (35%), Positives = 187/343 (54%), Gaps = 5/343 (1%)

Query: 1   MRFFFVVLMCFVVLEVYC-GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+    +    +V       T   AR++I + GSST+FP++  +AE F +    F TP V
Sbjct: 1   MKKTIALKAALLVAAAAIVSTPAAARDQINVVGSSTVFPFATAVAERFGKGTS-FGTPVV 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES GS  GLK FC G G +T DI N+SR+I  +E++ C  +GV +I EV +G+DGI+L +
Sbjct: 60  ESTGSGGGLKLFCSGTGANTPDITNASRRIKASEVELCASNGVKEIVEVKVGYDGIVLAN 119

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            R    +++ ++D+Y ALA  + VD K+V NP   W+E+ P  P  +I +  P    GTR
Sbjct: 120 SRATAPLAVDIKDIYNALAKEVEVDGKIVANPYTMWNEVNPALPATKIEVLGPPPTSGTR 179

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   + V++EGC      + ++D    +  + S  C SVR+DG  +E   +    + ++E
Sbjct: 180 DAFVELVMEEGCDMFPAIAALKD---SDKDRHSTVCKSVREDGGYVEAGENDNLIIQKLE 236

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            N D +G  G SF   NAD ++   I G  P+   I  G YP+SR L FYVK+ H   + 
Sbjct: 237 ANADAYGIFGFSFLDQNADKVQGATIGGKEPTFENIADGAYPVSRSLFFYVKKAHVGVIP 296

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           G+ E+++   S+  M  D  L   GLIP+  +E   +RD +  
Sbjct: 297 GIEEFLAEFTSEGAMGEDGYLADKGLIPMPEDEMAKIRDDVKN 339


>gi|319408035|emb|CBI81689.1| periplasmic phosphate binding protein [Bartonella schoenbuchensis
           R1]
          Length = 348

 Score =  268 bits (683), Expect = 1e-69,   Method: Composition-based stats.
 Identities = 160/343 (46%), Positives = 218/343 (63%), Gaps = 1/343 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M     V +  + +         AR++I+IAGSST+ PY KI++E F E +P FK P +E
Sbjct: 1   MSKLLSVGVGLMCVTALLVDIGNARDQIKIAGSSTVLPYEKIVSEVFGEIYPNFKIPVIE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFCRGIGD TIDIVNSSR +   EL  C   GV DI+E+ IG+DGI+  ++
Sbjct: 61  SGGSGAGIKEFCRGIGDKTIDIVNSSRPMKSGELQSCFNAGVKDIEEMRIGYDGIVFATN 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  L   D+Y+ALA+ ++VD K+  N + KW+ +    P+  I +Y+P  KHGTRE
Sbjct: 121 SSGPDWELRSVDVYRALAAQVVVDGKLQLNKVTKWNTVNNALPDWEITVYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+K+L  GC  S     M  +   N ++++ AC +VR+DG AI++DGDY+ET A +  
Sbjct: 181 VFEEKLLAAGCKASGAVEAMEAL-GMNEKEINAACIAVRKDGKAIDIDGDYSETFAHLMS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G + LSFY+NNAD LK+  I+G+VPS  TI +G Y +SRPL FYVK+ HF+ V G
Sbjct: 240 NKTGIGVLSLSFYENNADKLKVAYINGVVPSSETISNGKYSLSRPLFFYVKKAHFSIVPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           L EYV F +SD+M+ PD  L  YGL+  S EER+  R S   G
Sbjct: 300 LWEYVDFFLSDQMIGPDGPLADYGLVAASKEERQMQRTSFYAG 342


>gi|222147392|ref|YP_002548349.1| ABC transporter substrate binding protein (phosphate)
           [Agrobacterium vitis S4]
 gi|221734382|gb|ACM35345.1| ABC transporter substrate binding protein (phosphate)
           [Agrobacterium vitis S4]
          Length = 341

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 157/341 (46%), Positives = 220/341 (64%), Gaps = 2/341 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              + +  +V  V       AR++++IAGSST+ PY+KI+AE F E F +FKTP VESGG
Sbjct: 3   MLKLSVAALVASVAFAGAAAARDQVQIAGSSTVLPYAKIVAETFGETFTKFKTPVVESGG 62

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           +  GLKEFC+G+G +TIDI N+SR I ++E + CK  GV+DIQEV  G+DGI+   D   
Sbjct: 63  TGAGLKEFCKGVGPETIDIANASRPINKSEAEACKAAGVTDIQEVKFGYDGIVFAVDSSN 122

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
             ++L   DLYK LA+ ++VD K+V NP KKWSE+    P+  I  ++P  KHGTREV E
Sbjct: 123 KDLALVPTDLYKGLAAEVVVDGKLVANPYKKWSEVNKSLPDTDIMAFIPGEKHGTREVFE 182

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             VLQ+GC  +     ++       +     C +VR+DG A+++DGDY+ETLARI  NK 
Sbjct: 183 VNVLQQGCKDAGALDVIKAAVG--EKDAPKKCIAVRKDGKAVDIDGDYSETLARIAANKT 240

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GLSFY+NNAD LK+  + G+ PS+ T+ +G YP+SRPL FYVK+ H   + G++E
Sbjct: 241 AIGVFGLSFYENNADKLKVATVSGVKPSVETVATGKYPVSRPLFFYVKKAHLGVIPGMKE 300

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           YV F +S++M+  D  L  YGL+P  ++ER+  R     GK
Sbjct: 301 YVDFFLSEQMIGTDGPLANYGLVPAPDKEREEFRAKFTAGK 341


>gi|319406573|emb|CBI80215.1| periplasmic phosphate binding protein [Bartonella sp. 1-1C]
          Length = 348

 Score =  267 bits (681), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 158/345 (45%), Positives = 225/345 (65%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR    + + F+   +     ++ARNR+ I GSST+ PY KI+AE F E + +FK P +E
Sbjct: 1   MRKLLSIGIGFISSIILLVGISYARNRVHIVGSSTVLPYGKIVAEVFGEMYSDFKVPVIE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFCRGIG++T+DIV++SR +  +EL  C   GV DI+E+ IG+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCRGIGNNTVDIVHTSRAMKSDELRSCFNAGVKDIEEMRIGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +     L   DLY+ALA+ +IVD K+  N   KWS +  D P+  I  Y+P  KHGTRE
Sbjct: 121 INGPDWKLQPVDLYRALAAQVIVDGKLQPNKFMKWSAVNSDLPDWTITAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           VLE+KVL  GC  S    +M+ +   + + ++  C +VR+DG  I++DGDY+ET AR+  
Sbjct: 181 VLEEKVLSIGCKASGAVEQMKALGMSD-KAINATCIAVRKDGKVIDIDGDYSETFARLTS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +K   G  GL FY+NNAD LK+  I+G+ P++ TI  G Y I+RPL FYVK+ H N V G
Sbjct: 240 SKTGIGVFGLFFYENNADKLKVASINGVYPTVETISDGTYLIARPLFFYVKKLHLNIVPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           ++EYV F +SD+M+   S L +YGL+P+S  ER+  RD+ + GK 
Sbjct: 300 MQEYVDFFLSDQMIGLHSPLTEYGLVPLSERERQLQRDAFSSGKV 344


>gi|90023395|ref|YP_529222.1| phosphate binding protein [Saccharophagus degradans 2-40]
 gi|89952995|gb|ABD83010.1| phosphate binding protein, putative [Saccharophagus degradans 2-40]
          Length = 347

 Score =  266 bits (678), Expect = 4e-69,   Method: Composition-based stats.
 Identities = 113/347 (32%), Positives = 188/347 (54%), Gaps = 8/347 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   +  +      +   +   AR+ I I GSST+FP+SK++AE F +   ++++P VE
Sbjct: 1   MKRILIGAL-LTAGALASTSAMAARDSISIVGSSTVFPFSKVVAERFGKAT-DYRSPTVE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G+G    D+ N+SR+I Q+ELD CK++GV ++ EV IG+DGI+L + 
Sbjct: 59  STGTGGGFKAFCGGVGVAFPDMSNASRRIKQSELDMCKENGVKEVVEVLIGYDGIVLANA 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDK---VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
            +   +SL+ +D++ ALA  +   D    ++ NP   WS++ P  P+ +I +  P    G
Sbjct: 119 IEAKRLSLSAKDIFLALAKKIPNPDGSATLIDNPYTMWSDVNPSLPKSKIEVLGPPPTSG 178

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           TR+   +  ++ GC +      + D+ K +  +    C  +R+DG  IE   +    + +
Sbjct: 179 TRDAFVELAMEGGCKKFG---WIADLKKSDKNKYKAICHVIREDGHFIEAGENDNLIVQK 235

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           +  N +  G  G SF   NAD ++   IDG  P+  TI  G Y +SRPL FYVK+ H   
Sbjct: 236 LASNPNALGIFGFSFLDQNADKVQASKIDGAEPTFETIADGSYAVSRPLYFYVKKAHVGV 295

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + G+ EY++   S+     +  L + G+IP+S EER  +   +   +
Sbjct: 296 IQGIEEYLAEFTSERAWGDEGYLTEKGMIPLSAEERAKIAKRVKNLE 342


>gi|332703029|ref|ZP_08423117.1| periplasmic phosphate-binding protein [Desulfovibrio africanus str.
           Walvis Bay]
 gi|332553178|gb|EGJ50222.1| periplasmic phosphate-binding protein [Desulfovibrio africanus str.
           Walvis Bay]
          Length = 340

 Score =  266 bits (678), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 112/340 (32%), Positives = 180/340 (52%), Gaps = 12/340 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR      +  + +         AR++IRI GSST++P++  + E F      FKTP +E
Sbjct: 1   MRKLLATGLVALSMLAMGAGVAQARDQIRIVGSSTVYPFASYVTEEFGSTTK-FKTPVIE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G K F  G+GD+T DI N+SR++  +E +  +++GV DI E  IG DGI    +
Sbjct: 60  STGSGGGFKLFTEGMGDNTPDITNASRRMKGSEFERAQQNGVGDIVEAIIGFDGIAFAQN 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +   +++LT+E+L  A+A+ +  + K+V NP K W++I    P   I +Y P    GTR+
Sbjct: 120 KSNQAMNLTLEELTLAVAAEVPQNGKLVPNPYKNWNQINSKLPARPIVVYGPPTSSGTRD 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E+ V++    +                      T +RQDG+ I+   +    + R+  
Sbjct: 180 AFEELVMEHTSTKGGL-----------KDGYGGKYTKIRQDGVYIDAGENDNLIVQRLAQ 228

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +K+ FG  G SF + N D ++   I+G+ P    I SG YPISR L FY+K+ H   V G
Sbjct: 229 DKNAFGIFGYSFLEENQDRIQGASINGVEPKPEAISSGKYPISRSLYFYIKKAHIGKVPG 288

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           ++EY    +S++M+ P   L + GLIP+ ++ RK  +  +
Sbjct: 289 IKEYADLFMSEKMIGPKGLLKRIGLIPLPDDMRKKAQKQV 328


>gi|319403655|emb|CBI77240.1| periplasmic phosphate binding protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 348

 Score =  265 bits (677), Expect = 5e-69,   Method: Composition-based stats.
 Identities = 159/345 (46%), Positives = 223/345 (64%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR    + + F+   +     ++ARNR+ I GSST+ PY KI+AE F E + +FK P +E
Sbjct: 1   MRKLLSIGIGFISSIILLVDISYARNRVHIVGSSTVLPYGKIVAEVFGEMYSDFKVPVIE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFCRGIG  T+DIV++SR +  +EL  C   GV DI+E+ IG+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCRGIGKKTVDIVHTSRAMKSDELRSCFDAGVKDIEEMRIGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +     L   DLY+ALA+ +IVD K+  N   KWS +  D P+  I  Y+P  KHGTRE
Sbjct: 121 INGPDWKLQPVDLYRALAAQVIVDGKLQPNKFMKWSAVNSDLPDWTITAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           VLE+KVL  GC  S    +M+ +   + + ++  C +VR+DG  I++DGDY+ET AR+  
Sbjct: 181 VLEEKVLSIGCKASGAVEQMKALGMSD-KAINATCIAVRKDGKVIDIDGDYSETFARLTS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +K   G  GL FY+NNAD LK+  I+GI P++ TI  G Y I+RPL FYVK+ H N V G
Sbjct: 240 SKTGIGVFGLFFYENNADKLKVASINGIYPTVETISDGTYLIARPLFFYVKKLHLNIVPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           ++EYV F +SD+M+   S L +YGL+P+S  ER+  RD+ + GK 
Sbjct: 300 MQEYVDFFLSDQMIGLHSPLTEYGLVPLSERERQLQRDAFSSGKV 344


>gi|315121872|ref|YP_004062361.1| putative phosphate-binding periplasmic protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495274|gb|ADR51873.1| putative phosphate-binding periplasmic protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 355

 Score =  265 bits (677), Expect = 6e-69,   Method: Composition-based stats.
 Identities = 267/345 (77%), Positives = 310/345 (89%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MRFFFVV+ CFV    YCGT  FARNRIRIAGSST FPYSKIIAENFSEYFPEFKTPFVE
Sbjct: 1   MRFFFVVITCFVFWTTYCGTEIFARNRIRIAGSSTFFPYSKIIAENFSEYFPEFKTPFVE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLKEFC+GIG+DTIDIVNSSRKITQ+ELDECKK GVS+IQEVTIG+DGI+LVSD
Sbjct: 61  SGGSSAGLKEFCKGIGEDTIDIVNSSRKITQSELDECKKKGVSEIQEVTIGYDGIVLVSD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++MV+VSLT+EDLYKALAS LIV+  +V NP KKWS+IR D P++RI+IYVPS KHGTRE
Sbjct: 121 KNMVNVSLTIEDLYKALASKLIVNGLLVSNPFKKWSDIRSDLPKIRISIYVPSEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           ++E+KVL+EGCVRS NFSKMRD+FK+N  Q+ +ACT VR+DG+AIEVDGDYTETLARIEV
Sbjct: 181 IIEQKVLREGCVRSGNFSKMRDIFKHNASQVDMACTFVRKDGVAIEVDGDYTETLARIEV 240

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NKD+FGF+GLSFYKNNAD+L LV IDG++PS+ TI+SG+YPISRPLLFYVK+ HF +VLG
Sbjct: 241 NKDIFGFLGLSFYKNNADILNLVSIDGVIPSVDTILSGVYPISRPLLFYVKKSHFINVLG 300

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           LREYVSFS+SDEMM   SQL QYGLIPI N++RK V+DSIA+ K+
Sbjct: 301 LREYVSFSLSDEMMDSGSQLIQYGLIPIPNKDRKIVQDSIAIEKN 345


>gi|227820729|ref|YP_002824699.1| predicted phosphate ABC transporter, substrate-binding protein
           [Sinorhizobium fredii NGR234]
 gi|227339728|gb|ACP23946.1| predicted phosphate ABC transporter, substrate-binding protein
           [Sinorhizobium fredii NGR234]
          Length = 344

 Score =  265 bits (676), Expect = 7e-69,   Method: Composition-based stats.
 Identities = 173/343 (50%), Positives = 232/343 (67%), Gaps = 2/343 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  +V          AR++I++AGSST+ PY+KI+AE F E FP+FKTP VE
Sbjct: 1   MK-VLKLTVAALVASAAFAGAAVARDQIQVAGSSTVLPYAKIVAETFGETFPDFKTPVVE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLKEFC+G+G+DTIDI NSSRKI  +E++ CK  GV++IQEV IG+DGI+  +D
Sbjct: 60  SGGSSAGLKEFCKGVGEDTIDIANSSRKIKDSEVEACKAAGVTEIQEVKIGYDGIVFATD 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                ++L  E LYKALA+ ++VD K+V NP KKWSEI    P+  IA Y+P  KHGTRE
Sbjct: 120 AGNADLALKPEQLYKALAAEVVVDGKLVANPYKKWSEIDASLPDAEIAAYIPGEKHGTRE 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+K+L  GC  +     ++     + +  +  C +VR+DG+A+++DGDYTETLARI  
Sbjct: 180 VFEEKILAHGCKDAGAVDVIKAAI-SDEKAAAKKCVAVRKDGLAVDIDGDYTETLARIAS 238

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GLSFY+NNAD LK+  + GIVPS  TI SG YP+SRPL FYVK+ H   V G
Sbjct: 239 NKSGIGVFGLSFYENNADKLKVATVSGIVPSTETIASGEYPVSRPLFFYVKKAHLGVVPG 298

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           L+EYV F V D+M+ PD  L +YGL+   + ER+ +R +   G
Sbjct: 299 LKEYVEFFVDDQMIGPDGPLAEYGLVAAPDAEREEIRKTFEAG 341


>gi|262277659|ref|ZP_06055452.1| phosphate ABC transporter [alpha proteobacterium HIMB114]
 gi|262224762|gb|EEY75221.1| phosphate ABC transporter [alpha proteobacterium HIMB114]
          Length = 339

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 118/345 (34%), Positives = 190/345 (55%), Gaps = 8/345 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    +   F++L     +   AR++I+I GSST++PY+ ++AE F +   +FKTP +E
Sbjct: 1   MKQLKTLF--FLILSFVFVSNAIARDQIKIVGSSTVYPYATVVAERFGKS-GKFKTPVIE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G+K FC G+G +  DI N+SR I  +E + C K+GV DI E+ +G+DGI     
Sbjct: 58  STGTGGGMKLFCAGVGTNHPDITNASRAIKSSEKELCSKNGVKDIIEIVVGNDGISFAHS 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                 + T E L++ALA  + VD K+V NP KKWS+I    P   I I VP    GTR+
Sbjct: 118 VKAKDANFTKEHLWRALAHDVDVDGKLVVNPYKKWSDIDKSLPNYGIKILVPPPTSGTRD 177

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
                V+ +GC ++      +  ++   ++   AC  +R+DG AIE   + T  + ++  
Sbjct: 178 AWNSLVMAKGCSKT-----AKAAYEAVGKKAKKACVKLREDGFAIEAGENDTLIVNKLSA 232

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           + ++FG  G S+   N D +K   ++G+VPS+  I +  YPI+RPL FYVK+ H   V G
Sbjct: 233 DPELFGLFGFSYLVANKDKIKAAKVNGVVPSLEGIQNYSYPIARPLFFYVKKAHIGVVPG 292

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           + E++    + +   P   L   GL+P+S ++    R+S     +
Sbjct: 293 IHEFLKDFTAKKATGPRGYLTDVGLVPLSPDKYNLTRNSALKLTT 337


>gi|221134921|ref|ZP_03561224.1| phosphate binding protein, putative [Glaciecola sp. HTCC2999]
          Length = 345

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 113/340 (33%), Positives = 192/340 (56%), Gaps = 7/340 (2%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           F+  LM   +  V   +    R+ I + GSST++P+S ++AE F +   +F TP +ES G
Sbjct: 2   FYRKLMALSLAAVATTSMAAGRDTISVVGSSTVYPFSTVVAERFGKAT-DFATPKIESTG 60

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           +  G+K FC G+G DT D+ N+SR+I  +EL+ CK +GV ++ EV +G+DGI+  +    
Sbjct: 61  TGGGMKLFCAGVGVDTPDMSNASRRIKASELEMCKANGVDEVVEVLVGYDGIVFSNAIGA 120

Query: 124 VSVSLTVEDLYKALASYLIVDDK---VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            ++S+++++++ ALA  +   D    ++ NP   W+E+ P  P+++I++Y P    GTR+
Sbjct: 121 PNISISLQEIFLALAKEIPNPDGSATLIENPYNNWNEVNPSLPDMKISVYGPPPTSGTRD 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              +  L+ GC   + +S ++ + K +  +    C SVR+DG  IE   +    + ++  
Sbjct: 181 AFAELALEGGC---KTYSWIKALKKADKNRYKSICHSVREDGAYIETGENDNLIVQKLTT 237

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N   FG  G SF   N+D L+   + G  P+   I  G YPISRPL FYVK+ H   V G
Sbjct: 238 NPKAFGIFGFSFLDQNSDTLQGSKVSGAYPTFEDIADGAYPISRPLYFYVKKAHVGKVPG 297

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           + E++    S++ +  +      GLIP+S E+ + +R S+
Sbjct: 298 IMEFLEEFTSEDAIGDEGYTTDKGLIPLSYEKLEEMRKSV 337


>gi|319405126|emb|CBI78732.1| periplasmic phosphate binding protein [Bartonella sp. AR 15-3]
          Length = 348

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 159/345 (46%), Positives = 221/345 (64%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M     + + FV   +     ++ARNR+ I GSST+ PY KI+AE F E +  FK P +E
Sbjct: 1   MSKLLSIGISFVFSIILLIDISYARNRVHIVGSSTVLPYGKIVAEIFGEIYSNFKVPIIE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFCRGIG++TIDIV++SR +  +EL  C   GV DI+E+ IG+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCRGIGNNTIDIVHTSRAMKPDELRSCFNTGVKDIEEMRIGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +     L   D Y+ALA+ +IVD K+  N   KWS +  + P+  I  Y+P  KHGTRE
Sbjct: 121 INGPDWKLQPVDFYRALAAQVIVDGKLQPNEFMKWSAVNSNLPDWTITAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KVL  GC  S    +M+ +   + + ++ AC +VR+DG A+++DGDY+ET AR+  
Sbjct: 181 VFEEKVLAIGCKASGAVEQMKALGMSD-KAINAACIAVRKDGKAVDIDGDYSETFARLTS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +K   G   LSFY+NNAD LK   I+GI PS+ TI  G Y ISRPL FYVK+ H N V G
Sbjct: 240 SKTGIGVFSLSFYENNADKLKAASINGIYPSVETISDGSYLISRPLFFYVKKLHLNIVPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           ++EY+   +SD+M+   S L +YGL+PIS  ER+  RD+ + GK 
Sbjct: 300 MQEYIDLFLSDQMIGLHSPLAEYGLVPISERERQVQRDAFSSGKV 344


>gi|49475055|ref|YP_033096.1| periplasmic phosphate binding protein [Bartonella henselae str.
           Houston-1]
 gi|49237860|emb|CAF27055.1| Periplasmic phosphate binding protein [Bartonella henselae str.
           Houston-1]
          Length = 348

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 152/343 (44%), Positives = 218/343 (63%), Gaps = 1/343 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M       +  +   ++      AR++I+I GSST+ PY KI+AE F E +P FK P +E
Sbjct: 1   MSRLLSGGVGVIFAVLFSVNVGNARDQIQITGSSTVLPYQKIVAEIFGEIYPHFKIPVIE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGG+  G+KEFCRGIG++ IDIVN+SR +  +EL  C   GV D++E+ IG+DGI+  +D
Sbjct: 61  SGGTGGGIKEFCRGIGENAIDIVNASRAMKLSELQSCFDAGVKDVEEIRIGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +     L   D+Y+ALA+ ++ D K+  N + KWS +    P   IA Y+P  KHGTRE
Sbjct: 121 INGPDWKLQPVDIYRALAARIMKDGKLQSNNVSKWSAVNSALPGWTIAAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+K+L  GC  S     M+ +   + + + +AC +VR+DG  I++DGDY+ET AR+  
Sbjct: 181 VFEEKLLAAGCKESGAVDAMKSL-GMDDKAIHIACVAVRKDGKVIDIDGDYSETFARLTS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G  GLSFY+NNAD LK+  I G  P++ TI SG YP+SRPL FYVK+ H   + G
Sbjct: 240 NKTGVGVFGLSFYQNNADRLKVADISGFTPTVETISSGKYPVSRPLFFYVKKAHLGIIPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           LREYV F +SD+M+ P+  L +YGL+  S +ER++ R + + G
Sbjct: 300 LREYVDFFLSDQMIGPNGPLAEYGLVVASEKERQAQRSAFSAG 342


>gi|254462738|ref|ZP_05076154.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacterales bacterium HTCC2083]
 gi|206679327|gb|EDZ43814.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 349

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 136/341 (39%), Positives = 218/341 (63%), Gaps = 3/341 (0%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
              +    +      T   AR++++IAGSST+ PY+ I+AE F E F ++ TP VESGGS
Sbjct: 7   VAKITFSALTLSTAATVAIARDQVQIAGSSTVLPYASIVAEAFGENF-DYPTPVVESGGS 65

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
           S GLK FC G+G +TIDI N+SR+I  +EL+ C+ +GV+DI E+ IG+DGI+  S++   
Sbjct: 66  SAGLKRFCEGVGKNTIDIANASRQIKPSELEVCQANGVTDIIELRIGYDGIVFASEKGGN 125

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
             + T  D + AL+  ++++ K+V NP + WS +  D  +  +  ++P  KHGTREV E 
Sbjct: 126 EFAYTAADWFLALSDQILIEGKLVDNPNQSWSSVNADLQDQPLKAFIPGTKHGTREVFED 185

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
           KV+  GC  +     ++D    + +    AC ++R DG+++++DGDYTETLARIE NK+ 
Sbjct: 186 KVILAGCEATGALDALKDANGGDEKAAEKACITLRTDGVSVDIDGDYTETLARIESNKNG 245

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G  GL+FY+NN D L++  ++G++P++ +I SG YP+SRPL  Y+K+ H   + GL+++
Sbjct: 246 IGIFGLAFYENNTDKLQVATMEGVIPTVESISSGEYPVSRPLYMYLKQAHLEVIPGLKDF 305

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
             F V DE+   D  L +YGL+   + E ++ ++ +A G++
Sbjct: 306 AEFFVLDEIAGEDGPLAEYGLVA--DPELETTQEIVANGQT 344


>gi|331005885|ref|ZP_08329237.1| Phosphate ABC transporter [gamma proteobacterium IMCC1989]
 gi|330420329|gb|EGG94643.1| Phosphate ABC transporter [gamma proteobacterium IMCC1989]
          Length = 365

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 112/360 (31%), Positives = 179/360 (49%), Gaps = 17/360 (4%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   +     V           AR+ I I GSST++P++ ++AE F +   +FKTP +E
Sbjct: 1   MKTLKLATAIAVSALTLSSVTVSARDNISIVGSSTVYPFATVVAEKFGKTT-QFKTPTIE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G K FC G G    DI N+SR++  +EL +C+ +  +D+ EV IG DGI++ + 
Sbjct: 60  STGSGGGAKLFCSGNGVSHPDITNASRRMKLSELKKCQAN-GTDVVEVLIGFDGIVVANS 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDK---VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
                + LT +DL+ ALA  +   D    ++ NP + W ++ P  P  +IA++ P    G
Sbjct: 119 NKSKQLELTRKDLFLALAKEVPNTDGSETLIPNPYQTWKDVNPTLPASKIAVFGPPPTSG 178

Query: 178 TREVLEKKVLQEGCVRSRNFSKM------------RDMFKYNVQQLSVACTSVRQDGIAI 225
           TR+   +  ++ GC +      +            + + K    +    C ++R+DG  I
Sbjct: 179 TRDAFVELGMEGGCKKVSWIKDISSASKKAKKAGDKALSKSLKNKYKGICHTIREDGAYI 238

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRP 285
           E   +    + ++  N D  G  G SF + NA  ++   I+G  P+  TI S  YPISRP
Sbjct: 239 ESGENDNLIVQKLTKNPDSLGIFGFSFLEENASKVQGSLIEGNEPTFETISSKSYPISRP 298

Query: 286 LLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L FYVK+ H   V G+ EYV+    D    P+  L + G+IP+S+E R     +     +
Sbjct: 299 LYFYVKKNHIGVVPGIEEYVTEFTKDSTWGPEGYLAERGMIPLSDELRAKYSKNAKELVT 358


>gi|330813175|ref|YP_004357414.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Candidatus Pelagibacter sp. IMCC9063]
 gi|327486270|gb|AEA80675.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Candidatus Pelagibacter sp. IMCC9063]
          Length = 337

 Score =  264 bits (675), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 118/339 (34%), Positives = 185/339 (54%), Gaps = 11/339 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M       +  +VL +       AR++I+I GSST++PY+ ++AE F +   +FKTP VE
Sbjct: 1   MNKIK--FIAVLVLGLGITFAASARDQIQIVGSSTVYPYTTVVAEKFGKS-GKFKTPVVE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G+K FC G+G    D+ N+SR I   E   C K+GV+DI E+ +G+DGI+    
Sbjct: 58  STGTGGGMKLFCSGVGTQHPDVTNASRAIKSKEKALCAKNGVNDIIEIVVGNDGIVFSHS 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                 + T E L++ALA  + ++ K+V NP KKWS+I    P   I I VP    GTR+
Sbjct: 118 LKAKDANFTKEQLWRALAHDVDINGKIVANPYKKWSDIDKSLPNFGIKIMVPPPTSGTRD 177

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
                V+ +GC +           +   +     C  +R+DG+AIE   + T  + ++  
Sbjct: 178 AWNSLVMGKGCSK--------AYKELAGKDAKKGCPKLREDGLAIEAGENDTLIVNKLAA 229

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           + ++FG  G S+   N D +K   I+G+ PS+  I    YPI+RPL FYVK+ H   V G
Sbjct: 230 DPELFGLFGYSYLIGNKDKIKAASINGVKPSLEGIQDYSYPIARPLFFYVKKAHIGVVPG 289

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           ++E+++   S + M     L   GL+P+SN++ K+ R+S
Sbjct: 290 IKEFLNEFTSKKAMGNLGYLADIGLVPLSNDKYKTTRNS 328


>gi|15964262|ref|NP_384615.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           meliloti 1021]
 gi|307307000|ref|ZP_07586739.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           meliloti BL225C]
 gi|307320654|ref|ZP_07600067.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           meliloti AK83]
 gi|15073439|emb|CAC45081.1| Phosphate binding periplasmic protein [Sinorhizobium meliloti 1021]
 gi|306893689|gb|EFN24462.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           meliloti AK83]
 gi|306901940|gb|EFN32539.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           meliloti BL225C]
          Length = 344

 Score =  264 bits (674), Expect = 1e-68,   Method: Composition-based stats.
 Identities = 176/343 (51%), Positives = 236/343 (68%), Gaps = 2/343 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   +  +  +V          AR++I++AGSST+ PY+KI+AENF E FP+FKTP VE
Sbjct: 1   MKSLKLT-VAALVASAAFAGVAAARDQIQVAGSSTVLPYAKIVAENFGETFPDFKTPVVE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLKEFC+G+G+DTIDI NSSRKI  +E++ CK  GV++IQEV IG+DGI+  +D
Sbjct: 60  SGGSSAGLKEFCKGVGEDTIDIANSSRKIKDSEVEACKAAGVTEIQEVKIGYDGIVFATD 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                ++L  E LYKALA+ ++VD K+V NP KKWSE+    P+  IA Y+P  KHGTRE
Sbjct: 120 AGNADLALKPEHLYKALAAEIVVDGKLVANPYKKWSEVDASLPDAEIAAYIPGEKHGTRE 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+K+L  GC  S     ++     + +Q    C +VR+DG+A+++DGDYTETLARI  
Sbjct: 180 VFEEKILAAGCKDSGAQDVIKAAV-SDEKQQFSKCVAVRKDGMAVDIDGDYTETLARIAS 238

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G  GLSFY+NNAD LK+  ++GIVPS  TI SG YP+SRPL FYVK+ H   + G
Sbjct: 239 NKNGIGVFGLSFYENNADKLKVATVNGIVPSTETIASGEYPVSRPLFFYVKKAHIGVIPG 298

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           L+EYV F V D+M+ PDS L +YGL+   + ER+ +R S   G
Sbjct: 299 LKEYVEFFVDDQMIGPDSPLAEYGLVAAPDAEREEIRTSFEAG 341


>gi|83591937|ref|YP_425689.1| phosphate ABC transporter periplasmic binding protein
           [Rhodospirillum rubrum ATCC 11170]
 gi|83574851|gb|ABC21402.1| phosphate ABC transporter, periplasmic binding protein
           [Rhodospirillum rubrum ATCC 11170]
          Length = 342

 Score =  264 bits (673), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 115/318 (36%), Positives = 178/318 (55%), Gaps = 4/318 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++IRI GSST++P++  +AENF +    FKTP +ES GS  GLK FC G+G +  DI N
Sbjct: 23  RDQIRIVGSSTVYPFATTVAENFGK-TSSFKTPVIESTGSGGGLKLFCAGVGVEHPDIAN 81

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I ++E++ C K+GV +I EV IG DGI+L + +   + +LT   +++ALA  + VD
Sbjct: 82  ASRRIKKSEVETCAKNGVKEITEVQIGFDGIVLANTKTAPAFNLTKGQIFQALAKEVPVD 141

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K V NP   WS+I    P   I +  P    GTR+   + V++ GC+         D+ 
Sbjct: 142 GKWVANPYSNWSQIDAKLPNEEIEVLGPPPTSGTRDAFVELVMETGCL---ELPACADLK 198

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           K + ++ S    S+R+DG  IE   +    + +++ N    G  G SF   N+D ++   
Sbjct: 199 KADEKKFSSVFASLREDGRFIEAGENDNLIVQKLQSNPTALGIFGFSFLDQNSDKIQGSH 258

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           I+G+ P+   I S  Y +SRPL FYVK  H  +V G++EYV+   S++   P+  L + G
Sbjct: 259 IEGVAPTFEDIASSKYKVSRPLFFYVKNAHVGTVPGIKEYVAEFTSEKAWGPEGYLSEKG 318

Query: 325 LIPISNEERKSVRDSIAV 342
           LIP+ +  R         
Sbjct: 319 LIPLPDAVRADAAKKANA 336


>gi|150395347|ref|YP_001325814.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           medicae WSM419]
 gi|150026862|gb|ABR58979.1| putative phosphate-binding periplasmic protein [Sinorhizobium
           medicae WSM419]
          Length = 344

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 170/319 (53%), Positives = 229/319 (71%), Gaps = 1/319 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AENF E FP+FKTP +ESGGSS GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAENFGETFPDFKTPVIESGGSSAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSRKI  +E++ CK  GV++IQEV IG+DGI+  +D     ++L  E LYKALA+ ++VD
Sbjct: 84  SSRKIKDSEVEACKAAGVTEIQEVKIGYDGIVFATDAGNADLTLKPEHLYKALAAEIVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+    P+  IA Y+P  KHGTREV E+K+L  GC  S     ++   
Sbjct: 144 GKLVANPYKKWSEVDASLPDAEIAAYIPGEKHGTREVFEEKILAAGCKDSGAQDVIKAAV 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +Q    C +VR+DG+A+++DGDYTETLARI  NK+  G  GLSF++NNAD LK+  
Sbjct: 204 -SDEKQQHSKCVAVRKDGMAVDIDGDYTETLARIASNKNGIGVFGLSFFENNADKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++G+VPS  TI SG YP+SRPL FYVK+ H   + GL+EYV F V D+M+ PDS L +YG
Sbjct: 263 VNGVVPSTETIASGEYPVSRPLFFYVKKAHIGVIPGLKEYVEFFVDDQMIGPDSPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAVG 343
           L+   + ER+ +R S   G
Sbjct: 323 LVAAPDAEREEIRQSFEAG 341


>gi|254472022|ref|ZP_05085423.1| phosphate ABC transporter, periplasmic binding protein
           [Pseudovibrio sp. JE062]
 gi|211959224|gb|EEA94423.1| phosphate ABC transporter, periplasmic binding protein
           [Pseudovibrio sp. JE062]
          Length = 339

 Score =  263 bits (672), Expect = 2e-68,   Method: Composition-based stats.
 Identities = 116/343 (33%), Positives = 185/343 (53%), Gaps = 11/343 (3%)

Query: 1   MR-FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+   F  +    +          AR++I+I GSST+FP++  +AE F +    FKTP V
Sbjct: 1   MKIKAFASVAALALAGTIAAGSAQARDQIQIVGSSTVFPFATAVAEQFGQKT-NFKTPVV 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES GS  G+K FC G+G++T DI N+SR++   EL +C + GV+   EVT+G DGI+L +
Sbjct: 60  ESTGSGGGIKLFCEGVGENTPDITNASRRMKAKELVKCNEAGVTP-VEVTVGFDGIVLAN 118

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            +    + LT++ ++ ALA  + V+ K+V NP +KWS+I P  P  +I +  P    GTR
Sbjct: 119 SKAGAQLDLTLDQVFLALAKEVPVEGKLVANPYQKWSDIDPSLPNTKIEVLGPPPTSGTR 178

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   +  +Q GC +              +     AC  VR+DG  IE   +    + ++E
Sbjct: 179 DAFAELAMQGGCKKV--------AGAAELGLKKKACHEVREDGAYIEAGENDNLIVQKLE 230

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            N +  G  G SF   NAD ++   I+G+ P+   I +G YP+SR L FY+K++H   + 
Sbjct: 231 ANPNALGIFGFSFLDQNADKMQGANINGVAPTFDAIAAGDYPVSRSLFFYIKKEHVGVIP 290

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           G+ EY++   +++    +  L   GLIP+   +R SV  S + 
Sbjct: 291 GIAEYLAEFTNEDTWGDEGYLADKGLIPLPAADRASVSKSASA 333


>gi|291287534|ref|YP_003504350.1| periplasmic phosphate binding protein [Denitrovibrio acetiphilus
           DSM 12809]
 gi|290884694|gb|ADD68394.1| periplasmic phosphate binding protein [Denitrovibrio acetiphilus
           DSM 12809]
          Length = 338

 Score =  263 bits (672), Expect = 3e-68,   Method: Composition-based stats.
 Identities = 114/345 (33%), Positives = 184/345 (53%), Gaps = 15/345 (4%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ F  + +    + +       AR++IRI GSST++P++  +AE F        TP +E
Sbjct: 1   MKKFLTLALVAAFMTMSTV-AAHARDQIRIVGSSTVYPFASYVAEEFGATTGN-PTPIIE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G K F  G+  +T DI NSSR++  +E D+    GV +I E+ IG+DGI +  +
Sbjct: 59  STGSGGGHKLFSAGVDMNTPDITNSSRRMKTSEFDKNMAAGVKNITEIVIGYDGIAIAFN 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    ++ T +DL  A+A+ + V+ K+V NP KKW+EI P  P   I +Y P    GTR+
Sbjct: 119 KTNPDINFTRKDLTLAVAAEVPVNGKLVANPYKKWNEINPALPAKPILVYGPPTSSGTRD 178

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E+ V+++   +   +              +     +RQDGI +    +    + ++  
Sbjct: 179 AFEELVMEKVTKKMAEY-------------GNKGYGKIRQDGIYVPAGENDNLIVQKLSK 225

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF + NAD +K   +DG+ P    I SG YP+SR L FYVK  H + V G
Sbjct: 226 DKDAFGIFGYSFLEENADRIKGASVDGVDPVPANISSGKYPVSRSLFFYVKLAHLDKVPG 285

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L ++V   +S++M+  +  L   GLIP+ + +R +VR   +  ++
Sbjct: 286 LEKFVDMFLSEQMIGTNGLLKTIGLIPLPDADRDAVRARWSKRQN 330


>gi|114706438|ref|ZP_01439340.1| putative phosphate-binding periplasmic protein [Fulvimarina pelagi
           HTCC2506]
 gi|114538299|gb|EAU41421.1| putative phosphate-binding periplasmic protein [Fulvimarina pelagi
           HTCC2506]
          Length = 350

 Score =  263 bits (670), Expect = 4e-68,   Method: Composition-based stats.
 Identities = 143/343 (41%), Positives = 208/343 (60%), Gaps = 1/343 (0%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
             F  LM    L         +   +++AGSST+ PY++IIAEN+ E FP++ TP VESG
Sbjct: 4   KHFTSLMVGTSLAFAAPALAQSSEAVQVAGSSTVLPYAQIIAENYGETFPDYPTPVVESG 63

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           GSS GLK+FC+G+G +TIDI NSSR+I   E+  C   GV++I E+  G+DGI+  S   
Sbjct: 64  GSSAGLKQFCQGVGPETIDIANSSRQIRDLEVQACNDAGVNEISEIKFGYDGIVFASAAS 123

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
             S +LT E +YKA+ + +  D ++  N    WS++ P  P+  I+ ++P+  HGTREV 
Sbjct: 124 GESFALTPEMVYKAMGAQVPQDGEMGENSFSSWSDVDPSLPDQEISAFIPASNHGTREVF 183

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
           E+K++ +GC  S     M D    +   +  AC  VR DG   E+ GDYTETLARI+ N 
Sbjct: 184 EEKLMLQGCEDSGAMQVMMD-GGMDEDAVEDACMQVRNDGAIGEISGDYTETLARIDANP 242

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
              G  GL+FY+ N D L++  ++ + P+   I +G YP+SRPL FYVKR H   V GL+
Sbjct: 243 QAVGVFGLAFYEQNQDKLQVATVNDVTPTAEAIATGEYPVSRPLFFYVKRAHLGVVPGLQ 302

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           EYV F +S++M    S   +YGL+P+S +ER++  D    G++
Sbjct: 303 EYVQFFLSEQMTGEGSPTVEYGLVPLSADERQTQMDQFESGET 345


>gi|254448631|ref|ZP_05062090.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [gamma proteobacterium HTCC5015]
 gi|198261820|gb|EDY86106.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [gamma proteobacterium HTCC5015]
          Length = 346

 Score =  261 bits (667), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 115/343 (33%), Positives = 189/343 (55%), Gaps = 8/343 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   +  +  + +         AR+ + + GSST++P++ ++AENF    P FKTP +E
Sbjct: 1   MKKILLSAVAALAMG-GMTQAVQARDLVAVVGSSTVYPFAIVVAENFGRTGP-FKTPKIE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G+K FC G+G +T D+ N+SR++  +E + C+++GV +I EV IG+DGI+L + 
Sbjct: 59  STGSGGGMKLFCEGLGVNTPDVTNASRRMKMSEYEMCQENGVKEITEVLIGYDGIVLANA 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           R    + L++ D++ ALA  +   D   ++V NP K W+EI  + P+  I +  P    G
Sbjct: 119 RQSQQLDLSLRDIFLALAKDVPNPDGSEELVPNPYKTWNEINKNLPKTEIEVMGPPPTSG 178

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           TR+   +  ++ GC   + F  ++ +   +  +    C SVR+DG  +E   +    + +
Sbjct: 179 TRDAFNELAIEGGC---KTFPWLKAIKSEDKNRYKAICRSVREDGAYVEAGENDNLIVQK 235

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           +E N D  G  G SF   NAD ++   I G  P+  +I +G YP+SRPL FYVK  H   
Sbjct: 236 LEANPDALGVFGFSFLDQNADKVQGSKIGGQAPTFDSIATGDYPVSRPLYFYVKNAHVGK 295

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           V G+  YV   VS +    +  L + GLIP+S +E + +  S+
Sbjct: 296 VPGIEGYVREFVSAKASGQEGYLTEKGLIPLSPKEHREMEKSV 338


>gi|126664593|ref|ZP_01735577.1| phosphate binding protein, putative [Marinobacter sp. ELB17]
 gi|126630919|gb|EBA01533.1| phosphate binding protein, putative [Marinobacter sp. ELB17]
          Length = 352

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 106/347 (30%), Positives = 177/347 (51%), Gaps = 9/347 (2%)

Query: 1   MRFFFVVLMCFVVLEVYC--GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           M   +  L    +            AR+ I I GSST++P++ ++AE F     +F TP 
Sbjct: 1   MTKLYKALTTVTLAGAIAALSAPAMARDTISIVGSSTVYPFATVVAERFGR-NTDFATPK 59

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           +ES GS  GLK FC+G+G    DI N+SR++ ++E D C+ +GV +I EV IG DGI++ 
Sbjct: 60  IESTGSGGGLKLFCQGVGTQHPDITNASRRMKKSEFDMCQANGVKEITEVRIGADGIVMA 119

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
           + ++   + L+++ ++ ALA  +   D   ++V NP   WSEI    P + I++  P   
Sbjct: 120 NSKEAEKLDLSLKQIFLALAKDVPNPDGSNELVANPYMNWSEIDASLPNIAISVMGPPPT 179

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GTR+   +  ++ GC +    ++M D    +  +    C S+R DG  +E   +    +
Sbjct: 180 SGTRDAFVELAMESGCKQFPMIAQMED---EDEDKFKTVCHSMRDDGPFVEAGENDNLIV 236

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHF 295
            R+  + +  G  G SF   N   ++   ++G+ P+   I S  YP++R L FYVK+ H 
Sbjct: 237 QRLAQDPETLGIFGYSFLMENTGQIQAATVNGVEPTPEAISSDQYPVARSLWFYVKKAHV 296

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             V G++EY+S   S+     +  L   GLIP    ER  +  ++  
Sbjct: 297 GVVPGIQEYISEFTSEGTWGDNGYLVDVGLIPSPRNERMRIAKAVKE 343


>gi|319898362|ref|YP_004158455.1| periplasmic phosphate binding protein [Bartonella clarridgeiae 73]
 gi|319402326|emb|CBI75865.1| periplasmic phosphate binding protein [Bartonella clarridgeiae 73]
          Length = 348

 Score =  261 bits (666), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 165/345 (47%), Positives = 220/345 (63%), Gaps = 1/345 (0%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M     + + FV   +      +ARNR+ I GSST+ PY KI+AE F E +  FK P +E
Sbjct: 1   MSKLLSIGIGFVSSIILLIDIGYARNRVHIVGSSTVLPYGKIVAEIFGEMYSNFKVPVIE 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  G+KEFCRGIGD+TIDIV++SR +  NEL  C   GV D++E+ IG+DGI+  +D
Sbjct: 61  SGGSGAGIKEFCRGIGDNTIDIVHTSRAMKPNELRSCFDAGVKDVEEMRIGYDGIVFATD 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +     L   DLY+ALA+ +IVD K+  N   KWS +  D P+  I  Y+P  KHGTRE
Sbjct: 121 INGPDWKLQPVDLYRALAAQVIVDGKLQPNEFMKWSAVNSDLPDWTITAYIPGEKHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           + E+KVL  GC  S    +M+ +   N + ++ AC +VR+DG AI++DGDY+ETLAR+  
Sbjct: 181 IFEEKVLAIGCKASGAIEQMKAL-GMNDKAINAACVTVRKDGKAIDIDGDYSETLARLTS 239

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
            K   G  GL FY+NNAD LK+  I+GI PS  TI +G Y ISRPL FYVK+ H   V G
Sbjct: 240 GKIGIGVFGLFFYENNADKLKVASINGIYPSAETISNGSYLISRPLFFYVKKLHLAIVPG 299

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           ++EYV   +SD+M+   S L +YGLIPIS  ER+  RD+   GK 
Sbjct: 300 MQEYVDLFLSDQMIGLHSPLTEYGLIPISERERQVQRDAFYSGKV 344


>gi|144900231|emb|CAM77095.1| ABC-type phosphate transport system [Magnetospirillum
           gryphiswaldense MSR-1]
          Length = 343

 Score =  261 bits (665), Expect = 1e-67,   Method: Composition-based stats.
 Identities = 108/329 (32%), Positives = 186/329 (56%), Gaps = 4/329 (1%)

Query: 17  YCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIG 76
                  AR++IR+ GSST++P++  +AE F +   +FKTP VES G+  G K FC G+G
Sbjct: 16  SFAGAAQARDQIRVVGSSTVYPFTTAVAEQFGKA-GKFKTPVVESTGTGGGFKLFCAGVG 74

Query: 77  DDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKA 136
            D  D+ N+SR I ++E++ C K+GV+D+ E+ +G+DGI+L + +    + +T + L+ A
Sbjct: 75  PDHPDLTNASRAIKKSEMESCAKNGVTDVVEMKVGYDGIVLAASKKAKHIDVTRKQLFLA 134

Query: 137 LASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
           LA  + V+ K+V NP   W++I P  P  +I +  P    GTR+   + V++ G      
Sbjct: 135 LAKEVPVNGKLVENPYTTWNQIDPSLPASKIEVLGPPPTSGTRDAFLELVMESGAE---A 191

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
           F +++++ K + +      +S+R+DG  +E   +    + +++ N + FG  G SF   N
Sbjct: 192 FPEIKELKKTDEKAFKKVFSSIREDGAYVEAGENDNLIVQKLDANANAFGIFGYSFLDQN 251

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
           +D L+   +DG+ P+   I +G YP+SRPL  Y K+ H   + G++EY++   S++    
Sbjct: 252 SDKLQGSMVDGVAPTFEAIAAGKYPVSRPLFVYAKKAHVGQIPGIKEYLAEYTSEKAWGK 311

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGKS 345
              L   GLIP+ + ERK     I   ++
Sbjct: 312 SGYLADKGLIPMPDSERKEWAAKINGLEA 340


>gi|92113600|ref|YP_573528.1| periplasmic phosphate binding protein [Chromohalobacter salexigens
           DSM 3043]
 gi|91796690|gb|ABE58829.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chromohalobacter salexigens DSM 3043]
          Length = 341

 Score =  260 bits (664), Expect = 2e-67,   Method: Composition-based stats.
 Identities = 116/348 (33%), Positives = 175/348 (50%), Gaps = 17/348 (4%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTF---ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           M            +    G        R ++RI GSST++P++  + E F     ++ TP
Sbjct: 1   MNRILKTTALAAAVMSVAGVAQAQDETREQLRIVGSSTVYPFASYVVEEFGATT-DYPTP 59

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +ES GS  GL+ FC G+G DT DI N+SR++  +E + C+++GV+DI E  IG+DGI  
Sbjct: 60  VIESTGSGGGLRLFCNGVGLDTPDITNASRRMKPSEFERCQENGVTDITEAKIGYDGIAF 119

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
                   V+ T E L+ ALA+ +  D ++V NP  KWS+I    P+  I +Y P    G
Sbjct: 120 AESNTNEPVNFTREQLFLALAAKVPQDGELVDNPYTKWSDIDSSLPDREIMVYGPPTTSG 179

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           TR+  E+ V++        +                  T +RQDG  ++   +    + R
Sbjct: 180 TRDAFEELVMEAASEEMDAY-------------GGEGYTDIRQDGPYVDAGENDNLIVQR 226

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           ++ N   FG  G SF + NAD L    IDG+ P    I SG YP+SR L FYVK QH +S
Sbjct: 227 LQENTTAFGIFGYSFLEENADSLTAASIDGVEPEPEAISSGEYPVSRSLFFYVKNQHADS 286

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           V  +  YV   +S++M++P   L   GLIP+  + R+  R  +   +S
Sbjct: 287 VPAMYPYVDLFMSEQMISPMGYLKGLGLIPLPEDAREQARSDVENRES 334


>gi|254788386|ref|YP_003075815.1| phosphate binding protein [Teredinibacter turnerae T7901]
 gi|237686635|gb|ACR13899.1| phosphate binding protein [Teredinibacter turnerae T7901]
          Length = 347

 Score =  259 bits (661), Expect = 5e-67,   Method: Composition-based stats.
 Identities = 114/345 (33%), Positives = 182/345 (52%), Gaps = 8/345 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   V                 AR+ I I GSST+FP+SK++AE F      FK+P VE
Sbjct: 1   MKKLLVWTFAAATTMAASSAFA-ARDSISIVGSSTVFPFSKVVAERFGRATK-FKSPTVE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K+FC G+G +  D+ N+SR+I Q ELD CK +GV+DI EV IG+DGI++ + 
Sbjct: 59  STGTGGGFKQFCGGVGVNFPDMSNASRRIKQAELDNCKANGVTDIVEVLIGYDGIVIANS 118

Query: 121 RDMVSVSLTVEDLYKALASYLI---VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
                + L+ +DL+ ALA  +      D +V NP K W ++ P  P ++I +  P    G
Sbjct: 119 VKAKQMKLSRKDLFLALAKKVPNPSGGDTLVDNPYKTWKDVNPTLPAIKIEVLGPPPTSG 178

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           TR+   +  ++ GC     FS ++     +  +    C  +R+DG  IE   +    + +
Sbjct: 179 TRDAFVELAMEGGC---SQFSFIKAYKSSDKNRFKEVCHILREDGAFIEAGENDNLIVQK 235

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           +  N +  G  G SF   NAD ++   +DG +P+  TI  G YP+SRPL FYVK+ H   
Sbjct: 236 LNANPNALGIFGFSFLDQNADKVQASYVDGSLPTFDTIADGAYPVSRPLYFYVKKAHIGL 295

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           + G+ ++++   S++    +  L + GLIP+  + R ++   +  
Sbjct: 296 IPGIEQFLAEFTSEKAWGDEGYLSEKGLIPLDEDRRATIAKRVKA 340


>gi|118589312|ref|ZP_01546718.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Stappia aggregata IAM 12614]
 gi|118438012|gb|EAV44647.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Stappia aggregata IAM 12614]
          Length = 346

 Score =  259 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 154/347 (44%), Positives = 214/347 (61%), Gaps = 6/347 (1%)

Query: 1   MRFFFVV-LMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+F  +V      V          AR++++IAGSST+ PY+ I+AE F E   +F TP V
Sbjct: 1   MKFTTLVSATALAVASTAFVGSAQARDQVQIAGSSTVLPYASIVAEAFGE-NTDFPTPVV 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ESGGSS GLK+FC G+G++TIDI N+SR I + E+  C + GV DI EV IG+DGI+  S
Sbjct: 60  ESGGSSAGLKKFCTGVGENTIDIANASRAIREKEIKACAEAGVKDIIEVRIGYDGIVFAS 119

Query: 120 DRDMVSVS-LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
            +D  + +  T    + AL+  ++ D ++V NP  KWSE+    P+  IA ++P  KHGT
Sbjct: 120 QKDGPAFNEFTQVQWFNALSPKVLKDGQIVDNPYTKWSEVDASLPDAEIAAFIPGTKHGT 179

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
           REV E+KVL  GC  S     M D    +      AC +VR DG ++++DGDYTETLARI
Sbjct: 180 REVFEEKVLAVGCEESGALKAMID-GGMSEDDAEDACIAVRTDGKSVDIDGDYTETLARI 238

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           + N +  G  GL+FY+NN D LK+  + G+ PS  TI +G YP+SRPL FY+K+ H   +
Sbjct: 239 DSNPNGVGVFGLAFYENNTDKLKVATMAGVAPSTETIAAGEYPVSRPLFFYIKKAHIGVI 298

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
            GL+EY  F VSDE+  PD  L QYGL+  S+ E  + + SI   ++
Sbjct: 299 PGLKEYAQFFVSDEIAGPDGPLAQYGLV--SDPELAATQASIEAEET 343


>gi|51245733|ref|YP_065617.1| phosphate ABC transporter periplasmic-binding protein [Desulfotalea
           psychrophila LSv54]
 gi|50876770|emb|CAG36610.1| related to phosphate ABC transporter, periplasmic binding protein
           [Desulfotalea psychrophila LSv54]
          Length = 346

 Score =  259 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 106/348 (30%), Positives = 189/348 (54%), Gaps = 8/348 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    VL+   +  +  GT   AR+ I + GSST++P++ ++AE F +    F TP +E
Sbjct: 1   MK-VKTVLLGCTISLLAAGTALAARDYISVVGSSTVYPFATVVAEQFGKTT-NFATPKIE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G K FC G+G +  DI N+SR I  +E ++C+ +GV DI EV IG+DGI+L + 
Sbjct: 59  STGSGGGFKLFCSGLGVNYPDITNASRAIKSSEFNQCQANGVGDIVEVKIGYDGIVLANS 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDK---VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           ++   + L+ ++++ ALA  +        ++ NP K W ++ P  P  +I +  P    G
Sbjct: 119 KERAPLKLSRKEIFMALAMQVPDPQDPTKMIANPYKTWRDVNPQLPATQIEVLGPPPTSG 178

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           TR+   +  ++ G   ++ F  ++ + K + +     C ++R+DG  IE   +    + +
Sbjct: 179 TRDAFVELAMESG---AKQFDSIKALKKADKKAYKKICHTIREDGAYIEAGENDNLIVQK 235

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           ++ N    G  G SF + NAD+++   I+G+ P+   I  G YP+SRPL FYVK+ H + 
Sbjct: 236 LQANPAAVGIFGFSFLEQNADLVQGSFIEGMEPTFEAIADGSYPVSRPLFFYVKKAHVDV 295

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           + G++ +++   S++    +  L   G+IP+   ER     ++   K+
Sbjct: 296 IPGMKGFLAEFTSEKAWGDEGYLADKGMIPMPEAERAEYAQAVKELKT 343


>gi|320352743|ref|YP_004194082.1| PhoT family phosphate ABC transporter substrate-binding protein
           [Desulfobulbus propionicus DSM 2032]
 gi|320121245|gb|ADW16791.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Desulfobulbus propionicus DSM 2032]
          Length = 350

 Score =  259 bits (660), Expect = 6e-67,   Method: Composition-based stats.
 Identities = 111/333 (33%), Positives = 177/333 (53%), Gaps = 7/333 (2%)

Query: 15  EVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRG 74
                     R+ I I GSST++P++  +AE F +    FKTP +ES G+  G+K FC G
Sbjct: 17  TATLAPAADGRDYISIVGSSTVYPFATAVAEQFGKSTK-FKTPKIESTGTGGGMKLFCAG 75

Query: 75  IGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLY 134
            G DT DI N+SR++   E+D C+K+GV+++ EV +G+DGI++ + +    + L+ ++L+
Sbjct: 76  AGVDTPDIANASRRMKPAEMDTCRKNGVAEVVEVKVGYDGIVIANSKKAEPMQLSRKELF 135

Query: 135 KALASYLI---VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGC 191
            ALA  +      DK+V NP   W EI  + P+ +I +  P    GTR+   + V+ EGC
Sbjct: 136 LALAKEVPSPEGGDKLVANPYTTWKEINKELPDSKIEVLGPPPTSGTRDAFVELVMDEGC 195

Query: 192 VRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLS 251
                F  ++ + K + ++    C +VR+DG  +E   +    + ++E N    G  G S
Sbjct: 196 ---TAFDSIKALKKSDEKKFKAVCQTVREDGAYVEAGENDNLIVQKLEANPKSLGIFGFS 252

Query: 252 FYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSD 311
           F   NAD ++   +DG  P+   I +G Y +SRPL  YVK+ H   + G+ EY++   SD
Sbjct: 253 FLDQNADKIQGAVVDGEAPTFDNIAAGKYAVSRPLYIYVKKAHVGVIPGMAEYLAEFTSD 312

Query: 312 EMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
                +  L + GLIP   EER  +       K
Sbjct: 313 RAWGEEGYLAEKGLIPAPAEERTRMAADAKALK 345


>gi|262276142|ref|ZP_06053951.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Grimontia hollisae CIP 101886]
 gi|262219950|gb|EEY71266.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Grimontia hollisae CIP 101886]
          Length = 346

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 119/347 (34%), Positives = 191/347 (55%), Gaps = 7/347 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTF--ARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           M+   ++ +  V L  +         R+ I I GSST++P++ ++AE F     EF  P 
Sbjct: 1   MKLKALIAVSTVCLSAFTANHAAAANRDYISIVGSSTVYPFATVVAERFGR-TSEFSVPK 59

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           +ES GS  GLK FC G+G++T DI N+SRKI  +E+  C K+GV DI E+ IG+DGI   
Sbjct: 60  IESTGSGGGLKLFCAGVGENTPDITNASRKIKSSEVALCAKNGVKDITEIKIGYDGIAFA 119

Query: 119 SDRDMVSVSLTVEDLYKALASYLIV-DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           + +    + LT++DL+ ALA  +   +  ++ NP   W ++ P  P ++I +  P    G
Sbjct: 120 NSKKSQQLDLTLKDLFTALAKVVPDANGNLIENPNNTWKDVNPSLPAIKIEVLGPPPTSG 179

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           TR+   +  ++ GC   + + +++ M K + ++    C  +R+DG  IE   +    + +
Sbjct: 180 TRDAFVELAMEGGC---KQYPELKAMKKQDSKKYKAVCHGIREDGAFIEAGENDNLIVQK 236

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           ++ N + FG  G SF + NAD ++   I G+VP+   I  G YPISR L FYVK+ H N 
Sbjct: 237 LDANPNAFGIFGYSFLEQNADKVQGAKIGGVVPTFDAIGDGSYPISRSLYFYVKKAHANV 296

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + GL+ YVS   S++ +  +  L   GLIP+S  + K VR+     K
Sbjct: 297 IPGLQAYVSAFTSEDAIGEEGYLTDRGLIPLSARDWKLVRNDAVDLK 343


>gi|327192732|gb|EGE59668.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli CNPAF512]
          Length = 366

 Score =  258 bits (659), Expect = 7e-67,   Method: Composition-based stats.
 Identities = 170/321 (52%), Positives = 223/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 46  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 105

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE + CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 106 ASRPINKNEAEACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYVPADIYKALAAQVVVD 165

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 166 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEI 225

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC +VR+DG A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 226 -SDKAAQGKACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 284

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PD  L +YG
Sbjct: 285 VNGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDGPLAEYG 344

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 345 LVAAPDAERDAIRKDVEAGKS 365


>gi|86356163|ref|YP_468055.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli CFN 42]
 gi|86280265|gb|ABC89328.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli CFN 42]
          Length = 344

 Score =  258 bits (659), Expect = 8e-67,   Method: Composition-based stats.
 Identities = 172/321 (53%), Positives = 225/321 (70%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I+IAGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQIAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NEL+ CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRSINKNELEACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +    + AC +VR+DG A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 204 -SDKAAQTKACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PD  L +YG
Sbjct: 263 VNGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDGPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 323 LVAAPDAERDAIRKDVEAGKS 343


>gi|117924842|ref|YP_865459.1| phosphate binding protein [Magnetococcus sp. MC-1]
 gi|117608598|gb|ABK44053.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Magnetococcus sp. MC-1]
          Length = 344

 Score =  258 bits (658), Expect = 9e-67,   Method: Composition-based stats.
 Identities = 117/343 (34%), Positives = 183/343 (53%), Gaps = 7/343 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+  FV      V          AR++IRI GSST+FP++  +AE F      FKTP +E
Sbjct: 1   MKKLFVAAAM--VSMAMAAPQAEARDQIRIVGSSTVFPFATTVAEQFGRSTS-FKTPVIE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  GLK FC G+G D  DI N+SR+I ++E++ C K+ + +I EV +G+DGI+L + 
Sbjct: 58  STGSGGGLKLFCAGLGFDHPDITNASRRIKKSEVELCAKNDIKEIVEVKVGYDGIVLANS 117

Query: 121 RDMVSVSLTVEDLYKALASYLIV-DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           +    +SL++ D++ A A  +   +  ++ NP   W ++ P  P+  I I+ P    GTR
Sbjct: 118 KSAPLMSLSLRDIFMATAKMVPDANGNLIANPNMTWDQVNPKLPKTPIIIFGPPPTSGTR 177

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   +  ++ GC   + F  ++DM K + ++    C  VR+DG  +E   +    + ++ 
Sbjct: 178 DAFAELAMEGGC---KTFPAIKDMKKTDKKKYKALCHGVREDGAYVEAGENDNLIVQKLV 234

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            N    G  G SF + NAD ++   +    P+   I SG YP+SR L FYVK++H   V 
Sbjct: 235 ANPISMGIFGYSFLEQNADKVQGSLVMETTPTFENIASGKYPVSRSLYFYVKKKHVGLVP 294

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           G++EY++   SD+    D  L   GLIP+   ERK     I  
Sbjct: 295 GIKEYLAEFSSDKAWGDDGYLADKGLIPMPAAERKKFSMDIKE 337


>gi|71083869|ref|YP_266589.1| phosphate ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
 gi|71062982|gb|AAZ21985.1| phosphate ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
          Length = 338

 Score =  258 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 122/339 (35%), Positives = 189/339 (55%), Gaps = 11/339 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   ++L    V+     +   AR++IRI GSST++PY+ ++AENF +   +FKTP +E
Sbjct: 1   MKNVKIILSILTVM--LFASNVQARDQIRIVGSSTVYPYATVVAENFGK-TGKFKTPVIE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G+K FC G+G D  DI N+SR I   E   C+K+GV++I E+ +G+DGI L   
Sbjct: 58  STGTGGGMKLFCAGVGTDHPDITNASRAIKSKEKALCEKNGVTEIIEIIVGNDGISLAHA 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            D    + T E L++ALA+ + VD K+V NP K+WS+I P  P  +I I +     GTR+
Sbjct: 118 VDSPDSNFTKEQLWRALANEVDVDGKLVANPYKQWSDIDPSLPSKKIEILIAPPTSGTRD 177

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
                V+ +GC +        +       + S  CT +R+DG A+E   + T  + ++  
Sbjct: 178 AWNSLVMSKGCSK--------EAKALFGDKASSECTKIREDGYAVEAGENDTLIVQKLAS 229

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N D +GF G S+   N D +K   I+G+ PS+  I    YPI+RPL FYVK+ H   V G
Sbjct: 230 NPDAYGFFGYSYLVGNKDKVKAAAIEGVKPSLEGIQDYSYPIARPLFFYVKKAHIGVVPG 289

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           +  ++    S + M P   L + GL+P++  +   VR +
Sbjct: 290 IDAFIKDFTSKKAMGPRGYLAEIGLVPLAKAKYDVVRTA 328


>gi|15887768|ref|NP_353449.1| ABC transporter, substrate binding protein (phosphate)
           [Agrobacterium tumefaciens str. C58]
 gi|15155338|gb|AAK86234.1| ABC transporter, substrate binding protein (phosphate)
           [Agrobacterium tumefaciens str. C58]
          Length = 344

 Score =  258 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 163/319 (51%), Positives = 223/319 (69%), Gaps = 1/319 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE F+E FP FK P VESGG+  GLK FC G+G+ TIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAETFAETFPNFKAPVVESGGTGGGLKAFCSGVGEGTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I  +EL  CK  GV+D+QEV IG+DGI+   D     + L  +DLY ALA+ ++ D
Sbjct: 84  ASRPIKSDELAACKAAGVADVQEVKIGYDGIVFAMDSSNKDIKLEPKDLYLALAAEIVKD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSEI  + P+V IA Y+P  KHGTREV E+K++ +GC  ++    ++ + 
Sbjct: 144 GKLVANPYKKWSEINKELPDVAIAAYIPGSKHGTREVFEEKIMADGCKEAKATDAIKALI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +Q +  C +VR+DG A+++DGDYTETLARI+ NK   G  GL+FY+NNAD LK+  
Sbjct: 204 -TDAKQAAAKCVAVRKDGAAVDIDGDYTETLARIDANKTGLGVFGLAFYENNADRLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+VPS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F VSDEM+ PDS L  YG
Sbjct: 263 VSGVVPSTETVASGKYPVSRPLFFYVKKAHLGVIPGLKEYVEFFVSDEMIGPDSPLANYG 322

Query: 325 LIPISNEERKSVRDSIAVG 343
           L+   ++ER+ +R   A G
Sbjct: 323 LVAAPDKEREEIRSKFAAG 341


>gi|288940129|ref|YP_003442369.1| phosphate ABC transporter periplasmic binding protein
           [Allochromatium vinosum DSM 180]
 gi|288895501|gb|ADC61337.1| phosphate ABC transporter periplasmic binding protein
           [Allochromatium vinosum DSM 180]
          Length = 347

 Score =  258 bits (657), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 111/327 (33%), Positives = 177/327 (54%), Gaps = 5/327 (1%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
            T   AR+ I I GSST+FP+S  +AE F      F TP VES G+  G+K FC G+G D
Sbjct: 18  STQAMARDTINIVGSSTVFPFSTAVAETFGRTTS-FNTPKVESTGTGGGMKLFCGGVGVD 76

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
             DI N+SR +  +E + C++ GV +I EV IG+DGI + + +   +  L+++D+Y ALA
Sbjct: 77  HPDITNASRAMKTSEFEACQEAGVKEITEVKIGYDGIAIANSKTSGAWDLSLKDVYLALA 136

Query: 139 SYLIVD-DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
             +       + NP K W ++  D PEV+I +  P    GTR+   +  ++ GC      
Sbjct: 137 KDVPDGKGGFMANPYKTWKDVNADLPEVKIEVLGPPPTSGTRDAFVELAMEGGCDS---I 193

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
            +++++ K +  +    C  +R+DG  IE   +    + ++  N    G  G SF   NA
Sbjct: 194 PEIKELKKTDKDKHKAVCHGIREDGAYIEAGENDNLIVQKLVANPSALGIFGYSFLDQNA 253

Query: 258 DVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           D ++   IDG+ P+  +I  G YP+SR + FYVK+ H  ++ G+ E+V    SD+   P+
Sbjct: 254 DKVQGAKIDGVDPTYDSISDGSYPVSRSIYFYVKKAHVGTIPGIEEFVKEFTSDKAWGPE 313

Query: 318 SQLFQYGLIPISNEERKSVRDSIAVGK 344
             L   GLI + ++ER +V ++    K
Sbjct: 314 GYLADKGLIALPDDERAAVAEAAQSLK 340


>gi|221639015|ref|YP_002525277.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides KD131]
 gi|221159796|gb|ACM00776.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           precursor [Rhodobacter sphaeroides KD131]
          Length = 347

 Score =  257 bits (656), Expect = 1e-66,   Method: Composition-based stats.
 Identities = 144/341 (42%), Positives = 211/341 (61%), Gaps = 3/341 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              + +  + +         AR+ I+ AGSST+ PY+ I+AE F E F ++ TP VESGG
Sbjct: 3   LLKLTVSSLAVVAASAGIAAARDNIQSAGSSTVLPYATIVAEAFGENF-DYPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K+ C G+G++TIDI NSS +I Q+++D C ++GV++I EV IG+DGI+  SD   
Sbjct: 62  SGAGRKKLCEGVGENTIDIANSSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIQG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              + T  D +KALA+ ++VD K+V NP K W ++  +F +  I  ++P  KHGTREV +
Sbjct: 122 PDFAFTPADWFKALAAQVVVDGKLVANPNKSWKDVNGEFSDQPILAFIPGTKHGTREVFD 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  S            +  +    C ++R DG ++++DGDYTETL+RI  NK+
Sbjct: 182 EKVILAGCEESGAMEAFAAANGGDEDKAEELCMTLRTDGASVDIDGDYTETLSRISANKN 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GLSFY+NN D LK+  + G+ PS+ TI +G YP+SRPL FYVK  H + + GL+E
Sbjct: 242 AIGVFGLSFYQNNTDKLKVATMSGVSPSVETIAAGDYPVSRPLFFYVKNAHLDVIPGLQE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           Y+ F VSDEM  PD  L  YGL+  S+ E    ++ +A  +
Sbjct: 302 YIEFFVSDEMAGPDGPLAAYGLV--SDPELAKTQEMVANRE 340


>gi|190890212|ref|YP_001976754.1| phosphate ABC transporter substrate-binding protein [Rhizobium etli
           CIAT 652]
 gi|190695491|gb|ACE89576.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli CIAT 652]
          Length = 344

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 171/321 (53%), Positives = 223/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE D CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRPINKNEADACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC +VR+DG A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 204 -SDKAAQGKACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PD  L +YG
Sbjct: 263 VNGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDGPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 323 LVAAPDAERDAIRKDVEAGKS 343


>gi|209966521|ref|YP_002299436.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Rhodospirillum centenum SW]
 gi|209959987|gb|ACJ00624.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Rhodospirillum centenum SW]
          Length = 346

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 113/341 (33%), Positives = 175/341 (51%), Gaps = 7/341 (2%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           +   +      V  V       AR +IRI GSST+FP++  + E F +    F  P +ES
Sbjct: 4   KKLALAAALAAVSVVGLTGVAEARQQIRIVGSSTVFPFTATVVERFGQTTS-FPAPILES 62

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            G+  G++ FC G+G D  DI  +SR +  +E D+C+K+GV ++ E+ IG DGI     +
Sbjct: 63  TGTGGGMRLFCAGVGADHPDITGASRAMKASEFDQCQKNGVEEVTEIMIGFDGIAFAHAK 122

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
               ++LT   L++ALA  + V+ ++V NP K+WS++ P  P   I +  P    GTR+ 
Sbjct: 123 SGPDINLTKAQLWQALAKEVEVNGQIVPNPHKRWSDVDPSLPNAPIEVLGPPPTSGTRDA 182

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
             + V+  GC        +    K         C ++R+DG+ IE   +    + R+E N
Sbjct: 183 WVELVMDTGCEEYPAVKSLAAARK------KAVCQTMREDGVFIEAGENDNLIVQRLEQN 236

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL 301
           KD +G  G S+ + N D LK   I G+ PS  TI SG YPISRPL  Y+K  H   + GL
Sbjct: 237 KDAYGIFGFSYLEENLDKLKGATISGVTPSFETIASGEYPISRPLFIYLKNAHVGVIPGL 296

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           +E+V+  V +     D  L   GL+ +  E    V++++  
Sbjct: 297 KEFVTEYVGERAAGEDGYLADKGLVAMPKERLAKVQETVKS 337


>gi|325291853|ref|YP_004277717.1| phosphate ABC transporter substrate-binding protein [Agrobacterium
           sp. H13-3]
 gi|325059706|gb|ADY63397.1| phosphate ABC transporter, substrate binding protein [Agrobacterium
           sp. H13-3]
          Length = 344

 Score =  257 bits (656), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 163/319 (51%), Positives = 222/319 (69%), Gaps = 1/319 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE F+E FP FK P VESGG+  GLK FC G+G+ TIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAETFAETFPNFKAPVVESGGTGGGLKAFCSGVGEGTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I  +EL  CK  GV+D+QEV IG+DGI+   D     + L  +DLY ALA+ ++ D
Sbjct: 84  ASRPIKSDELAACKAAGVADVQEVKIGYDGIVFAMDSSNKDIKLEPKDLYLALAAEIVKD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSEI  + P+V IA Y+P  KHGTREV E+K++ +GC  ++    ++ + 
Sbjct: 144 GKLVANPYKKWSEINKELPDVAIAAYIPGSKHGTREVFEEKIMADGCKEAKATDAIKALI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +Q +  C +VR+DG A+++DGDYTETLARI+ NK   G  GL+FY+NNAD LK+  
Sbjct: 204 -TDAKQAAAKCVAVRKDGAAVDIDGDYTETLARIDANKTGLGVFGLAFYENNADRLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+VPS  T+ SG YP+SRPL FYVK+ H   + GL+EYV F VSDEM+ PDS L  YG
Sbjct: 263 VSGVVPSTETVASGKYPVSRPLFFYVKKAHLGVIPGLKEYVEFFVSDEMIGPDSPLANYG 322

Query: 325 LIPISNEERKSVRDSIAVG 343
           L+    +ER+ +R   A G
Sbjct: 323 LVAAPEKEREEIRSKFAAG 341


>gi|116250314|ref|YP_766152.1| solute-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115254962|emb|CAK06036.1| putative solute-binding component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 344

 Score =  256 bits (654), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 172/321 (53%), Positives = 227/321 (70%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGGS  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPIVESGGSGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR I +NEL+ CK  GV+DIQEV IG+DGI+  +D     ++    D+YKALA+ ++VD
Sbjct: 84  SSRPINKNELEACKAAGVTDIQEVKIGYDGIVFATDASNPDLAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S   + +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGA-TDVIAKE 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC +VR+DG+A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 203 IADKAAQGKACVAVRKDGVAVDIDGDYPETLARIAANKTGLGVFGLSFYENNADKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PDS L +YG
Sbjct: 263 MSGIVPSTETISNGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER+++R  +  GK+
Sbjct: 323 LVAAPDAEREAIRKEVEAGKA 343


>gi|189500173|ref|YP_001959643.1| ABC-type phosphate transport system periplasmic component-like
           protein [Chlorobium phaeobacteroides BS1]
 gi|189495614|gb|ACE04162.1| ABC-type phosphate transport system periplasmic component-like
           protein [Chlorobium phaeobacteroides BS1]
          Length = 408

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 104/318 (32%), Positives = 182/318 (57%), Gaps = 8/318 (2%)

Query: 23  FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
            AR+ I + GSST++P++ ++AE F +   +FKTP +ES GS  G K F  G+G +  DI
Sbjct: 80  SARDYISVVGSSTVYPFATVVAEQFGK-TSDFKTPKIESTGSGGGFKLFAAGVGVEHPDI 138

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI 142
            N+SR+I ++E + C ++GVS++ E+ IG+DGI++ + +      ++ +D++ ALA  + 
Sbjct: 139 TNASRRIKKSECEMCAENGVSEVVELKIGYDGIVMANSKKAEPFKVSRKDIFLALAKEVP 198

Query: 143 V----DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                D  +V NP   W E+ P+ PEV+I +  P    GTR+   +  ++ G   ++ F+
Sbjct: 199 DPNGEDGTLVANPYTTWKEVNPELPEVKIEVLGPPPTSGTRDAFVELAMEAG---AKEFA 255

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
            ++ + K +  +      +VR+DG  +E   +    + +++ N D  G  G SF   N D
Sbjct: 256 WIKALKKEDKDKFKQISHTVREDGAYVEAGENDNLIVQKLDANPDALGVFGFSFLDQNKD 315

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
            ++   +DG+ P+   I  G YP+SRPL FYVK+ H  ++ G++EY++   S++    + 
Sbjct: 316 KVQGSFVDGVEPAFSAIADGSYPLSRPLYFYVKKAHVGTIPGMQEYLTEFTSEKAWGDEG 375

Query: 319 QLFQYGLIPISNEERKSV 336
            L + GLIP+  EER+  
Sbjct: 376 YLTEKGLIPMPKEEREKY 393


>gi|332558032|ref|ZP_08412354.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides WS8N]
 gi|332275744|gb|EGJ21059.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides WS8N]
          Length = 347

 Score =  256 bits (653), Expect = 3e-66,   Method: Composition-based stats.
 Identities = 144/340 (42%), Positives = 210/340 (61%), Gaps = 3/340 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              + +  + +         AR+ I+ AGSST+ PY+ I+AE F E F ++ TP VESGG
Sbjct: 3   LLKLTVSSLAVVAASAGIAAARDNIQSAGSSTVLPYATIVAEAFGENF-DYPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K+ C G+G++TIDI NSS +I Q+++D C ++GV++I EV IG+DGI+  SD   
Sbjct: 62  SGAGRKKLCEGVGENTIDIANSSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIQG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              + T  D +KALA+ ++VD K+V NP K W ++  +F +  I  ++P  KHGTREV +
Sbjct: 122 PDFAFTPADWFKALAAQVVVDGKLVANPNKSWKDVNGEFSDQPILAFIPGTKHGTREVFD 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  S            +  +    C ++R DG ++++DGDYTETL+RI  NK+
Sbjct: 182 EKVILAGCEESGAMEAFAAANGGDEDKAEELCMTLRTDGASVDIDGDYTETLSRISANKN 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GLSFY+NN D LK+  + G+ PS+ TI +G YP+SRPL FYVK  H + + GL+E
Sbjct: 242 AIGVFGLSFYQNNTDKLKVATMSGVSPSVETIAAGDYPVSRPLFFYVKNAHLDVIPGLQE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           Y+ F VSDEM  PD  L  YGL+  S+ E    ++ +A  
Sbjct: 302 YIEFFVSDEMAGPDGPLAAYGLV--SDPELAKTQEMVANR 339


>gi|126462030|ref|YP_001043144.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126103694|gb|ABN76372.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 347

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 145/340 (42%), Positives = 210/340 (61%), Gaps = 3/340 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              + +  + +         AR+ I+ AGSST+ PY+ I+AE F E F ++ TP VESGG
Sbjct: 3   LLKLTVSSLAVVAASAGIAAARDNIQSAGSSTVLPYATIVAEAFGENF-DYPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K+ C G+G++TIDI NSS +I Q+++D C ++GV++I EV IG+DGI+  SD   
Sbjct: 62  SGAGRKKLCEGVGENTIDIANSSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIQG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              + T  D +KALA+ ++VD K+V NP K W ++  DF +  I  ++P  KHGTREV +
Sbjct: 122 PDFAFTPADWFKALAAQVVVDGKLVANPNKSWKDVNGDFSDQPILAFIPGTKHGTREVFD 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  S            +  +    C ++R DG ++++DGDYTETL+RI  NK+
Sbjct: 182 EKVILAGCEESGAMEAFAAANGGDEDKAEELCMTLRTDGASVDIDGDYTETLSRISANKN 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GLSFY+NN D LK+  + G+ PS+ TI +G YP+SRPL FYVK  H + + GL+E
Sbjct: 242 AIGVFGLSFYQNNTDKLKVATMSGVSPSVETIAAGDYPVSRPLFFYVKNAHLDVIPGLQE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           Y+ F VSDEM  PD  L  YGL+  S+ E    ++ +A  
Sbjct: 302 YIEFFVSDEMAGPDGPLAAYGLV--SDPELAKTQEMVANR 339


>gi|77463158|ref|YP_352662.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides 2.4.1]
 gi|77387576|gb|ABA78761.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Rhodobacter sphaeroides 2.4.1]
          Length = 347

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 145/340 (42%), Positives = 210/340 (61%), Gaps = 3/340 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              + +  + +         AR+ I+ AGSST+ PY+ I+AE F E F ++ TP VESGG
Sbjct: 3   LLKLTVSSLAVVAASAGIAAARDNIQSAGSSTVLPYATIVAEAFGENF-DYPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K+ C G+G++TIDI NSS +I Q+++D C ++GV++I EV IG+DGI+  SD   
Sbjct: 62  SGAGRKKLCEGVGENTIDIANSSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIQG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              + T  D +KALA+ ++VD K+V NP K W ++  DF +  I  ++P  KHGTREV +
Sbjct: 122 PDFAFTPADWFKALAAQVVVDGKLVANPNKSWKDVNGDFSDQPILAFIPGTKHGTREVFD 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  S            +  +    C ++R DG ++++DGDYTETL+RI  NK+
Sbjct: 182 EKVVLAGCEESGAMEAFAAANGGDEDKAEELCMTLRTDGASVDIDGDYTETLSRISANKN 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GLSFY+NN D LK+  + G+ PS+ TI +G YP+SRPL FYVK  H + + GL+E
Sbjct: 242 AIGVFGLSFYQNNTDKLKVATMSGVSPSVETIAAGDYPVSRPLFFYVKNAHLDVIPGLQE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           Y+ F VSDEM  PD  L  YGL+  S+ E    ++ +A  
Sbjct: 302 YIEFFVSDEMAGPDGPLAAYGLV--SDPELAKTQEMVANR 339


>gi|18181925|dbj|BAB83861.1| periplasmic phosphate binding protein [Rhodobacter sphaeroides f.
           sp. denitrificans]
          Length = 347

 Score =  256 bits (653), Expect = 4e-66,   Method: Composition-based stats.
 Identities = 145/341 (42%), Positives = 209/341 (61%), Gaps = 3/341 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              + +  + +         AR+ I+ AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   LLKLTVSSLAVVAASAGIAAARDNIQSAGSSTVLPYATIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K+ C G+G++TIDI NSS +I Q+++D C ++GV++I EV IG+DGI+  SD   
Sbjct: 62  SGAGRKKLCEGVGENTIDIANSSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIQG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              + T  D +KALA+ ++VD K+V NP K W ++  D  +  I  ++P  KHGTREV +
Sbjct: 122 PDFAFTPADWFKALAAQVVVDGKLVANPNKSWKDVNGDLSDQPILAFIPGTKHGTREVFD 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  S            +  +    C ++  DG ++++DGDYTETL+RI  NKD
Sbjct: 182 EKVILAGCEESGAMEAFAAANGGDEDKAEELCMTLYTDGASVDIDGDYTETLSRISANKD 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GLSFY+NN D LK+  + G+ PS+ TI +G YP+SRPL FYVK  H + + GL+E
Sbjct: 242 AIGVFGLSFYQNNTDKLKVATMSGVTPSVETIAAGDYPVSRPLYFYVKNAHLDVIPGLQE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           Y+ F VSDEM  PD  L  YGL+  S+ E    ++ +A  +
Sbjct: 302 YIEFFVSDEMAGPDGPLAAYGLV--SDPELAKTQEMVANRE 340


>gi|153870082|ref|ZP_01999555.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Beggiatoa sp. PS]
 gi|152073455|gb|EDN70448.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Beggiatoa sp. PS]
          Length = 347

 Score =  256 bits (652), Expect = 5e-66,   Method: Composition-based stats.
 Identities = 113/341 (33%), Positives = 184/341 (53%), Gaps = 8/341 (2%)

Query: 9   MCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGL 68
           +    L          R+ I I GSST++P++ ++AE F +   +FKTP +ES G+  G+
Sbjct: 8   IILAFLTTPSLVLASGRDVINIVGSSTVYPFATVVAERFGKS-SQFKTPKIESTGTGGGI 66

Query: 69  KEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSL 128
           K FC G+  +T DI N+SR++ Q+E D+C+K+GV++I EV +G+DGI+L +      + L
Sbjct: 67  KLFCAGVDINTPDITNASRRMKQSEFDQCQKNGVTEIVEVLVGYDGIVLANTIAKPQMQL 126

Query: 129 TVEDLYKALASYLIVDDK----VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           +V D++ ALA  +         ++ NP K W ++ P  P  +I I  P    GTR+   +
Sbjct: 127 SVRDIFLALAKSVPAFQNGSPTLIANPYKTWRDVNPKLPANKIEILGPPPTSGTRDAFAE 186

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
             L+ GC   + F  ++ + K +  +    C  VR+DG  IE   +    + ++  N   
Sbjct: 187 LALEGGC---KTFEWIKALKKTDKSRYKAICHEVREDGAYIEAGENDNLIVQKLVANPKA 243

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G  G SF   N+D+++   I+G      +I SG YPISRPL FYVK+ H   V G+ EY
Sbjct: 244 VGVFGFSFLDQNSDMIQGSIINGAEAEFDSIASGAYPISRPLYFYVKKAHIGVVPGIAEY 303

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           ++   S+     +  L   GLIP+ + +R++VR S    ++
Sbjct: 304 IATFTSEAAYGEEGYLTDKGLIPLDDAKRQAVRQSAKNLQN 344


>gi|89054780|ref|YP_510231.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Jannaschia sp. CCS1]
 gi|88864329|gb|ABD55206.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Jannaschia sp. CCS1]
          Length = 344

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 142/343 (41%), Positives = 213/343 (62%), Gaps = 4/343 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M F  + +    V  +       +R+ ++IAGSST+ PY+ I+AE F E F +F TP VE
Sbjct: 1   MSFAKLSVSVLAVTAITTAASAQSRDNVQIAGSSTVLPYATIVAEAFGENF-DFPTPVVE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GL+ FC G+G++T DI NSSR I ++E+  C ++GV+DI EV  G+DGI+  SD
Sbjct: 60  SGGSSTGLRRFCEGVGENTTDIANSSRSIRESEIATCAENGVTDIIEVRFGYDGIVFASD 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +  S   T  D + ALA+ L VD ++V NP   WS++R   P+  I+ +VP  +HGTRE
Sbjct: 120 INGPSFEFTQSDWHLALAAELPVDGEMVANPNTNWSQVRDGLPDQPISAFVPGTRHGTRE 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V +++V+ +GC  + + + + DM   +      AC  +R DG+++++DGDYTETLARI  
Sbjct: 180 VFDERVILQGCEDNGSMAAIMDM-GMDEDAAEEACMELRADGVSVDIDGDYTETLARINA 238

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           + +  G  GL+FY+NN  VL++  + G+VP++  I +G YP+SRPL FY+K  H   + G
Sbjct: 239 DANGIGVFGLAFYENNTSVLQVATMAGVVPTVDAIATGEYPVSRPLYFYIKAAHLGVIPG 298

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           L+EY  F VSD++      L  YGL+  S+ E    +  +A G
Sbjct: 299 LQEYADFFVSDDIAGDWGPLAAYGLV--SDPELAETQAIVANG 339


>gi|154250850|ref|YP_001411674.1| phosphate ABC transporter periplasmic-binding protein [Parvibaculum
           lavamentivorans DS-1]
 gi|154154800|gb|ABS62017.1| phosphate ABC transporter, periplasmic binding protein
           [Parvibaculum lavamentivorans DS-1]
          Length = 359

 Score =  255 bits (651), Expect = 6e-66,   Method: Composition-based stats.
 Identities = 116/319 (36%), Positives = 174/319 (54%), Gaps = 7/319 (2%)

Query: 23  FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
            AR++I++ GSST+FP+S+  AE F+        P VES G+  G+K FC G+G    D+
Sbjct: 38  HARDQIQVVGSSTVFPFSQAAAEQFANET-GSPAPVVESTGTGGGMKIFCGGVGTGHPDV 96

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI 142
             +SR +  +E + C  +GV+DI EV +G DG+ +   R+   + LT + L++ALA  + 
Sbjct: 97  TGASRAMKLSEYELCTSNGVTDITEVLLGFDGLSMAVSRNGQQLDLTKKQLFQALADKVE 156

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           VD K+V NP KKWS+I P  P V I++  P    GTR+   + V++EGC        +  
Sbjct: 157 VDGKLVANPYKKWSDIDPSLPNVAISVMGPPPTSGTRDAWVELVMEEGCKEFPAIEAL-- 214

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
               +      AC  +R DG  IE   +    + R+E +   +G  G SF   N D L+ 
Sbjct: 215 ----DKDAHKEACQRMRTDGPFIEAGENDNLIVQRLESDPTSYGIFGYSFLYENQDKLQP 270

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
           V I+G+ P+  TI  G Y ISRP+ FYVK  H   + GL E+V+   SDE M     L +
Sbjct: 271 VKIEGVAPNEETIADGSYKISRPIFFYVKNAHRGVIPGLNEFVAEYTSDEAMGTGGYLEE 330

Query: 323 YGLIPISNEERKSVRDSIA 341
            GLIP++++ R  V+ +  
Sbjct: 331 RGLIPLADDRRAEVQKAAK 349


>gi|254456439|ref|ZP_05069868.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083441|gb|EDZ60867.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Candidatus Pelagibacter sp. HTCC7211]
          Length = 344

 Score =  255 bits (650), Expect = 7e-66,   Method: Composition-based stats.
 Identities = 120/339 (35%), Positives = 184/339 (54%), Gaps = 4/339 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   ++L  F+VL +   T   AR++I I GSST+FPY+ ++AE F +    FKTP +E
Sbjct: 1   MKKLTIILASFLVLTLSTVTS-QARDQITIVGSSTVFPYATVVAERFGKK--GFKTPIIE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G+G+   DI N+SR +   E   C K+G++DI E+ IG+DGI L   
Sbjct: 58  STGTGGGAKLFCAGVGEAHPDITNASRAMKDKEKALCAKNGITDIVEIIIGNDGITLAYS 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            D   V+ T E LY ALA + +VD K+V N  K W+EI    P   I + +P G  GTR+
Sbjct: 118 LDAEPVNFTKEHLYLALAKHTVVDGKLVDNIYKNWNEIDSSLPNKPIKVMIPPGTSGTRD 177

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
                V+++G +     +  +  +    ++        R+DG+AIEV  + +  + ++  
Sbjct: 178 AWNSLVMKKG-MTKEAKALYKAGYAAGNKKYKKPQKLYREDGLAIEVGENDSLIIQKLVE 236

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD+FGF G S+Y    D L+   IDG  PS+ +I    Y ++RPL FYVK+ H   + G
Sbjct: 237 DKDMFGFFGFSYYLAAKDKLQAASIDGGQPSLESIQDYSYAVARPLFFYVKKAHVGVIPG 296

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           L E+V        +     L   GL+P+     ++ RD+
Sbjct: 297 LHEFVKEFTKTGTIGKRGYLADIGLVPLDKAMYRTTRDN 335


>gi|218672744|ref|ZP_03522413.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           etli GR56]
          Length = 350

 Score =  255 bits (650), Expect = 8e-66,   Method: Composition-based stats.
 Identities = 167/319 (52%), Positives = 225/319 (70%), Gaps = 1/319 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE + CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRAINKNEAEACKAAGVTDIQEVKIGYDGIVFATDSSNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S   + +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGA-TDVIAKE 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC +VR+DG A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 203 ISDKAAQGKACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++GIVPS+ TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ P+  L +YG
Sbjct: 263 VNGIVPSVETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPEGPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAVG 343
           L+   + ER+++R ++  G
Sbjct: 323 LVAAPDAEREAIRKAVEAG 341


>gi|302384352|ref|YP_003820175.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Brevundimonas subvibrioides ATCC 15264]
 gi|302194980|gb|ADL02552.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Brevundimonas subvibrioides ATCC 15264]
          Length = 357

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 103/340 (30%), Positives = 171/340 (50%), Gaps = 7/340 (2%)

Query: 2   RFFFVVLMCFVVLEVYC---GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           R   V     + L +     G    AR+ I  AGSST+FP++  +AENF+   P+   P 
Sbjct: 7   RRLSVAATAVMALSLAACGQGGPRTARDGIWAAGSSTVFPFATRVAENFARNNPDASPPR 66

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           VES G+  G++ FC+G+G  T DI N+SR + ++E ++C ++GV++I E+ IG+DGI++ 
Sbjct: 67  VESLGTGGGIQAFCQGVGPSTPDIANASRPMKKSEFEKCAENGVTEIVELKIGYDGIVVA 126

Query: 119 SDRDMVSVSLTVEDLYKALASYLIV-DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           + R   S +  + DLY+ LA  +   +   V NP + W+++    P  RI +Y P    G
Sbjct: 127 TSRTGNSFNFELNDLYEGLAKEVPGPNGTFVLNPARTWNQVNSGLPNQRIQVYGPPPTSG 186

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           TR+   +  +  G   ++       +   +  +      +VR+DG  I+   +    L  
Sbjct: 187 TRDAFLELGMTPG---AKLVPAAAVVAAQDPDRFEGLAHTVREDGSWIDSGENDNAILQT 243

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           +       G  G SF + N D +K   IDG+ P+   I +G YP++R L  YVK+ H   
Sbjct: 244 LTRTPGSLGVFGFSFLEQNLDTVKAETIDGVYPTAEAIANGTYPLARSLFIYVKKAHVGV 303

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
             GL+E++    S+  +     L   GL+P+   E  + R
Sbjct: 304 TPGLQEFLIEFTSEAAVGQGGYLQDRGLVPLPEPELVAQR 343


>gi|83942439|ref|ZP_00954900.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sulfitobacter sp. EE-36]
 gi|83846532|gb|EAP84408.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sulfitobacter sp. EE-36]
          Length = 346

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 152/339 (44%), Positives = 220/339 (64%), Gaps = 3/339 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              +    + +     T   AR+++++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   LVKLTTSALAIAAVSATAAAARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TID+ N+SR+I  +E++ C  +GV+DI EV IG+DGI+  SD + 
Sbjct: 62  SSAGLKRFCEGVGENTIDVANASRQIKSSEVEACAANGVTDIIEVQIGYDGIVFASDING 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            +   T ED YKAL++ ++VD ++V NP K WS++   FPE  I  Y+P  KHGTREV E
Sbjct: 122 NTFEFTPEDWYKALSAEVVVDGEIVANPNKMWSDVNASFPEQPIQAYIPGTKHGTREVFE 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  + +F   +     + +    AC ++R DG+++++DGDYTETLARIE NKD
Sbjct: 182 EKVILAGCEATGDFEAFKAANGDDKKAAEKACIALRTDGVSVDIDGDYTETLARIESNKD 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GL+FY+NN D L +  + G+ P++ TI SG YP+SRPL FYVK+ H   + GL+E
Sbjct: 242 GIGVFGLAFYENNTDKLTVANMSGVEPTVETISSGDYPVSRPLFFYVKKAHIGVIPGLKE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           Y  F V+DE+  PD  L +YGL+  S+ E    +  +A 
Sbjct: 302 YAEFFVADEIAGPDGPLAEYGLV--SDPELAKTQSVVAE 338


>gi|259415703|ref|ZP_05739623.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Silicibacter sp. TrichCH4B]
 gi|259347142|gb|EEW58919.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Silicibacter sp. TrichCH4B]
          Length = 346

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 150/342 (43%), Positives = 217/342 (63%), Gaps = 3/342 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           F  +    + +     T   AR+++++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   FVKLTASTLAIAAVSATAAAARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TID+ N+SR I + E+  C + GV+DI EV IG+DGI+  SD + 
Sbjct: 62  SSAGLKRFCEGVGENTIDVANASRAIKEKEIKACAEAGVTDIIEVRIGYDGIVFASDING 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
                T  D + AL+  + VD K+V NP K W+++  DFP   I  ++P  KHGTREV E
Sbjct: 122 NGFEFTPTDWFLALSDKVSVDGKLVDNPNKTWADVNGDFPAQAIQAFIPGTKHGTREVFE 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  +  F   ++    + +    AC ++R DG+++++DGDYTETLARIE NKD
Sbjct: 182 EKVILAGCEETGAFELFKEANGGDEKAAEKACIALRTDGVSVDIDGDYTETLARIESNKD 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GL+FY+NN D L++  + GIVPS  +I +G YP+SRPL FYVK+ H   + GL+E
Sbjct: 242 GIGVFGLAFYENNTDKLQVATMSGIVPSTESIATGEYPVSRPLFFYVKKAHIGVIPGLKE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           Y  F VSDE+  PD  L +YGL+   + E    ++++A   +
Sbjct: 302 YAEFFVSDEVAGPDGPLSEYGLVA--DPELAKTQEAVASEAT 341


>gi|254427058|ref|ZP_05040765.1| hypothetical protein ADG881_288 [Alcanivorax sp. DG881]
 gi|196193227|gb|EDX88186.1| hypothetical protein ADG881_288 [Alcanivorax sp. DG881]
          Length = 348

 Score =  254 bits (649), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 110/329 (33%), Positives = 175/329 (53%), Gaps = 8/329 (2%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
               AR+ I I GSST++P++ ++AE F        TP +ES GS  G+K FC+G+G   
Sbjct: 19  GTAMARDTISIVGSSTVYPFATVVAERFGRT--GNATPKIESTGSGGGMKLFCQGVGTQH 76

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI N+SR++ ++E + C+ +GV DI EV +G+DGI++ +      + L++ D++ ALA 
Sbjct: 77  PDITNASRRMKKSEFELCQSNGVKDITEVKVGYDGIVIANSVKGKHIDLSLRDVFLALAK 136

Query: 140 YLIVDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
            +   D   ++V NP K W E+ P  P  +I +  P    GTR+   +  ++ GC     
Sbjct: 137 DVPNPDGSEELVANPYKTWKEVNPALPNTKIEVLGPPPTSGTRDAFNELAIEGGCKS--- 193

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
           F  ++ +   +  +    C SVR+DG  +E   +    + ++E N D FG  G SF   N
Sbjct: 194 FPWLKAIKGEDKSKYKAICRSVREDGAYVEAGENDNLIVQKLEKNPDAFGVFGYSFLDQN 253

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
             V++   + G+ P+   I SG YP+SR L FYVK+ H   V G+  YV    S++    
Sbjct: 254 RGVVQAANVGGVEPTFEAIGSGDYPVSRSLYFYVKKAHVGVVPGIEGYVKEFTSEKAWGD 313

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGKS 345
              L + GLIP+ ++ RKS+       KS
Sbjct: 314 QGYLGEKGLIPLGDDLRKSMAKQARSLKS 342


>gi|317152748|ref|YP_004120796.1| periplasmic phosphate-binding protein [Desulfovibrio aespoeensis
           Aspo-2]
 gi|316942999|gb|ADU62050.1| periplasmic phosphate binding protein [Desulfovibrio aespoeensis
           Aspo-2]
          Length = 346

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 115/345 (33%), Positives = 183/345 (53%), Gaps = 7/345 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR F  +L+   V+    G    AR++I++ GSST++P+S  +AE       +FK+P VE
Sbjct: 1   MRKFVKLLVAVAVITFGAG-MAHARDQIKVVGSSTVYPFSSYVAEELGA-TSKFKSPVVE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G K F +G G DT DI N+SR++  +E +     GV++I E  IG+DGI +  +
Sbjct: 59  STGSGGGFKLFIQGAGMDTPDITNASRRMKSSEFEAATAAGVTEITEALIGYDGIAIAQN 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++    S+T+++L  A    + V+ K+  NP   W +I P  P+ +I  Y P    GTR+
Sbjct: 119 KENGEFSITMDELALATMEMVPVNGKLEKNPYTTWDQINPALPKRKIIFYGPPTSSGTRD 178

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + VL      +                     ++VRQDGI +    +    + ++  
Sbjct: 179 AFAEMVLGHFGKANGALYDAIAPKGKGEN-----YSAVRQDGIYVPAGENDNLIVQKLTK 233

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF   N+D +    I+G+ P   TI SG YPISR L FY+K+ H + V G
Sbjct: 234 DKDAFGIFGYSFLGENSDRIVGAKINGVFPEPETIASGKYPISRSLFFYIKKAHLDKVPG 293

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           ++EYV   +SD+M+ P   L + GL+P++++ R  V+  +   K+
Sbjct: 294 MKEYVELFMSDKMIGPKGLLKRIGLVPLADDMRAKVQKDVLSLKN 338


>gi|218887651|ref|YP_002436972.1| phosphate ABC transporter periplasmic protein [Desulfovibrio
           vulgaris str. 'Miyazaki F']
 gi|218758605|gb|ACL09504.1| periplasmic phosphate binding protein [Desulfovibrio vulgaris str.
           'Miyazaki F']
          Length = 344

 Score =  254 bits (648), Expect = 1e-65,   Method: Composition-based stats.
 Identities = 113/325 (34%), Positives = 172/325 (52%), Gaps = 7/325 (2%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
               AR+++RI GSST++P+S  +AE F     +FK+P VES GS  G K F  G+G DT
Sbjct: 19  GVAEARDQVRIVGSSTVYPFSSAVAEEFGATNKQFKSPVVESTGSGGGHKLFYAGVGPDT 78

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI NSSR++   EL+   K+GV+DI E  IG DGI++  +     ++LT++DL  A+  
Sbjct: 79  PDITNSSRRMKVEELETNIKNGVTDITEAKIGFDGIVIAQNIGNADMNLTLKDLALAVLE 138

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            + VD K+  NP K W ++ P  P+ +I IY P    GTR+   + V+++   +   F  
Sbjct: 139 EVPVDGKLAPNPYKTWKQLNPALPDRKIVIYGPPATSGTRDAFIEMVVEKFTGKDETFKA 198

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           +        ++       +RQDG  +    +    + ++  + +  G  G SF   N D 
Sbjct: 199 VLGKDAAQYKK-------IRQDGPYVPAGENDNLIVQKLTKDTEAVGIFGYSFLAENKDR 251

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           +K   ++G  P+   I S  YPISR L FYVK  H   + GL+EYV   +S++M+     
Sbjct: 252 IKGCTVEGNPPTFDNISSAKYPISRALFFYVKDAHIGKIAGLKEYVELFMSEKMIGDAGY 311

Query: 320 LFQYGLIPISNEERKSVRDSIAVGK 344
           L   GLIP+   ER+ VR  +   K
Sbjct: 312 LKTIGLIPLPAAEREKVRKDVTGFK 336


>gi|209547777|ref|YP_002279694.1| phosphate ABC transporter substrate-binding protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209533533|gb|ACI53468.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 344

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 171/321 (53%), Positives = 224/321 (69%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE + CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRPINKNEAEACKAAGVTDIQEVKIGYDGIVFATDASNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S     +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGALDVIAKEI 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +    + AC +VR+DG A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 204 -ADKAAQTKACVAVRKDGAAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PDS L +YG
Sbjct: 263 MSGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 323 LVAAPDAERDAIRKDVEAGKS 343


>gi|163746359|ref|ZP_02153717.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanibulbus indolifex HEL-45]
 gi|161380244|gb|EDQ04655.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanibulbus indolifex HEL-45]
          Length = 346

 Score =  254 bits (648), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 146/338 (43%), Positives = 212/338 (62%), Gaps = 3/338 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              +    + +     T   AR+++++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   LAKLTTSALAIAAVSATAAAARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TIDI N+SR+I   E+  C ++GV+DI EV +G+DGI+  SD D 
Sbjct: 62  SSAGLKRFCEGVGENTIDIANASRQIKDAEVAVCAENGVTDIIEVRVGYDGIVFASDIDG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            +   T  D YKAL++ ++VD +V  NP   W ++ P FP   I  ++P  KHGTREV E
Sbjct: 122 NTFEFTPTDWYKALSAKVVVDGEVTTNPYTTWDQVNPAFPAQPIQAFIPGTKHGTREVFE 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  + +     +    + +     C S+R DG ++++DGDYTETLARIE N+D
Sbjct: 182 EKVILAGCEETGDLEAFAEAAGGDEKAAEKECISLRTDGKSVDIDGDYTETLARIESNQD 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GL+FY+NN D L++  + G+ P+  +I SG YP+SRPL FYVK+ H   + GL+E
Sbjct: 242 GIGVFGLAFYENNTDKLQVATMGGVEPTTESIASGDYPVSRPLFFYVKKAHIGVIPGLKE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           Y  F V+DE+  PD  L +YGL+  S+ E    +  +A
Sbjct: 302 YAEFFVADEVAGPDGPLAEYGLV--SDPELAETQSVVA 337


>gi|83953659|ref|ZP_00962380.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sulfitobacter sp. NAS-14.1]
 gi|83841604|gb|EAP80773.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sulfitobacter sp. NAS-14.1]
          Length = 346

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 154/339 (45%), Positives = 220/339 (64%), Gaps = 3/339 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              +    + +     T   AR+++++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   LVKLTTSALAIAAVSATAAAARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TID+ N+SRKI  +E++ C  +GV+DI EV IG+DGI+  SD + 
Sbjct: 62  SSAGLKRFCEGVGENTIDVANASRKIKSSEVEACATNGVTDIIEVQIGYDGIVFASDING 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            +   T ED YKAL++ ++VD ++V NP K WS++   FPE  I  Y+P  KHGTREV E
Sbjct: 122 NTFEFTPEDWYKALSAEVVVDGEIVANPNKMWSDVNASFPEQPIQAYIPGTKHGTREVFE 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  + +F   +     + +    AC ++R DG+++++DGDYTETLARIE NKD
Sbjct: 182 EKVILAGCEATGDFEAFKAANGDDKKAAEKACIALRTDGVSVDIDGDYTETLARIESNKD 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GL+FY+NN D L +  + GI P++ TI SG YP+SRPL FYVK+ H   + GL+E
Sbjct: 242 GIGVFGLAFYENNTDKLTVANMSGIEPTVETISSGDYPVSRPLFFYVKKAHIGVIPGLKE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           Y  F V+DE+  PD  L +YGL+  S+ E    +  +A 
Sbjct: 302 YAEFFVADEIAGPDGPLAEYGLV--SDPELAKTQSVVAE 338


>gi|110835546|ref|YP_694405.1| phosphate ABC transporter periplasmic binding protein [Alcanivorax
           borkumensis SK2]
 gi|110648657|emb|CAL18133.1| phosphate ABC transporter periplasmic binding protein [Alcanivorax
           borkumensis SK2]
          Length = 348

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 108/328 (32%), Positives = 178/328 (54%), Gaps = 8/328 (2%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
               AR+ I I GSST++P++ ++AE F        TP +ES GS  G+K FC+G+G   
Sbjct: 19  GTAMARDTISIVGSSTVYPFATVVAERFGRT--GNATPKIESTGSGGGMKLFCQGVGTQH 76

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI N+SR++ ++E + C+ +GV DI EV +G+DGI++ +      + L++ +++ ALA 
Sbjct: 77  PDITNASRRMKKSEFELCQSNGVKDITEVKVGYDGIVIANSVKGKHIDLSLREVFLALAK 136

Query: 140 YLI---VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
            +      +++V NP K W EI P  P V+I +  P    GTR+   +  ++ GC   + 
Sbjct: 137 DVPNPKGGEELVANPYKTWKEINPALPNVKIEVLGPPPTSGTRDAFNELAIEGGC---KT 193

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
           F  ++ +   +  +    C SVR+DG+ +E   +    + ++E N + FG  G SF   N
Sbjct: 194 FPWLKAIKGEDKSKYKAICRSVREDGVYVEAGENDNLIVQKLEKNPNAFGVFGYSFLDQN 253

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
             V++   + G+ P+   I SG YP+SR L FYVK+ H   V G+  YV    S++    
Sbjct: 254 RGVVQAANVGGVEPTFEAIGSGEYPVSRSLYFYVKKAHVGVVPGIEGYVKEFTSEKAWGD 313

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGK 344
              L + GLIP++++ RKS+       K
Sbjct: 314 QGYLSEKGLIPLADDLRKSMAKQARSLK 341


>gi|88799187|ref|ZP_01114767.1| phosphate binding protein, putative [Reinekea sp. MED297]
 gi|88778170|gb|EAR09365.1| phosphate binding protein, putative [Reinekea sp. MED297]
          Length = 336

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 112/338 (33%), Positives = 180/338 (53%), Gaps = 7/338 (2%)

Query: 10  CFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLK 69
                         AR++I I GSST++P++ ++AE F        TP +ES GS  GLK
Sbjct: 1   MLATTAAIAAVPAQARDQINIVGSSTVYPFATVVAERFGRATGN-PTPTIESTGSGGGLK 59

Query: 70  EFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLT 129
            FC GIG++T DI NSS  I Q++ D C + G+ DI EV IG+DGI   + R    + ++
Sbjct: 60  LFCDGIGENTPDITNSSSYIKQSQFDACAEKGI-DIIEVKIGYDGIAFANSRQSDKIDVS 118

Query: 130 VEDLYKALASYLIVD--DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL 187
            +DL+ ALA+++  D   +++ NP + W ++    P  +I +  P    GTR    + V+
Sbjct: 119 RKDLFLALAAHVPGDKEGELIENPYQTWKDVNSSLPATKIRVLGPPPTSGTRAAFVELVM 178

Query: 188 QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGF 247
           ++GC      S ++D+   +  +    C S+R+DG  +E   +    + +++ +   FG 
Sbjct: 179 EKGC---SEISWIKDLKSSDKSKWEEVCGSMREDGAFVEAGENDNLIVQKLDADPSSFGI 235

Query: 248 VGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSF 307
            G SF   N+D L+    DG+  S   I  G YP+SRPL F+VK+QH   + G+ EYV+ 
Sbjct: 236 FGYSFLDQNSDKLQGASFDGVDISFDNIADGSYPVSRPLHFFVKKQHIGVIPGIMEYVNT 295

Query: 308 SVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
            +S+   + D  L + GLIP+S  E + +R  +   K 
Sbjct: 296 FLSNAAQSEDGYLAEKGLIPLSGVELQKMRADVNAQKV 333


>gi|241202932|ref|YP_002974028.1| phosphate ABC transporter substrate-binding protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240856822|gb|ACS54489.1| phosphate ABC transporter, substrate-binding protein [Rhizobium
           leguminosarum bv. trifolii WSM1325]
          Length = 344

 Score =  254 bits (647), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 171/321 (53%), Positives = 225/321 (70%), Gaps = 1/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I++AGSST+ PY+KI+AE+F E F  FKTP VESGG+  GLKEFC+G+G+DTIDI N
Sbjct: 24  RDQIQVAGSSTVLPYAKIVAESFGETFTNFKTPVVESGGTGAGLKEFCKGVGEDTIDIAN 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I +NE + CK  GV+DIQEV IG+DGI+  +D     V+    D+YKALA+ ++VD
Sbjct: 84  ASRPINKNEAEACKAAGVTDIQEVKIGYDGIVFATDASNPDVAYVPADIYKALAAQVVVD 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP KKWSE+ P  P V IA Y+P  KHGTREV E+ VL  GC  S   + +    
Sbjct: 144 GKLVANPYKKWSEVNPKLPAVDIAAYIPGEKHGTREVFEQNVLAAGCKASGA-TDVIAKE 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC +VR+DG+A+++DGDY ETLARI  NK   G  GLSFY+NNAD LK+  
Sbjct: 203 IADKAAQGKACVAVRKDGVAVDIDGDYPETLARIAANKTGVGVFGLSFYENNADKLKVAS 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GIVPS  TI +G YP+SRPL FYVK+ H  +V GL+EYV+F VSD+M+ PDS L +YG
Sbjct: 263 MSGIVPSTETIANGTYPVSRPLFFYVKKAHLGAVPGLKEYVNFFVSDQMIGPDSPLVEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+   + ER ++R  +  GKS
Sbjct: 323 LVAAPDAERDAIRKDVEAGKS 343


>gi|262278266|ref|ZP_06056051.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter calcoaceticus RUH2202]
 gi|262258617|gb|EEY77350.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter calcoaceticus RUH2202]
          Length = 343

 Score =  253 bits (646), Expect = 2e-65,   Method: Composition-based stats.
 Identities = 137/321 (42%), Positives = 200/321 (62%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSRKI   E++ C K GV  IQE+ IG+DGI+  S+ +  +  L    ++ ALA+ L   
Sbjct: 87  SSRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASNSNKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P+  HGTREV ++K+++ GC     F  +    
Sbjct: 147 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCEAYGYFKSL---- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++  
Sbjct: 203 --DKDAQKKACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVAT 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL ++V + VS +     S+  + G
Sbjct: 261 VNNVVPSEKTVLNGTYPVSRPLFFYVKGEHLKSVKGLPQFVEYFVSKKATGKGSKAERDG 320

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V      GK+
Sbjct: 321 LIAMSDAERAKVLADFKAGKT 341


>gi|146329860|ref|YP_001210064.1| phosphate binding family protein [Dichelobacter nodosus VCS1703A]
 gi|146233330|gb|ABQ14308.1| phosphate binding family protein [Dichelobacter nodosus VCS1703A]
          Length = 335

 Score =  253 bits (645), Expect = 3e-65,   Method: Composition-based stats.
 Identities = 113/340 (33%), Positives = 174/340 (51%), Gaps = 12/340 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ + +  M            +  R+ I I GSST++P+S ++AE+F +    FKTP +E
Sbjct: 1   MQKYLLAAMIVAATGSVAAQSS--RDHISIVGSSTVYPFSTLVAEHFGK-TSNFKTPKIE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G+G +  DI N+SR I  +E+ +CK+   ++  E  IG+DGI++ S 
Sbjct: 58  STGTGGGFKLFCAGVGPEHADIANASRPIKDSEVKDCKEK-GAEFTEFKIGYDGIVMASS 116

Query: 121 RDMVSVSLTVEDLYKALASYLI--VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           +    +SLT E +Y ALA  +       +V NP KKWS+I    P+ +I +  P    GT
Sbjct: 117 KTAAPMSLTTEQIYLALAKKVPSKDGKSLVDNPYKKWSDIDKSLPDSKIEVLGPPPTSGT 176

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
           R+   +  L  GC        +      + ++ + AC  VR+DG  IE   +    + ++
Sbjct: 177 RDAFAEMALDNGCKNFEVIKAL------SKEEKTAACQGVREDGAYIEAGENDNLIVNKL 230

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
             N    G  G SF + N D ++ V I G  P+   I SG YP+SRPL  YVK  H   +
Sbjct: 231 TANPAAVGIFGYSFLEENTDKVQAVTIAGKQPNFDNIASGEYPLSRPLFIYVKNMHIGVI 290

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRD 338
            G++E+V   +S+E    D  L   GLIP+S +E    + 
Sbjct: 291 PGIKEFVQTFLSEEASGQDGYLKNNGLIPLSGDELAKAKA 330


>gi|255261824|ref|ZP_05341166.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thalassiobium sp. R2A62]
 gi|255104159|gb|EET46833.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thalassiobium sp. R2A62]
          Length = 341

 Score =  253 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 145/341 (42%), Positives = 208/341 (60%), Gaps = 7/341 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M    V  +    L         AR+ ++IAGSST+ PY+ I+AE F E F +F TP VE
Sbjct: 3   MSKLTVSTLAICAL----AGAASARDNVQIAGSSTVLPYAAIVAEAFGENF-DFPTPVVE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLK FC G+GD TIDI N+SR I  +E++ C  +GV+DI EV IG+DGI+  SD
Sbjct: 58  SGGSSSGLKRFCEGVGDTTIDIANASRAIKSSEIEACAANGVTDIIEVRIGYDGIVFASD 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +    + +  D + AL++ ++VD  +V NP   W ++   FP+  I  +VP  KHGTRE
Sbjct: 118 VNSNDFAFSPTDWFLALSNTILVDGAMVENPNTTWEKVNASFPDQPIQAFVPGTKHGTRE 177

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E KV+ EGC  +  F  +      + +    AC  +R DG ++++DGDYTETLARIE 
Sbjct: 178 VFEDKVILEGCEATGAFEAIMAANGGDKKAAEGACIELRTDGRSVDIDGDYTETLARIES 237

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           + +  G  GLSFY+NN D L++  ++ +VPS  +I +G YP+SRPL FY+K  H   + G
Sbjct: 238 DANSIGVFGLSFYENNTDKLRVATMNDVVPSTESIATGEYPVSRPLYFYIKAAHIGVIPG 297

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           ++EY  F V+DE+  PD  L +YGL+  S+ E    +  ++
Sbjct: 298 VKEYAEFFVADEIAGPDGPLAEYGLV--SDPELAETQGIVS 336


>gi|99081103|ref|YP_613257.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ruegeria sp. TM1040]
 gi|99037383|gb|ABF63995.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Ruegeria sp. TM1040]
          Length = 346

 Score =  253 bits (644), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 146/342 (42%), Positives = 215/342 (62%), Gaps = 3/342 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           F  +    + +     T   AR ++++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   FVKLTASTLAIAAVSATAASAREQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TIDI N+SR I + E+  C + GV+DI EV IG+DGI+  SD D 
Sbjct: 62  SSAGLKRFCEGVGENTIDIANASRAIKEKEIKACAEAGVTDIIEVRIGYDGIVFASDIDG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
                T  D + AL+  ++VD  +V NP K W+++   FP   I  ++P  KHGTREV E
Sbjct: 122 NGFEFTPTDWFLALSDKVVVDGALVDNPNKTWADVNAAFPAQPIQAFIPGTKHGTREVFE 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
            KV+  GC  +  F  +++    + +    AC ++R DG+++++DGDYTETLARI+ NKD
Sbjct: 182 DKVILAGCEETGAFDLLKEANGGDKKAAEKACIALRTDGVSVDIDGDYTETLARIDSNKD 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GL+FY+NN D L++  + G+VPS  +I +G YP+SRPL FYVK+ H   + GL+E
Sbjct: 242 GIGVFGLAFYENNTDKLQVATMSGVVPSTESIATGEYPVSRPLYFYVKKAHIGVIPGLKE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           +  F V+DE+  PD  L +YGL+   + E    ++++A   +
Sbjct: 302 FAEFFVADEVAGPDGPLAEYGLVA--DPELAKTQEAVAAEAT 341


>gi|260772585|ref|ZP_05881501.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Vibrio metschnikovii CIP 69.14]
 gi|260611724|gb|EEX36927.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Vibrio metschnikovii CIP 69.14]
          Length = 340

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 146/345 (42%), Positives = 204/345 (59%), Gaps = 6/345 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+F    L+    +         AR  I+IAGSST+ P+S I+AE F + F +F TP V 
Sbjct: 1   MKFGRNALLLASTVATAISAPAMARETIQIAGSSTVLPFSSIVAEEFGQTFAQFNTPIVG 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGS  GL++FC+G+G +TIDI NSSR I  NEL  CK +GV+++ EV IG+DGI+  S 
Sbjct: 61  SGGSGGGLRQFCQGVGVNTIDIANSSRAIRPNELANCKANGVNEVIEVKIGYDGIVFASR 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            D  S +L  E ++KA A+ +  + K+V NP   W +I P  P+  I + +P   HGTRE
Sbjct: 121 TDSGSFALKPEHVFKAGAAQIPQNGKMVNNPYTNWKQIDPSLPDQDILLVIPGSNHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KV+  GC        M      + +     C ++R DG  +EV GDYTETLAR++ 
Sbjct: 181 VYEEKVVHPGCATFAEVKAM------DSKAKENFCNAIRTDGRVVEVAGDYTETLARLDA 234

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
            ++  G  GLSFY  N D LK+  +DG+ PS+ TI +G YP+SRPL FY+K  H   V G
Sbjct: 235 QRNALGVFGLSFYDQNRDRLKVATVDGVTPSLETISTGEYPVSRPLFFYIKNAHVGVVPG 294

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L EY  F V++++    S L + GLIP+ + ER  V + I   K+
Sbjct: 295 LLEYAQFFVNEQIGGMGSPLEEAGLIPMDDAERAQVSNDIRNRKT 339


>gi|315635493|ref|ZP_07890759.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Arcobacter butzleri JV22]
 gi|315480251|gb|EFU70918.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Arcobacter butzleri JV22]
          Length = 344

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 111/337 (32%), Positives = 180/337 (53%), Gaps = 4/337 (1%)

Query: 10  CFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLK 69
             ++      T   AR++I+I GSST++P+S  +AE F      F TP VES G+  G+K
Sbjct: 1   MALIASALLTTTLSARDQIKIVGSSTVYPFSSSVAEEFGATTK-FPTPVVESTGTGGGMK 59

Query: 70  EFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLT 129
            FC G+  +T DI N+SRK+   E + CK++GV+DI E  IG DGI +     + S ++T
Sbjct: 60  LFCAGVDLNTPDIANASRKMKDKEFETCKENGVTDITEALIGFDGIAIAQSTKVKSFNVT 119

Query: 130 VEDLYKALASYLI--VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL 187
            E L  A+A  +       ++ NP KKWS+I    P   I +Y P    GTR+  E+ VL
Sbjct: 120 KEQLALAVAEEVPSKDGKTLIKNPYKKWSDIDASLPNREIIVYGPPKSSGTRDSFEELVL 179

Query: 188 QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGF 247
           Q    +   ++ +    +   ++     + +R DG+ +E   +    + ++  N+   G 
Sbjct: 180 QHVFEKMPVYTDLFKKDENANKKYKA-YSVIRTDGVYVESGENDNLIVQKLTKNEAAIGI 238

Query: 248 VGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSF 307
            G SF   N D +  + +D I P++ TI SG YP++R + FY+K QH   V  L+EY + 
Sbjct: 239 FGYSFLAENKDKVLGITVDNISPTVETIASGKYPVARSMYFYIKNQHSKDVPALKEYTNL 298

Query: 308 SVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
            +S++M+  D  L + GLIP++N+ R   R+ +   +
Sbjct: 299 FMSEKMIGDDGILSELGLIPLTNDVRSKARNKVLNSE 335


>gi|109899623|ref|YP_662878.1| phosphate binding protein, putative [Pseudoalteromonas atlantica
           T6c]
 gi|109701904|gb|ABG41824.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Pseudoalteromonas atlantica T6c]
          Length = 361

 Score =  252 bits (643), Expect = 5e-65,   Method: Composition-based stats.
 Identities = 115/355 (32%), Positives = 181/355 (50%), Gaps = 14/355 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   + ++C  V  +        R+ I + GSST++ +S ++AE F +  P F TP +E
Sbjct: 1   MKPSTLSIICACVWTLISAPANAMRDYIDVVGSSTVYAFSTVVAERFGKTSP-FHTPKIE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  GLK FC+G+G    DI NSSR+I  +E+D C+++GV ++ E+ IG DGI+L   
Sbjct: 60  STGSGGGLKLFCQGVGMKFPDIANSSRRIKPSEIDLCQRNGVHEVIEILIGFDGIVLAQS 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDK---VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           +   S+ LT  +LY ALA  +   D     + NP   W +I P  P + I ++ P    G
Sbjct: 120 KLAESIPLTRRELYLALAKSVPNPDGSATTIDNPFITWQDINPRLPNIEIEVFGPPSTSG 179

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYN----------VQQLSVACTSVRQDGIAIEV 227
           TR+   + VL  GC      ++M +                 Q    C  +R+DG  I+ 
Sbjct: 180 TRDAFSELVLDYGCHTFAWLAQMSEPQSQAQATSKEARIRKSQQRRLCRMLREDGAYIDA 239

Query: 228 DGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLL 287
             +    + ++  N +  G +G SF   N D +K   IDG +PS  +I +G YPISRPL 
Sbjct: 240 GENDNLVVQKLNANPNALGLLGFSFLDQNRDRIKSAKIDGFLPSFSSIANGDYPISRPLY 299

Query: 288 FYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           FYVK+ H   + G+  ++   +SD        L + G+IP++  ER+++   I  
Sbjct: 300 FYVKKAHIGMIPGIEAFIREFISDNASGESGYLPRKGMIPLTKSERQAIEYRINA 354


>gi|260549703|ref|ZP_05823920.1| sphX [Acinetobacter sp. RUH2624]
 gi|260407220|gb|EEX00696.1| sphX [Acinetobacter sp. RUH2624]
          Length = 343

 Score =  252 bits (643), Expect = 6e-65,   Method: Composition-based stats.
 Identities = 135/321 (42%), Positives = 197/321 (61%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S     +  L    ++ ALA+ L   
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASSSHKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P+  HGTREV ++K++  GC     F  +    
Sbjct: 147 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVDAGCESYEYFKNL---- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++  
Sbjct: 203 --DKDAQKKACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVAS 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ ++PS  T+++G YP+SRPL FYVK +H  SV GL +YV + +S +     S+  + G
Sbjct: 261 VNNVLPSEKTVLNGTYPVSRPLFFYVKGEHLKSVKGLPQYVEYFLSKKATGKGSKAERDG 320

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V      GK+
Sbjct: 321 LIAMSDAERAKVLADFKAGKT 341


>gi|157736356|ref|YP_001489039.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Arcobacter butzleri RM4018]
 gi|157698210|gb|ABV66370.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Arcobacter butzleri RM4018]
          Length = 351

 Score =  252 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 111/342 (32%), Positives = 181/342 (52%), Gaps = 4/342 (1%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F      ++      T   AR++I+I GSST++P+S  +AE F      F TP VES G+
Sbjct: 3   FKKTSMALIASALLTTTLSARDQIKIVGSSTVYPFSSSVAEEFGATTK-FPTPVVESTGT 61

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G+K FC G+  +T DI N+SRK+   E + CK++GV+DI E  IG DGI +     + 
Sbjct: 62  GGGMKLFCAGVDLNTPDIANASRKMKDKEFETCKENGVTDITEALIGFDGIAIAQSTKVK 121

Query: 125 SVSLTVEDLYKALASYLI--VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
           S ++T E L  A+A  +       ++ NP KKWS+I    P   I +Y P    GTR+  
Sbjct: 122 SFNVTKEQLALAVAEEVPSKDGKTLIKNPYKKWSDIDASLPNREIIVYGPPKSSGTRDSF 181

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
           E+ VLQ    +   ++ +    +   ++     + +R DG+ +E   +    + ++  N+
Sbjct: 182 EELVLQHVFEKMAVYTDLFKKDENANKKYKA-YSVIRTDGVYVESGENDNLIVQKLTKNE 240

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
              G  G SF   N D +  + +D I P++ TI SG YP++R + FY+K QH   V  L+
Sbjct: 241 AAIGIFGYSFLAENKDKVLGITVDNISPTVETIASGKYPVARSMYFYIKNQHSKDVPALK 300

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           EY +  +S++M+  D  L + GLIP++++ R   R+ +   +
Sbjct: 301 EYTNLFMSEKMIGDDGILSELGLIPLTSDVRSKARNKVLNSE 342


>gi|126642484|ref|YP_001085468.1| putative phosphate transporter [Acinetobacter baumannii ATCC 17978]
 gi|332857056|ref|ZP_08436362.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6013150]
 gi|332869994|ref|ZP_08438970.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6013113]
 gi|332874755|ref|ZP_08442625.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6014059]
 gi|332726871|gb|EGJ58385.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6013150]
 gi|332732494|gb|EGJ63745.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6013113]
 gi|332737016|gb|EGJ67973.1| phosphate ABC transporter, phosphate-binding protein [Acinetobacter
           baumannii 6014059]
          Length = 348

 Score =  252 bits (642), Expect = 7e-65,   Method: Composition-based stats.
 Identities = 135/321 (42%), Positives = 196/321 (61%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 32  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 91

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S     +  L    ++ ALA+ L   
Sbjct: 92  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASSSSKAAYKLKPYHVFAALAAQLPSK 151

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P+  HGTREV ++K+++ GC             
Sbjct: 152 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCE------AYEYFK 205

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++  
Sbjct: 206 SLDKDAQKKACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVAT 265

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + +S +     S+  + G
Sbjct: 266 VNNVVPSEKTVLNGTYPVSRPLYFYVKGEHLKSVKGLPQYVEYFLSKKATGKGSKAERDG 325

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V      GK+
Sbjct: 326 LIAMSDAERAKVLADFKAGKT 346


>gi|169795175|ref|YP_001712968.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter baumannii AYE]
 gi|213158161|ref|YP_002320212.1| phosphate ABC transporter, substrate-binding protein [Acinetobacter
           baumannii AB0057]
 gi|301345430|ref|ZP_07226171.1| phosphate ABC transporter, substrate-binding protein [Acinetobacter
           baumannii AB056]
 gi|301511735|ref|ZP_07236972.1| phosphate ABC transporter, substrate-binding protein [Acinetobacter
           baumannii AB058]
 gi|301596644|ref|ZP_07241652.1| phosphate ABC transporter, substrate-binding protein [Acinetobacter
           baumannii AB059]
 gi|169148102|emb|CAM85965.1| putative phosphate transporter (ABC superfamily, peri-bind)
           [Acinetobacter baumannii AYE]
 gi|213057321|gb|ACJ42223.1| phosphate ABC transporter, substrate-binding protein [Acinetobacter
           baumannii AB0057]
          Length = 343

 Score =  252 bits (642), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 135/321 (42%), Positives = 197/321 (61%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S  +  +  L    ++ ALA+ L   
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASSSNKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P+  HGTREV ++K+++ GC             
Sbjct: 147 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCE------AYEYFK 200

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++  
Sbjct: 201 SLDKDAQKKACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVAT 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + +S +     S+  + G
Sbjct: 261 VNNVVPSEKTVLNGTYPVSRPLYFYVKGEHLKSVKGLPQYVEYFLSKKATGKGSKAERDG 320

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V      GK+
Sbjct: 321 LIAMSDAERAKVLADFKAGKT 341


>gi|312115109|ref|YP_004012705.1| phosphate-binding periplasmic protein [Rhodomicrobium vannielii
           ATCC 17100]
 gi|311220238|gb|ADP71606.1| putative phosphate-binding periplasmic protein [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 361

 Score =  251 bits (641), Expect = 8e-65,   Method: Composition-based stats.
 Identities = 153/340 (45%), Positives = 213/340 (62%), Gaps = 10/340 (2%)

Query: 15  EVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRG 74
            ++      AR++++IAGSST+FPY+KI+AENF++     K P VESGGS  GLK+FC G
Sbjct: 16  GLFAADSASARDQVKIAGSSTVFPYAKIVAENFAKANAGLKAPVVESGGSGAGLKQFCDG 75

Query: 75  IGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLY 134
           +G+D IDI NSSR+I + E + C K+GV+D+ EV  G+DGI+  SD    + +   +D +
Sbjct: 76  VGEDKIDIANSSRRIKKGEQETCTKNGVADVVEVKFGYDGIVFASDVKGAAFAYEAKDWF 135

Query: 135 KALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
            ALA  ++VD K+V NP K W E+   FP   I  Y+P  KHGTREV E+KVL  GC  +
Sbjct: 136 NALAPEIVVDGKLVANPNKTWKEVNAAFPGWEIVAYIPGEKHGTREVFEEKVLVAGCKAT 195

Query: 195 RNFSKMRDMFKYNV-------QQLSVACTSVRQDGI---AIEVDGDYTETLARIEVNKDV 244
                + +  K               AC  VR+D     AI++DGDYTETLAR++ NK+ 
Sbjct: 196 GADKLIAEKLKAAGTAEDKLHGATEKACAKVRKDDGGKHAIDIDGDYTETLARLQANKES 255

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G  GL+FY+NN D L++  + G+ PS+ TI +G YP+SRPL FYVK+ H   + GL+EY
Sbjct: 256 IGVFGLAFYENNTDKLRVATVGGVTPSVETISAGKYPVSRPLFFYVKKAHVGVIPGLKEY 315

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             F VSD+M+  D  L QYGL+P+   E K+VR+ +   K
Sbjct: 316 SEFFVSDKMIGEDGPLAQYGLVPLPEAEAKAVREIVKDLK 355


>gi|146277956|ref|YP_001168115.1| ABC-type phosphate transport system periplasmic component-like
           protein [Rhodobacter sphaeroides ATCC 17025]
 gi|145556197|gb|ABP70810.1| ABC-type phosphate transport system periplasmic component-like
           protein [Rhodobacter sphaeroides ATCC 17025]
          Length = 347

 Score =  251 bits (641), Expect = 9e-65,   Method: Composition-based stats.
 Identities = 148/340 (43%), Positives = 213/340 (62%), Gaps = 3/340 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              + +  + +         AR+ I+ AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   LLKLTVSSLAVVAASAGVAAARDNIQTAGSSTVLPYATIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K+ C G+G++TIDI NSS +I Q+++D C ++GV++I EV IG+DGI+  SD   
Sbjct: 62  SGAGRKKLCEGVGENTIDIANSSSRIKQSDIDLCAQNGVNEIMEVRIGYDGIVFASDIGG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              + T  D + ALA+ ++VD +VV NP  +W+++ P+ P+  I  ++P  KHGTREV +
Sbjct: 122 PDFAFTPADWFNALAAQIVVDGQVVANPNGRWNQVNPELPDQPILAFIPGTKHGTREVFD 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KV+  GC  S            +  +    C ++R DG ++++DGDYTETL+RI+ NK+
Sbjct: 182 EKVIVAGCEESGAMEAFAAANGGDEDKAHDMCMALRTDGASVDIDGDYTETLSRIDANKN 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GLSFY+NN D LK+  +  +VPS+ TI SG YP+SRPL FYVK  H + + GL+E
Sbjct: 242 AIGVFGLSFYQNNTDKLKVATMSDVVPSVETIASGDYPVSRPLFFYVKMAHLDVIPGLQE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           YV F VSDEM  PD  L  YGL+  S+ E  + +D IA  
Sbjct: 302 YVEFFVSDEMAGPDGPLAAYGLV--SDPELAATQDMIANR 339


>gi|254465409|ref|ZP_05078820.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacterales bacterium Y4I]
 gi|206686317|gb|EDZ46799.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacterales bacterium Y4I]
          Length = 346

 Score =  251 bits (641), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 148/339 (43%), Positives = 215/339 (63%), Gaps = 3/339 (0%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           F  +    + +     T   AR+++++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   FVKLTASALAISAVSATAAAARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TID+ N+SRKI   E+  C ++GV+DI EV IG+DGI+  SD   
Sbjct: 62  SSAGLKRFCEGVGENTIDVANASRKIKDKEIAACAENGVTDIIEVRIGYDGIVFASDSSA 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            +   T  D + AL+  ++VD ++  NP   W+++ PDFP V I  +VP  KHGTREV E
Sbjct: 122 NAFEFTPSDWFLALSDKILVDGELADNPNTTWADVNPDFPAVDIQAFVPGTKHGTREVFE 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
            KV+  GC  +  F   ++    + +    AC ++R DG ++++DGDYTETLARIE NK+
Sbjct: 182 DKVILAGCEETGAFEAFKEANGGDKKAAEKACIALRTDGKSVDIDGDYTETLARIESNKN 241

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GL+FY+NN D L++  + G+VPS  +I SG YP+SRPL FYVK+ H   + GL+E
Sbjct: 242 GIGVFGLAFYENNTDKLQVATMSGVVPSTESIASGEYPVSRPLFFYVKKAHIGVIPGLKE 301

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           Y  F V+DE+   D  L +YGL+   + E    ++++A 
Sbjct: 302 YAEFFVADEVAGEDGPLAEYGLVA--DPELAETQETVAN 338


>gi|119946060|ref|YP_943740.1| ABC phosphate transporter eriplasmic phosphate-binding protein
           [Psychromonas ingrahamii 37]
 gi|119864664|gb|ABM04141.1| ABC phosphate transporter eriplasmic phosphate-binding protein
           [Psychromonas ingrahamii 37]
          Length = 350

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 117/351 (33%), Positives = 184/351 (52%), Gaps = 10/351 (2%)

Query: 1   MRFFF---VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           M+      V L   V L         +R+ I + GSST++P+S ++AE F +   +F TP
Sbjct: 1   MKKLVLNTVALTFTVSLLASAAATAASRDMISVVGSSTVYPFSTVVAERFGKKT-QFNTP 59

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +ES G+  G+K FC G G DT D+ N+SR++ ++E + C ++GV+DI EV IG+DGI++
Sbjct: 60  KIESTGTGGGMKLFCAGNGIDTPDMSNASRRMKKSEYEMCVENGVTDITEVLIGYDGIVV 119

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDK---VVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            +      + L+ +DL+ ALA  +   D    ++ NP K W ++ P  P  +I +  P  
Sbjct: 120 ANSNAAPQMKLSRKDLFLALAKEVPALDGSETLIKNPYKTWKDVNPSLPATKIEVLGPPP 179

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GTR+   + V++ GC   + +  ++ + K +       C SVR+D   IE   +    
Sbjct: 180 TSGTRDAFAELVMEGGC---KQYPWIKAIKKTDKSAYKTICHSVREDHAYIEAGENDNLI 236

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQH 294
           + +I+ N D  G  G SF   N D ++   IDG  PS   I  G YP+SRPL FYVK  H
Sbjct: 237 IQKIDANPDAMGIFGFSFLDQNTDKIQGSFIDGTAPSFDAIADGSYPVSRPLFFYVKNSH 296

Query: 295 FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
            + V G+ EY++   S+  M     L   GLIP+ +E+   V   +   K+
Sbjct: 297 VDKVPGIAEYLAEFTSESAMGQMGYLTDKGLIPLGDEKFAEVSADVKSYKA 347


>gi|293609758|ref|ZP_06692060.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828210|gb|EFF86573.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|325122980|gb|ADY82503.1| putative phosphate transporter (ABC superfamily, PerI-bind)
           [Acinetobacter calcoaceticus PHEA-2]
          Length = 343

 Score =  251 bits (640), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 136/321 (42%), Positives = 197/321 (61%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S+    +  L    ++ ALA+ L   
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASNSHKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P+  HGTREV ++K+++ GC             
Sbjct: 147 GKLVPNPYTNWNQIDKTLPNEPITLVIPASNHGTREVFQEKMVEAGCE------AYEYFK 200

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++  
Sbjct: 201 SLDKDAQKKACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVAT 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + VS +     S+  + G
Sbjct: 261 VNNVVPSEKTVLNGTYPVSRPLYFYVKGEHLKSVKGLPQYVEYFVSKKATGKGSKAERDG 320

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V      GK+
Sbjct: 321 LIAMSDAERAKVLADFKAGKT 341


>gi|299769226|ref|YP_003731252.1| putative phosphate transporter [Acinetobacter sp. DR1]
 gi|298699314|gb|ADI89879.1| putative phosphate transporter [Acinetobacter sp. DR1]
          Length = 343

 Score =  251 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 136/321 (42%), Positives = 197/321 (61%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S+    +  L    ++ ALA+ L  +
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASNSHKAAYKLKPYHVFAALAAQLPSN 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P+  HGTREV ++K++  GC             
Sbjct: 147 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVDAGCE------AYEYFK 200

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++  
Sbjct: 201 NLDKDAQKKACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVAT 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + VS +     S+  + G
Sbjct: 261 VNNVVPSEKTVLNGTYPVSRPLFFYVKGEHLKSVKGLPQYVEYFVSKKATGKGSKAERDG 320

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V      GK+
Sbjct: 321 LIAMSDAERAKVLADFKAGKT 341


>gi|169632868|ref|YP_001706604.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter baumannii SDF]
 gi|215482723|ref|YP_002324921.1| Protein sphX precursor [Acinetobacter baumannii AB307-0294]
 gi|239501138|ref|ZP_04660448.1| putative phosphate transporter [Acinetobacter baumannii AB900]
 gi|260556655|ref|ZP_05828873.1| sphX [Acinetobacter baumannii ATCC 19606]
 gi|169151660|emb|CAP00450.1| putative phosphate transporter (ABC superfamily, peri-bind)
           [Acinetobacter baumannii]
 gi|193077953|gb|ABO12866.2| putative phosphate transporter [Acinetobacter baumannii ATCC 17978]
 gi|213987049|gb|ACJ57348.1| Protein sphX precursor [Acinetobacter baumannii AB307-0294]
 gi|260409914|gb|EEX03214.1| sphX [Acinetobacter baumannii ATCC 19606]
 gi|322508956|gb|ADX04410.1| Putative phosphate transporter [Acinetobacter baumannii 1656-2]
 gi|323518942|gb|ADX93323.1| putative phosphate transporter [Acinetobacter baumannii
           TCDC-AB0715]
          Length = 343

 Score =  251 bits (639), Expect = 1e-64,   Method: Composition-based stats.
 Identities = 135/321 (42%), Positives = 196/321 (61%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S     +  L    ++ ALA+ L   
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASSSSKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P+  HGTREV ++K+++ GC             
Sbjct: 147 GKLVPNPYTNWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCE------AYEYFK 200

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++  
Sbjct: 201 SLDKDAQKKACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVAT 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + +S +     S+  + G
Sbjct: 261 VNNVVPSEKTVLNGTYPVSRPLYFYVKGEHLKSVKGLPQYVEYFLSKKATGKGSKAERDG 320

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V      GK+
Sbjct: 321 LIAMSDAERAKVLADFKAGKT 341


>gi|114568947|ref|YP_755627.1| phosphate ABC transporter periplasmic binding protein [Maricaulis
           maris MCS10]
 gi|114339409|gb|ABI64689.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Maricaulis maris MCS10]
          Length = 351

 Score =  251 bits (639), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 119/343 (34%), Positives = 183/343 (53%), Gaps = 8/343 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    +     V+ +  G     R++IRI GSST+FP+S  +AE+F     +  TP VE
Sbjct: 1   MKLQAQLAAALAVVAIAGGAEAQQRDQIRIVGSSTVFPFSTAVAESFGAKTGQ-PTPVVE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL-VS 119
           S GS  GL+ FC G+G +  DIVN+SR++  +E + C+ +GV +I EV IG DGI++  +
Sbjct: 60  STGSGGGLRLFCSGVGTEHPDIVNASRRMRGSEYERCQDNGVREITEVRIGFDGIVIGAA 119

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDK---VVFNPLKKWSEIRPDFPEVRIAIYVPSGKH 176
           DR    V +T++ ++ ALA+ +  DD     + NP  +WS+I P  P  RI ++ P    
Sbjct: 120 DRGAADVDMTLDQVWLALAAEVPADDSCSSFIPNPNTRWSDIDPSLPRQRIEVFGPPPTS 179

Query: 177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
           GTR+   +  LQ+G   +R+ + M ++   +  +     + +R+DG  I+   +    + 
Sbjct: 180 GTRDAFVELALQDG---ARHIACMDELRDADRDRFEQIASRIREDGAWIDAGENDNAIVQ 236

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFN 296
            +      FG  G SF   N+D +  V IDG+ P    I  G YP+SR L FYVK QH  
Sbjct: 237 TLVNTPTAFGVFGFSFLDQNSDRISAVSIDGVAPEFDNIADGSYPVSRSLFFYVKNQHAA 296

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
            + GL  YV    S+E       L   GLIP+ + ER + RD+
Sbjct: 297 IIPGLTGYVEEFTSEESWGEFGYLTDRGLIPLPDAERNATRDA 339


>gi|184158974|ref|YP_001847313.1| phosphate ABC transporter periplasmic protein [Acinetobacter
           baumannii ACICU]
 gi|183210568|gb|ACC57966.1| ABC-type phosphate transport system, periplasmic component
           [Acinetobacter baumannii ACICU]
          Length = 343

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 136/321 (42%), Positives = 197/321 (61%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ ++AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TID+ N
Sbjct: 27  RDTIQIAGSSTVLPFASVVAEEFGNTFPQFKTPVVGSGGSSAGLKQFCQGVGDNTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E++ C K GV  IQE+ IG+DGI+  S     +  L    ++ ALA+ L   
Sbjct: 87  ASRKIKSTEIEACNKAGVKQIQEIKIGYDGIVFASSSSKAAYKLKPYHVFAALAAQLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP  KW++I    P   I + +P+  HGTREV ++K+++ GC             
Sbjct: 147 GKLVPNPYTKWNQIDKSLPNEPITLVIPASNHGTREVFQEKMVEAGCE------AYEYFK 200

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      AC++ R+DG  IE+ GDYTETLAR++ +    G  GLSFY  N D L++  
Sbjct: 201 SLDKDAQKKACSTFRKDGRVIEIAGDYTETLARLKTSPSAVGVFGLSFYDMNRDKLRVAT 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  T+++G YP+SRPL FYVK +H  SV GL +YV + +S +     S+  + G
Sbjct: 261 VNNVVPSEKTVLNGTYPVSRPLYFYVKGEHLKSVKGLPQYVEYFLSKKATGKGSKAERDG 320

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V      GK+
Sbjct: 321 LIAMSDAERAKVLADFKAGKT 341


>gi|83310474|ref|YP_420738.1| ABC-type phosphate transport system [Magnetospirillum magneticum
           AMB-1]
 gi|82945315|dbj|BAE50179.1| ABC-type phosphate transport system [Magnetospirillum magneticum
           AMB-1]
          Length = 341

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 123/320 (38%), Positives = 180/320 (56%), Gaps = 7/320 (2%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
               AR++IRI GSST++P+S  +AE F +   +FKTP VES G+  G++ FC G+G+  
Sbjct: 20  GAAQARDQIRIVGSSTVYPFSTAVAEAFGKA-GKFKTPVVESTGTGGGMRLFCSGVGESF 78

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI N+SR+I  +E++ C K+GV+ I EV IG+DGI+ ++ +     +LT E +YKA A 
Sbjct: 79  PDITNASRRIEPSEVEFCTKNGVTGITEVVIGYDGIVFMNSKAGPDFTLTREQMYKATAK 138

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            + V  K+V NP K WS+I P  P+  I +Y P+  HGTR+   + VL   C +      
Sbjct: 139 DVPVGGKLVPNPYKNWSDIDPSLPKEPILVYGPAPNHGTRDAYVELVLDPACAKQPELKD 198

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           M             AC +VR+DG  +EV  +YT    +I  N    G +  S+   N D 
Sbjct: 199 ME------KAAKKKACQTVREDGAWVEVSENYTVIQQKITSNPAALGVITFSYLDQNRDK 252

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           +K  P+DG+V +   I S  YP+SRPL FYVK+QH   V G++EYV+   SD+    +  
Sbjct: 253 VKAAPVDGVVATYDAIASNKYPVSRPLFFYVKKQHVGMVPGVKEYVTEFTSDKAWGKEGY 312

Query: 320 LFQYGLIPISNEERKSVRDS 339
           L   GLI   +  RK   ++
Sbjct: 313 LADKGLIASPDAIRKEQANN 332


>gi|311696280|gb|ADP99153.1| phosphate ABC transporter periplasmic binding protein [marine
           bacterium HP15]
          Length = 347

 Score =  250 bits (638), Expect = 2e-64,   Method: Composition-based stats.
 Identities = 109/343 (31%), Positives = 178/343 (51%), Gaps = 8/343 (2%)

Query: 1   MRFFFVVLMCFVVLEVYC-GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+    +    +   V        AR+ I I GSST++P++ ++AE F     +F TP +
Sbjct: 2   MKLNKALATVALAGSVAAMSAPAMARDTISIVGSSTVYPFATVVAERFGTKT-DFSTPKL 60

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES GS  GLK FC+GIG    DI N+SR++  +EL+ C+ +GV+DI E  IG DGI++ S
Sbjct: 61  ESTGSGGGLKLFCQGIGTQHPDITNASRRMKTSELELCQSNGVTDITEFRIGSDGIVIAS 120

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            ++  ++ +T+E L+ AL S + V+ + V NP K WS++    P   I +  P    GTR
Sbjct: 121 SKEAENLDITLEQLFLALGSKVPVNGEWVANPNKNWSDVDSSLPNKPIRVMGPPPTSGTR 180

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   +  L  GC +    + +         + +  C SVR+DG  IE   +    + ++ 
Sbjct: 181 DSFNELALAAGCDQLPEAANL------GKDEHASICESVREDGAFIEAGENDNLIVQKLI 234

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            +  ++G  G SF + NAD L+   ++G++P+   I +  YP++R L FYVK+ H   V 
Sbjct: 235 GDTGMYGVFGYSFLEENADRLQAATLNGMIPTAEAIAADEYPVARSLFFYVKKAHVGVVP 294

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           G++EY+   +S+  M  +  L   GLI         + D    
Sbjct: 295 GIQEYIGEFISNAAMGQNGYLKDVGLIVPPRAALMDLMDKAES 337


>gi|119387035|ref|YP_918090.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Paracoccus denitrificans PD1222]
 gi|119377630|gb|ABL72394.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Paracoccus denitrificans PD1222]
          Length = 342

 Score =  250 bits (637), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 159/345 (46%), Positives = 221/345 (64%), Gaps = 6/345 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  + +     T   AR++I+++GSST+ PYS I+AE F E   +F TP VE
Sbjct: 1   MK-SAKLTVSALAVIAASATVAAARDQIQVSGSSTVLPYSTIVAEAFGE-NTDFPTPVVE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLK+FC G+GD+TIDI N+SR I ++E++ CK  GV+DI EV IG+DGI+  SD
Sbjct: 59  SGGSSAGLKKFCEGVGDNTIDIANASRPIKESEIEACKAAGVTDIMEVRIGYDGIVFASD 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                 + T  D + ALA+ ++VD KVV NP  KW+EIR D P+  I  +VP  KHGTRE
Sbjct: 119 IGGNDFAFTPADWFNALAAEIVVDGKVVPNPHTKWNEIRSDLPDQEILAFVPGTKHGTRE 178

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KV+  GC  S     ++     +      AC ++R DG +I++DGDYTETLARI+ 
Sbjct: 179 VFEEKVIAAGCEESGAAEVLKAEKGEDEGA--SACMALRTDGKSIDIDGDYTETLARIQS 236

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
            K+  G  GLSFY+NN D LK+  I G+ PS  +I SG YP+SRPL FYVK+QH ++V G
Sbjct: 237 AKNGIGVFGLSFYENNTDKLKVATIAGVQPSTESIASGEYPVSRPLFFYVKKQHIDTVPG 296

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+E+  F VSDE+  PD  L  YGL+   + E  + + ++A   +
Sbjct: 297 LKEFAEFFVSDELAGPDGPLAAYGLVA--DPELATTQAAVADEAT 339


>gi|85703112|ref|ZP_01034216.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Roseovarius sp. 217]
 gi|85672040|gb|EAQ26897.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Roseovarius sp. 217]
          Length = 345

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 146/319 (45%), Positives = 206/319 (64%), Gaps = 3/319 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ PY+ I+AE F E F EF TP VESGGS  G K+ C G+G++TIDI N
Sbjct: 23  RDNIQIAGSSTVLPYAAIVAEAFGENF-EFPTPVVESGGSGAGRKKLCEGVGENTIDIAN 81

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D C  +GV++I EV IG+DGI+  SD +  S + T  D + ALA+ ++ D
Sbjct: 82  SSSRIKQSDIDLCASNGVTEIMEVRIGYDGIVFASDINGPSYAFTPADWHAALAAQVVKD 141

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
             +  N  K WS++R D P   I  +VP  KHGTREV ++KV+  GC  +  +       
Sbjct: 142 GALADNTNKVWSDVRADLPGDEILAFVPGTKHGTREVFDEKVIIAGCEENGTYDAHLAAN 201

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG +I++DGDYTETLAR++ NK+  G  GLSFY+NN D L++  
Sbjct: 202 GGDEKAAEKACMALRTDGASIDIDGDYTETLARVDANKNGIGVFGLSFYQNNTDKLQVAT 261

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GI PS+ TI SG YP+SRPL FYVK  H + + G++EY+ F VSDE+  PD  L  YG
Sbjct: 262 MGGIEPSVETIASGEYPVSRPLFFYVKNAHLDVIPGMQEYIEFFVSDEIAGPDGPLAAYG 321

Query: 325 LIPISNEERKSVRDSIAVG 343
           L+  S+ E    ++ +A  
Sbjct: 322 LV--SDPELAKTQEMVANR 338


>gi|288956865|ref|YP_003447206.1| periplasmic binding protein [Azospirillum sp. B510]
 gi|288909173|dbj|BAI70662.1| periplasmic binding protein [Azospirillum sp. B510]
          Length = 349

 Score =  249 bits (636), Expect = 3e-64,   Method: Composition-based stats.
 Identities = 113/332 (34%), Positives = 178/332 (53%), Gaps = 5/332 (1%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
            + +  ++          +R++IR  GSST+FP++  +AE F      FKTP VES G+ 
Sbjct: 12  ALGLGLILSLATASAWAQSRDQIRAVGSSTVFPFTTAVAEAFGRS-GRFKTPVVESTGTG 70

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            GLK FC G+G    DI N+SR+I ++E+D+C  +GV+ + E+ IG+DGI L S R    
Sbjct: 71  GGLKLFCGGVGPAHPDIANASRRIKKSEIDQCAANGVTTVTELKIGYDGIALASSRKAAP 130

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
           VSL+   L+KALA  + V+  +V NP K WS+I P  P   I +  P    GTR+ + + 
Sbjct: 131 VSLSTLVLWKALAKEVPVNGALVANPYKLWSDIDPALPRTAIEMLGPPPTSGTRDTVNEL 190

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           V+ +GC +    +++      +      AC ++R+DG  +E   +    + ++  N D F
Sbjct: 191 VMLQGCGKVAEVARVV----PDEAARERACMTIREDGAYVEAGENDNLIVQKLAANPDAF 246

Query: 246 GFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           G  G S+   N D L+   +DG+  +  T+ +G Y ++RPL  YVK  H   + G+RE++
Sbjct: 247 GIFGYSYLDQNRDTLQSATMDGVELTAETVAAGRYELARPLYIYVKNAHAGVIPGIREFI 306

Query: 306 SFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
               S+  M  D  L   GLIP     R++ R
Sbjct: 307 GEYTSERAMGDDGYLVDKGLIPEPKPLREAAR 338


>gi|310814684|ref|YP_003962648.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ketogulonicigenium vulgare Y25]
 gi|308753419|gb|ADO41348.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ketogulonicigenium vulgare Y25]
          Length = 340

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 142/318 (44%), Positives = 198/318 (62%), Gaps = 7/318 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ PY+ I+AE+F E FPEF  P VESGGSS GL+ FC GIG++  DI N
Sbjct: 23  RDNIQIAGSSTVLPYASIVAESFGENFPEFPVPVVESGGSSGGLQRFCAGIGENQTDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR I   E++ C  +GV+DI EV +G+DGI+  S  +    + T  D YKALA+ ++VD
Sbjct: 83  SSRPIRAGEIETCAANGVTDIIEVRVGYDGIVFASALNGPEFAFTPADWYKALAAEVVVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++V NP   W ++ P  P  +I  ++P  +HGTREV ++KVL  GC  S     +    
Sbjct: 143 GEIVPNPYTTWDQVNPALPAQQILAFIPGTRHGTREVFDEKVLVAGCEESGAAEVLSAAR 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                    AC ++R DG+++++DGDYTETLARI  N    G  GLSFY+NN D L++  
Sbjct: 203 GD-----EAACVALRTDGVSVDIDGDYTETLARIAANPQALGVFGLSFYENNTDTLRVAT 257

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           +  I P++  I +G YP+SRPL FY+K+ H   + GL+EY  F +SD+M  P   L QYG
Sbjct: 258 MSDIEPTVEAIATGTYPVSRPLYFYIKKAHIGVIPGLKEYAEFFMSDDMAGPAGPLAQYG 317

Query: 325 LIPISNEERKSVRDSIAV 342
           L+  S+ E    +  IA 
Sbjct: 318 LV--SDPELAETQALIAN 333


>gi|262372058|ref|ZP_06065337.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter junii SH205]
 gi|262312083|gb|EEY93168.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter junii SH205]
          Length = 343

 Score =  249 bits (635), Expect = 4e-64,   Method: Composition-based stats.
 Identities = 143/347 (41%), Positives = 209/347 (60%), Gaps = 8/347 (2%)

Query: 1   MRF--FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           MR    ++ L   V      GT   AR+ I+IAGSST+ PY+ I+AE F   FP+FK P 
Sbjct: 1   MRLNPRYIALALAVSGATVAGTANAARDTIQIAGSSTVLPYASIVAEEFGNTFPQFKAPV 60

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           V SGGSS GLK+FC+G+GD+TIDI NSSR I   E+  CKK GV+ IQE+ IG+DGI+  
Sbjct: 61  VGSGGSSGGLKQFCQGVGDNTIDIANSSRAIKDTEIAACKKAGVNQIQEIKIGYDGIVFA 120

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           S+    +  L    ++ AL++ L  + K+V NP   W++I    P   I + +P+  HGT
Sbjct: 121 SNVKKAAYKLKPYHVFTALSAQLPSNGKLVPNPYTTWNQIDKSLPNEPITLVIPASNHGT 180

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
           REV ++K+++ GC               + +    AC++ R+DG  IE+ GDYTETLAR+
Sbjct: 181 REVFQEKMVEAGCE------AYDYFKNLDKEAQKKACSTFRKDGRVIEIAGDYTETLARL 234

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           + +    G  GL FY  N D L++  ++ +VPS  TI+SG YP+SRPL FYVK +H  S+
Sbjct: 235 KTSPSAVGVFGLGFYDLNRDKLRVATVNNVVPSEKTILSGQYPVSRPLFFYVKGEHLKSI 294

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
            GL +YV + ++ ++    S+L + GLI +S++ER  +      GK+
Sbjct: 295 KGLPQYVEYFLNKKVSGKGSKLEKAGLIALSDKERAKILADFKAGKT 341


>gi|56696821|ref|YP_167183.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ruegeria pomeroyi DSS-3]
 gi|56678558|gb|AAV95224.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ruegeria pomeroyi DSS-3]
          Length = 346

 Score =  249 bits (635), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 145/321 (45%), Positives = 211/321 (65%), Gaps = 3/321 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E+  C ++GV+DI EV IG+DGI+  SD    +   T  D + AL+  ++VD
Sbjct: 83  ASRKIKDKEVAVCAENGVTDIIEVRIGYDGIVFASDIAGNTFEFTPSDWFLALSDKIMVD 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++V NP   W+++   FP   I  ++P  KHGTREV E KV+  GC  +  F  ++   
Sbjct: 143 GQLVDNPNSTWADVNAAFPAQPIQAFIPGTKHGTREVFEDKVILAGCEATGAFEALKAAN 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG+++++DGDYTETLARIE NKD  G  GL+FY+NN D L++  
Sbjct: 203 GDDKKAAEKACIALRTDGVSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDKLQVAT 262

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + GIVPS  +I +G YP+SRPL FYVK+ H   + GL+EY  F ++DE+  PD  L +YG
Sbjct: 263 MSGIVPSTESIATGEYPVSRPLYFYVKKAHIGVIPGLKEYAEFFIADEIAGPDGPLAEYG 322

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+  S+ E    ++++A  K 
Sbjct: 323 LV--SDPELAKTQEAVADEKV 341


>gi|46202104|ref|ZP_00053761.2| COG0226: ABC-type phosphate transport system, periplasmic component
           [Magnetospirillum magnetotacticum MS-1]
          Length = 341

 Score =  249 bits (634), Expect = 5e-64,   Method: Composition-based stats.
 Identities = 118/323 (36%), Positives = 181/323 (56%), Gaps = 7/323 (2%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
               AR++IRI GSST++P+S  +AE F +   +FKTP VES G+  G++ FC G+G+  
Sbjct: 20  GAAQARDQIRIVGSSTVYPFSTAVAEAFGK-TGKFKTPVVESTGTGGGMRLFCSGVGETF 78

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI N+SR+I  +E++ C K+GV+ I EV IG+DGI+ ++ +     +LT E +YKA A 
Sbjct: 79  PDITNASRRIEPSEVEFCTKNGVTGITEVVIGYDGIVFMNSKAGPDFALTREQMYKATAK 138

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            ++V  K+V NP K WS+I P  P+  I +Y P+  HGTR+   + VL   C +      
Sbjct: 139 DVVVGGKLVPNPYKNWSDIDPSLPKEPILVYGPAPNHGTRDAYVELVLDPACGKQPEIKA 198

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           M      +      AC +VR+DG  +EV  +YT    ++  N    G +  S+   N D 
Sbjct: 199 M------DKDAGKKACRTVREDGAWVEVSENYTVIQQKVTSNPAALGVITFSYLDQNRDK 252

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           +K  P+DG++ +   I +  YP+SRPL FY+K+QH   + G++EYV+   SD+    +  
Sbjct: 253 VKAAPVDGVIATYDAIATNKYPVSRPLFFYIKKQHVGMIPGVKEYVAEFTSDKAWGKEGY 312

Query: 320 LFQYGLIPISNEERKSVRDSIAV 342
           L   GLI   +  RK    +   
Sbjct: 313 LADKGLIASPDASRKEQAANARN 335


>gi|90415567|ref|ZP_01223501.1| phosphate ABC transporter, periplasmic binding protein-like [marine
           gamma proteobacterium HTCC2207]
 gi|90332890|gb|EAS48060.1| phosphate ABC transporter, periplasmic binding protein-like [marine
           gamma proteobacterium HTCC2207]
          Length = 352

 Score =  249 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 103/317 (32%), Positives = 177/317 (55%), Gaps = 6/317 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I + GSST++P+S ++AE +        TP +ES GS  G+K FC G+G +  DI N
Sbjct: 26  RDSIEVVGSSTVYPFSTVVAERYGRS-SGKPTPKIESTGSGGGMKLFCSGVGTNYPDITN 84

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI-- 142
           SSR++  +E  +C+ +GV D+ EV IG+DGI++ +   +  + LT +D++ ALA+ +   
Sbjct: 85  SSRRMKASEFKKCQTNGVKDVIEVHIGYDGIVIANSIKVAPMKLTRKDIFLALAAKVPGA 144

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           VD +++ NP K W ++ P  P   I +  P    GTR+   +  L+ GC +      +  
Sbjct: 145 VDGELIENPYKTWKDVNPALPATAIEVMGPPPTSGTRDAFAELGLEGGCKK---IDWINA 201

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
           + K +       C ++R+DG+ IE   +    + ++E N    G  G SF   NAD ++ 
Sbjct: 202 LKKTDKHAFKEVCHTIREDGVYIEAGENDNLIVQKLEANPAALGVFGFSFLDQNADKVQG 261

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
             I+ + P+  +I    YPISRPL FYVK+ H   V G++ Y++   S++    +  L +
Sbjct: 262 SLIESVEPTFESIADKSYPISRPLYFYVKKAHVGVVPGIQGYLNEFTSEKAWGEEGYLAE 321

Query: 323 YGLIPISNEERKSVRDS 339
            G+IP+  +ER+++ ++
Sbjct: 322 KGMIPLPIKERRAMAEN 338


>gi|256830444|ref|YP_003159172.1| periplasmic phosphate binding protein [Desulfomicrobium baculatum
           DSM 4028]
 gi|256579620|gb|ACU90756.1| periplasmic phosphate binding protein [Desulfomicrobium baculatum
           DSM 4028]
          Length = 338

 Score =  249 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 118/344 (34%), Positives = 187/344 (54%), Gaps = 15/344 (4%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M  F    +  + L +       AR++++I+GSST+FP+S  +AE        F  P VE
Sbjct: 1   MNRFLNKAIFALALLLVGTGMAHARDQVKISGSSTVFPFSSYVAEELGATTK-FAAPVVE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G K F  G+G  T DI NSSR++  +E +   K+GV+DI E  IG DGI +   
Sbjct: 60  STGSGGGHKLFGAGMGVGTPDIANSSRRMKDSEFENAAKNGVTDITEAKIGFDGIAVAQS 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +D   +S+++E+L  A+A+ ++VD K+V NP K W+EI P  P  +I  Y P    GTR+
Sbjct: 120 KDNDPMSISLEELATAVAADIMVDGKLVPNPYKMWNEINPQLPARKIVFYGPPTSSGTRD 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E+ V+++                   +       ++RQD   +    +    + ++  
Sbjct: 180 AFEEMVVEK--------------IFGKKEGYEKGYHAIRQDNAYVPAGENDNLIVQKLAK 225

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF + NAD ++   I+G+ P+  ++ SG YPISR L FYVK  H++++ G
Sbjct: 226 DKDAFGIFGYSFLEENADSIQGAAINGVTPNPESVASGQYPISRSLFFYVKNAHYDAIPG 285

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           L+EYV   +S++M+  D  L   GLIP+ + ER + R+++   K
Sbjct: 286 LKEYVELFMSEKMIGKDGLLKSIGLIPLPDAERATARENVLSKK 329


>gi|149202575|ref|ZP_01879547.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Roseovarius sp. TM1035]
 gi|149143857|gb|EDM31891.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Roseovarius sp. TM1035]
          Length = 345

 Score =  249 bits (634), Expect = 6e-64,   Method: Composition-based stats.
 Identities = 143/319 (44%), Positives = 208/319 (65%), Gaps = 3/319 (0%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ PY+ I+AE F E F +F TP VESGGS  G K+ C G+G++TIDI N
Sbjct: 23  RDNIQIAGSSTVLPYAAIVAEAFGENF-DFPTPVVESGGSGAGRKKLCEGVGENTIDIAN 81

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SS +I Q+++D C ++GV++I EV IG+DGI+  SD +  + + T  D + ALA+ +  D
Sbjct: 82  SSSRIKQSDIDLCAQNGVTEIMEVRIGYDGIVFASDINGPAYAFTPADWHAALAAQVSKD 141

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
             +  N  K WS++R D P   I  +VP  KHGTREV ++KV+  GC  +  +       
Sbjct: 142 GALADNTNKVWSDVRADLPGDEILAFVPGTKHGTREVFDEKVIIAGCEENGTYDLHLAAN 201

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             + +    AC ++R DG++I++DGDYTETLAR++ NK+  G  GLSFY+NN D L++  
Sbjct: 202 GGDEKAAEKACMALRTDGVSIDIDGDYTETLARVDANKNGIGVFGLSFYQNNTDKLQVAT 261

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           + G+VPS+ +I SG YP+SRPL FYVK  H + + G++EY+ F VSDE+  PD  L  YG
Sbjct: 262 MGGVVPSVESIASGEYPVSRPLFFYVKNAHLDVIPGMQEYIEFFVSDEISGPDGPLSAYG 321

Query: 325 LIPISNEERKSVRDSIAVG 343
           L+  S+ E    ++ +A  
Sbjct: 322 LV--SDPELAKTQEMVANR 338


>gi|89069581|ref|ZP_01156925.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanicola granulosus HTCC2516]
 gi|89044916|gb|EAR51006.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanicola granulosus HTCC2516]
          Length = 344

 Score =  248 bits (632), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 144/324 (44%), Positives = 203/324 (62%), Gaps = 5/324 (1%)

Query: 23  FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
            +R+ ++IAGSST+ PY+ I+AE F E   +F TP VESGGSS GL  FC G+G++TIDI
Sbjct: 24  QSRDNVQIAGSSTVLPYASIVAEVFGE-NTDFPTPVVESGGSSAGLARFCEGVGENTIDI 82

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYL 141
            N+SR I + EL+EC  +GV+DI EV IG+DGI+  S  D     +    D + ALA+ L
Sbjct: 83  ANASRAIREGELEECAANGVTDIIEVRIGYDGIVFASRIDGPDFTAFEASDWFTALAAEL 142

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
            VD ++V NP   W+E+  D P+  I  ++P  KHGTREV E+KVL +GC  +       
Sbjct: 143 PVDGEIVENPHTTWNEVDADLPDAEILAFIPGTKHGTREVFEEKVLLQGCEDTGALQAFL 202

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
           D    +      AC +VR DG ++++DGDYTETLAR++ N    G  GLSFY+NN D LK
Sbjct: 203 D-SGMDEDAAESACMAVRTDGASVDIDGDYTETLARLDSNPQGVGVFGLSFYENNTDKLK 261

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +  + G+ P+  TI +G YP+SRPL FY+K  H   + GL+E+  F V+DE+  PD  L 
Sbjct: 262 VATMGGVEPTTETIAAGDYPVSRPLYFYIKAAHLGVIPGLKEFAQFFVADELAGPDGPLA 321

Query: 322 QYGLIPISNEERKSVRDSIAVGKS 345
            YGL+  S+ E  + +  +A  ++
Sbjct: 322 AYGLV--SDPELAATQAKVANEET 343


>gi|149376558|ref|ZP_01894319.1| phosphate ABC transporter periplasmic binding protein [Marinobacter
           algicola DG893]
 gi|149359225|gb|EDM47688.1| phosphate ABC transporter periplasmic binding protein [Marinobacter
           algicola DG893]
          Length = 350

 Score =  248 bits (631), Expect = 1e-63,   Method: Composition-based stats.
 Identities = 116/347 (33%), Positives = 176/347 (50%), Gaps = 12/347 (3%)

Query: 1   MRFFFVVL--MCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           M      L  +          T   AR+ I I GSST++P++ ++AE F     +F TP 
Sbjct: 1   MIKLKTALTTVALAGSIAAVSTPAMARDTISIVGSSTVYPFATVVAERFGSST-DFPTPK 59

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           +ES GS  GLK FC GIG    DI N+SR++  +E D C+K+GV DI E  IG DGI++ 
Sbjct: 60  LESTGSGGGLKLFCAGIGTQHPDITNASRRMKTSEYDLCQKNGVKDITEFRIGSDGIVIA 119

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDK---VVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
           S +   ++ +T+E L+ AL   +   D    +V NP +KWS+I    P V I +  P   
Sbjct: 120 SSQKADNLDITLEQLFLALGKQVPSPDDETKLVANPYEKWSDIDSSLPNVAIRVMGPPPT 179

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GTR+   +  LQ GC      + M      +   +   C SVR+DG  IE   +    +
Sbjct: 180 SGTRDSFNELALQGGCEDLPAVADM------SEDDMEGVCQSVREDGAFIEAGENDNLIV 233

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHF 295
            ++  +K ++G  G SF + N+D L+   ++G+VP+   I +  YP++R L FYVK+ H 
Sbjct: 234 QKLIDDKGLYGVFGYSFLEENSDRLQAATLNGMVPTAEAIAADEYPVARSLFFYVKKAHV 293

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             V G+ +Y  F VS   M  +  L   GLI    +    ++D  + 
Sbjct: 294 GVVPGIADYAEFFVSPSAMGQNGYLKDVGLIVPPRDALMKLQDKASN 340


>gi|254504985|ref|ZP_05117136.1| hypothetical protein SADFL11_5024 [Labrenzia alexandrii DFL-11]
 gi|222441056|gb|EEE47735.1| hypothetical protein SADFL11_5024 [Labrenzia alexandrii DFL-11]
          Length = 365

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 153/339 (45%), Positives = 209/339 (61%), Gaps = 5/339 (1%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
            V      V          AR+++++AGSST+ PY+ I+AE F E   +F TP VESGGS
Sbjct: 26  LVSATALAVASTAFVGAAQARDQVQVAGSSTVLPYASIVAEVFGE-NTDFPTPVVESGGS 84

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
           S GLK FC G+G++TID+ N+SRKI + E+  C ++GV+DI EV IG+DGI+  S +D  
Sbjct: 85  SAGLKRFCEGVGENTIDVANASRKIREKEIKACAENGVTDIMEVRIGYDGIVFASQKDGP 144

Query: 125 SV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
           +  + T    + ALA  ++VD  +V NP  KWSE+    P+V IA ++P  KHGTREV E
Sbjct: 145 AFTAFTPVQWHNALAPKVLVDGAIVDNPYTKWSEVDASLPDVEIAAFIPGTKHGTREVFE 204

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KVL  GC  S     M D    +      AC +VR DG ++++DGDYTETLARI+ N +
Sbjct: 205 EKVLLIGCEESGAMKAMMD-GGMSEDDAEDACLAVRTDGKSVDIDGDYTETLARIDSNPN 263

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GL+FY+NN D LK+  +  I PS  TI +G YP+SRPL FYVK+ H   + GL+E
Sbjct: 264 GVGVFGLAFYENNTDKLKVATMSDIAPSTETISTGEYPVSRPLFFYVKKAHIGVIPGLKE 323

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           Y  F V+DE+  P   L QYGL+  S+ E  + + SI  
Sbjct: 324 YAQFFVADEIAGPQGPLAQYGLV--SDPELAATQASIEA 360


>gi|34557337|ref|NP_907152.1| periplasmic phosphate binding protein [Wolinella succinogenes DSM
           1740]
 gi|34483053|emb|CAE10052.1| PERIPLASMIC PHOSPHATE BINDING PROTEIN [Wolinella succinogenes]
          Length = 345

 Score =  247 bits (630), Expect = 2e-63,   Method: Composition-based stats.
 Identities = 117/339 (34%), Positives = 174/339 (51%), Gaps = 12/339 (3%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F  L   V           AR++I++AGSST++P+S  +AE F       KTP VES G+
Sbjct: 4   FGKLALSVTAAAVLALSAQARDQIKMAGSSTVYPFSSYVAEEFGATTGN-KTPVVESLGT 62

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K FC G G DT DI N+SR I ++E D C  +GV+DI  V IG+DGI +   +   
Sbjct: 63  GGGFKVFCAGDGLDTTDIANASRPIKKSEFDNCVANGVTDITGVMIGYDGISIAQSKANA 122

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           +++  +E L+ ALA  + VD K+V NP K W+++    P   I +Y P    GTR+  E+
Sbjct: 123 AINFKIEHLFLALAEEVPVDGKLVKNPYKTWNQVDASLPNRPIVVYGPPTTSGTRDAFEE 182

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
            V++ G  +   +                    +RQDG  I    +    + ++  +K+ 
Sbjct: 183 LVMEVGSKKFDAY-----------GDAKGKYKKIRQDGAYIPAGENDNLIVQKLVQDKNA 231

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G  G SF + N D +    I+GI P+  TI  G YP+SR L FYVK  H   V GL ++
Sbjct: 232 LGIFGYSFLEENPDKVSGANINGIAPTAKTIGDGSYPVSRSLYFYVKNSHRAGVKGLDQF 291

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           V   +SD+M+  +  L   GLIP+  +  K V+D++   
Sbjct: 292 VDLFISDKMIGGNGVLKNIGLIPMQPDLLKKVQDTVKAK 330


>gi|260430659|ref|ZP_05784631.1| phosphate ABC transporter, periplasmic binding protein
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260418100|gb|EEX11358.1| phosphate ABC transporter, periplasmic binding protein
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 345

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 114/318 (35%), Positives = 173/318 (54%), Gaps = 6/318 (1%)

Query: 29  RIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRK 88
           RI GSST+FPY++ +AE F        +P VES G+  G+K FC GIG++T DI  +SR 
Sbjct: 28  RIVGSSTVFPYTQAVAEQF-ANNTGAPSPIVESTGTGGGMKIFCEGIGENTADITGASRA 86

Query: 89  ITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM-VSVSLTVEDLYKALASYLIVDDKV 147
           +  +E + C+K+GV+DI E  IG DG+ +   R       LT+ ++Y AL + + VD + 
Sbjct: 87  MKASEYELCQKNGVTDISEALIGFDGLSVAVSRANDFDWDLTLGEIYMALGAQVPVDGEW 146

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
             NP K W+EIR D P V I  Y P    GTR+   +  +  GC              ++
Sbjct: 147 KDNPYKMWNEIREDLPAVEILAYGPPPTSGTRDAFVELAMHAGCEELD----FVKDGGFD 202

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
              +   C+ +R DG  +E   +    + R+E + +  G  G SF   N D LK V I+G
Sbjct: 203 GDWVEENCSRMRTDGPFVEAGENDNLIVQRLEADPNAVGIFGYSFLYENLDKLKPVKIEG 262

Query: 268 IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIP 327
           + P+  TI    YP+SRPL FYVK  H   +  L E++   +SD+ +A D  L + GL+ 
Sbjct: 263 VEPNADTIADKSYPVSRPLYFYVKNAHRGVIPNLDEFLEEYMSDDALAADGYLAERGLVA 322

Query: 328 ISNEERKSVRDSIAVGKS 345
           +S+E R+ ++D+I  G++
Sbjct: 323 LSDERREELQDAILNGQN 340


>gi|254438938|ref|ZP_05052432.1| hypothetical protein OA307_3808 [Octadecabacter antarcticus 307]
 gi|198254384|gb|EDY78698.1| hypothetical protein OA307_3808 [Octadecabacter antarcticus 307]
          Length = 343

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 150/342 (43%), Positives = 212/342 (61%), Gaps = 4/342 (1%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              + +  + +     T   AR+ ++IAGSST+ PY+ I+AE F E   +F TP VESGG
Sbjct: 3   VLKLTVSTLAITALSATVVAARDNVQIAGSSTVLPYAAIVAEFFGE-NTDFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G +TIDI N+SR I  +EL  C ++GV+DI EV IG+DGI+  SD D 
Sbjct: 62  SSAGLKRFCEGVGANTIDIANASRAIKDSELAICAENGVTDIVEVRIGYDGIVFASDIDG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            S + T  D Y ALA+ + +D  +  NP   WS++  DF    I  ++P  KHGTREV E
Sbjct: 122 NSFAFTPSDWYTALAADMPMDGTMAANPNTDWSQVNADFAMQPIVAFIPGTKHGTREVFE 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           +KVL +GC  +   + M DM   +       C +VR DG+++++DGDYTETLARIE + +
Sbjct: 182 EKVLLQGCEDTGAMAAMIDM-GMDEDTAESTCMAVRTDGLSVDIDGDYTETLARIEADTN 240

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G  GLSFY+NN D L++  + G+VP+  TI +G YP+SRPL FY+K  H   + GL+E
Sbjct: 241 GIGVFGLSFYENNTDKLQVATMVGVVPTTQTISAGDYPVSRPLYFYIKAAHVGVIPGLQE 300

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           + SF V+DE+  PD  L  YGL+  S+ E    + ++A   +
Sbjct: 301 FASFFVADELAGPDGPLAAYGLV--SDPELADTQAAVANLTT 340


>gi|307544716|ref|YP_003897195.1| ABC transporter periplasmic protein [Halomonas elongata DSM 2581]
 gi|307216740|emb|CBV42010.1| ABC-type transport system periplasmic substrate-binding protein
           [Halomonas elongata DSM 2581]
          Length = 341

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 116/322 (36%), Positives = 183/322 (56%), Gaps = 15/322 (4%)

Query: 23  FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
            AR+++RI GSST++P++  +AE F     E+ TP +ES GS  GL+ FC G+GDDT DI
Sbjct: 27  QARDQVRIVGSSTVYPFASYVAEEFGATT-EYPTPVIESTGSGGGLRLFCNGVGDDTPDI 85

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI 142
            N+SR++  +E + C+++GV+DI E  IG+DGI      +  ++ +T E ++ ALA+ + 
Sbjct: 86  TNASRRMKPSEFERCEENGVTDITEAFIGYDGIAFAQSGENDAMPVTREQIFLALAAQVP 145

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
           VD ++V NP  +WS+I    P+ +IA+Y P    GTR+  E+ V++              
Sbjct: 146 VDGELVDNPYTQWSDIDESLPDRKIAVYGPPTTSGTRDAFEELVMEAASE---------- 195

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
               +++    A T +R DG  I+   +    + R+  NKD FG  G SF + N+D L  
Sbjct: 196 ----DMEAYGEAYTDIRSDGAYIDAGENDNLIVQRLAENKDAFGIFGYSFLEENSDSLIG 251

Query: 263 VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
             IDG+ P+   I SG YP+SR L FYVK QH  +V  + EY +  +S++M+     L  
Sbjct: 252 SSIDGVKPTPEAIGSGEYPVSRSLFFYVKNQHAENVPPMYEYANMFMSEQMIGDMGYLKG 311

Query: 323 YGLIPISNEERKSVRDSIAVGK 344
            GLIP   + R+  R+++   +
Sbjct: 312 IGLIPAPQDMREEARNAVESKE 333


>gi|110679869|ref|YP_682876.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter denitrificans OCh 114]
 gi|109455985|gb|ABG32190.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter denitrificans OCh 114]
          Length = 346

 Score =  246 bits (628), Expect = 3e-63,   Method: Composition-based stats.
 Identities = 150/339 (44%), Positives = 212/339 (62%), Gaps = 5/339 (1%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           F  +    + + V   T   AR+++++AGSST+ PY+ I+AE F E F EF TP VESGG
Sbjct: 3   FVKISSSALAIAVVAATSATARDQVQVAGSSTVLPYAAIVAEAFGENF-EFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++T+DI NSSR I + E+  C ++GV+DI EV IG+DGI+  S +  
Sbjct: 62  SSAGLKRFCEGVGENTVDIANSSRPIREREIAACAENGVTDIIEVRIGYDGIVFASQQTG 121

Query: 124 VSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
            +       D Y ALA+ L VD ++V NP   W  + P  P V IA ++P  KHGTREV 
Sbjct: 122 PAFTEFQPSDWYTALAANLPVDGEMVANPNMTWDAVNPALPAVDIAAFIPGTKHGTREVF 181

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
           E+KVL +GC  +     M DM   +      AC +VR DG ++++DGDYTETLARIE N 
Sbjct: 182 EEKVLLQGCEDTGAMQAMMDM-GMDEDAAESACMAVRTDGKSVDIDGDYTETLARIESNA 240

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           +  G  GL+FY+NN D LK+  + G+ P+  TI +G YP+SRPL FY+K+ H   + GL+
Sbjct: 241 NGIGVFGLAFYENNTDKLKVATMGGVEPTTETISTGEYPVSRPLFFYIKKAHIGVIPGLK 300

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           ++  F VSD++  PD  L +YGL+  S+      + ++A
Sbjct: 301 DFAEFFVSDDIAGPDGPLAEYGLV--SDPALAETQAAVA 337


>gi|194595544|gb|ACF77055.1| putative ABC-type phosphate transporter periplasmic phosphate
           binding protein [Halomonas sp. HAL1]
          Length = 323

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 113/330 (34%), Positives = 171/330 (51%), Gaps = 14/330 (4%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +       AR++IRI GSST++P++  + E F        TP +ES GS  GL+ FC G+
Sbjct: 1   MSVAGVAQARDQIRIVGSSTVYPFASYVTEEFGATTGN-PTPVIESTGSGGGLRLFCNGV 59

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
           G+ T DI N+SR++   E + C+++GV+DI E  IG DGI+L        V LT+E ++ 
Sbjct: 60  GEGTPDITNASRRMKVAEFERCEENGVTDITEAKIGSDGIVLGQSNTNDVVDLTLEQIFM 119

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
           A+A+ + VD ++V NP   WSEI    P+  I+IY P    GTR+  E+ VL+   +   
Sbjct: 120 AVAAQVPVDGELVDNPYTNWSEIDSSLPDREISIYGPPTTSGTRDAFEELVLETASLEMD 179

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
            +                  T +R DG+ I+   +    + R+  +    G  G SF + 
Sbjct: 180 VY-------------GEEGYTDIRSDGVYIDAGENDNLIVQRLSEDTGAMGIFGYSFLEE 226

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           N D L    I+G+ P    I SG YP++R L FYVK QH   V  + +YV   +S+ M+ 
Sbjct: 227 NTDSLNGATINGVAPEPEAISSGDYPVARSLWFYVKNQHAEEVPPMADYVDMFMSEMMIG 286

Query: 316 PDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
            D  L   GLI +  EER+  R ++A   +
Sbjct: 287 ADGYLKDIGLIVLPEEEREEWRQAVADRTT 316


>gi|189345919|ref|YP_001942448.1| periplasmic phosphate binding protein [Chlorobium limicola DSM 245]
 gi|189340066|gb|ACD89469.1| periplasmic phosphate binding protein [Chlorobium limicola DSM 245]
          Length = 342

 Score =  246 bits (627), Expect = 4e-63,   Method: Composition-based stats.
 Identities = 111/344 (32%), Positives = 177/344 (51%), Gaps = 12/344 (3%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           + F+                  AR +IRI GSST+FP++  +AE F +    F TP +ES
Sbjct: 4   KRFWKTAFMACAFAGLATGSAEAREQIRIVGSSTVFPFASYVAEEFGKTTK-FATPVIES 62

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            GS  G K F  G G  T DI NSSR++ ++E +  +++GV  I E  IG+DGI++ + +
Sbjct: 63  TGSGGGHKLFGEGDGLATPDITNSSRRMKKSEFERAQQNGVKTIHEAVIGYDGIVVANAK 122

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
              ++ L+ +D++ ALA  + V  ++V NP K W++I P  P+ +I +Y P    GTR+ 
Sbjct: 123 AAPALKLSRKDIFMALAEEVPVKGQLVKNPYKMWNQINPALPKQKILVYGPPTSSGTRDA 182

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
            ++ V++    +   +                    +RQDG+ +    +    + RI  +
Sbjct: 183 FDEMVMEAASKKMTEYGTAA-----------GKYKKIRQDGVYVPSGENDNLIVQRIVKD 231

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL 301
           ++  G  G SF + NAD +K   +DG+ P    I +G YP+SR L FYVK  H   V GL
Sbjct: 232 RNAVGVFGYSFLEENADRIKGATVDGVAPLPANITTGKYPVSRDLFFYVKGSHLAQVKGL 291

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           +EYV   + ++M+     L + GLIP+   +R +VR S    K 
Sbjct: 292 KEYVDLFLGEKMIGDYGYLKKIGLIPLPKAKRDAVRASWTAKKV 335


>gi|163761563|ref|ZP_02168635.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Hoeflea phototrophica DFL-43]
 gi|162281277|gb|EDQ31576.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Hoeflea phototrophica DFL-43]
          Length = 343

 Score =  245 bits (625), Expect = 6e-63,   Method: Composition-based stats.
 Identities = 150/326 (46%), Positives = 211/326 (64%), Gaps = 6/326 (1%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
                 AR++++IAGSST+ PY+ I+AE F E F EF TP VESGGS  G K+ C G+G+
Sbjct: 17  LTGAAVARDQVQIAGSSTVLPYASIVAEAFGENF-EFPTPVVESGGSGAGRKKLCEGVGE 75

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKAL 137
           +TIDI NSS +I Q+++D C  +GV++IQEV IG+DGI+  SD +    + T  D + AL
Sbjct: 76  NTIDIANSSSRIKQSDIDLCASNGVTEIQEVRIGYDGIVFASDINGPEYAFTPADWHNAL 135

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
           A+ ++ D ++V NP K W+EIR D P   I  +VP  KHGTREV ++KV+  GC  +   
Sbjct: 136 AAKVMKDGQLVDNPYKTWNEIRADLPAQEILAFVPGTKHGTREVFDEKVIIAGCEENGAA 195

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
              +     +V     AC  +R DG++I++DGDYTETLAR++ NK+  G  GLSFY+NN 
Sbjct: 196 EAHKAAGAEDVDD---ACMQLRTDGVSIDIDGDYTETLARVDANKNGIGVFGLSFYQNNT 252

Query: 258 DVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           D L++  + G+VPS+ +I SG YP+SRPL FYVK  H + + GL+EYV F VSDE+  PD
Sbjct: 253 DKLQVGTMGGVVPSVESIASGEYPVSRPLYFYVKNAHLDVIPGLQEYVEFFVSDEIAGPD 312

Query: 318 SQLFQYGLIPISNEERKSVRDSIAVG 343
             L  YGL+  S+ E    ++ +   
Sbjct: 313 GPLAAYGLV--SDPELAKTQEMVKNR 336


>gi|78188479|ref|YP_378817.1| periplasmic phosphate binding protein [Chlorobium chlorochromatii
           CaD3]
 gi|78170678|gb|ABB27774.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chlorobium chlorochromatii CaD3]
          Length = 342

 Score =  245 bits (624), Expect = 9e-63,   Method: Composition-based stats.
 Identities = 117/346 (33%), Positives = 176/346 (50%), Gaps = 14/346 (4%)

Query: 1   MRF--FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           MR   F+      +           AR +IRI GSST+FP++  +AE F +     +TP 
Sbjct: 1   MRITQFWKHATMALAFVGLASGSLEAREQIRIVGSSTVFPFASYVAEEFGKTTGN-QTPV 59

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           +ES GS  G K F       T DI NSSR++ + E D  K++G+  I EV IG+DGI++ 
Sbjct: 60  IESTGSGGGHKLFGESDAITTPDITNSSRRMKKAEFDRAKQNGIQAIHEVVIGYDGIVIA 119

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           + +   ++ LT  DL+ ALA  + +  ++V NP  KWS+IR   P  +I +Y P    GT
Sbjct: 120 NAKKATTLQLTRRDLFFALAEEVPMKGQLVKNPYTKWSQIRKGLPNQKILVYGPPTSSGT 179

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
           R+  ++ V++        +  +                 +RQDG+ +    +    + RI
Sbjct: 180 RDAFDEMVMEASSKSITEYGALA-----------GKYKKIRQDGVFVPSGENDNLIVQRI 228

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
             +K   G  G SF + NAD +K   IDG+ P    I SG YP+SR L FYVK  H   V
Sbjct: 229 VKDKAAVGVFGYSFLEENADRIKGATIDGVAPVPANITSGKYPVSRDLYFYVKGSHIAQV 288

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
            GL+EYV   V ++M+     L + GLIP+  +ER+++R +    K
Sbjct: 289 KGLKEYVDLFVGEKMIGDYGYLKKIGLIPLPKKEREAIRANWNARK 334


>gi|307941520|ref|ZP_07656875.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseibium sp. TrichSKD4]
 gi|307775128|gb|EFO34334.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseibium sp. TrichSKD4]
          Length = 345

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 151/347 (43%), Positives = 215/347 (61%), Gaps = 6/347 (1%)

Query: 1   MRFFFVVLMCFVVLEVY-CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+F  +V +  V            AR+++++AGSST+ PY+ I+AE F E   +F TP V
Sbjct: 1   MKFTTLVSVAAVAAASVSFAGAAQARDQVQVAGSSTVLPYASIVAEAFGE-NTDFPTPVV 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ESGGSS GLK FC G+G++TID+ N+SRKI + E+  C ++GV+DI EV IG+DGI+  S
Sbjct: 60  ESGGSSSGLKRFCEGVGENTIDVANASRKIREKEIKACAENGVTDIIEVRIGYDGIVFAS 119

Query: 120 DRDMVSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
            +D  +  + T    + ALA  ++ D ++V NP  KWSE+    P+V IA ++P  KHGT
Sbjct: 120 QKDGPAFTAFTPVQWHNALAPKVLKDGQIVDNPYNKWSEVDASLPDVEIAAFIPGTKHGT 179

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
           REV E+KVL  GC  S     M D    +      AC +VR DG ++++DGDYTETLARI
Sbjct: 180 REVFEEKVLLVGCEESGAMKAMMD-GGMSEDDAEDACLAVRTDGKSVDIDGDYTETLARI 238

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           + N +  G  GL+FY+NN D LK+  +  + PS  TI +G YP+SRPL FYVK+ H   +
Sbjct: 239 DSNPNGVGVFGLAFYENNTDKLKVATMSDVAPSTETIATGTYPVSRPLFFYVKKAHIGVI 298

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
            GL+EY  F  +DE+  P   L QYGL+   + E  + + SI+  ++
Sbjct: 299 PGLKEYAQFFTADEIAGPQGPLAQYGLVA--DPELAATQASISAEET 343


>gi|332305411|ref|YP_004433262.1| phosphate binding protein [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332172740|gb|AEE21994.1| phosphate binding protein, putative [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 345

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 114/340 (33%), Positives = 178/340 (52%), Gaps = 14/340 (4%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           ++    T  R+ I + GSST+F +S ++AE F +    F+TP +ES GS  GLK FC+G+
Sbjct: 1   MFSAPATAMRDYIDVVGSSTVFAFSTVVAERFGKS-SVFRTPKIESTGSGGGLKLFCQGV 59

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
           G    DI NSSR+I  +ELD C+++GV ++ E+ IG DGI+L   +  V+V LT  +LY 
Sbjct: 60  GMKFPDIANSSRRIKASELDLCQQNGVHEVIEILIGFDGIVLAQSKLGVNVELTRRELYL 119

Query: 136 ALASYLIVDDK---VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCV 192
           ALA  +   D     + NP K W +I P  P+++I ++ P    GTR+   + VL  GC 
Sbjct: 120 ALAKRVPNPDGSKTTIENPYKTWHDITPSLPKIKINVFGPPPTSGTRDAFSELVLDYGCH 179

Query: 193 RSRNFSKMRDMFKYNV----------QQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
                ++M                   +    C  +R+DG  I+   +    + ++  N 
Sbjct: 180 TFEWLAQMSQPQGAVKRDVKEKKALLNKQKRLCRMIREDGAYIDAGENDNLIVQKLNANP 239

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           D  G +G SF   N D +K   IDG +PS  +I SG YPISRPL  YVK+ H   + G+ 
Sbjct: 240 DALGLLGFSFLDQNRDRIKSAKIDGFLPSFRSISSGDYPISRPLYMYVKKAHIGMIPGVE 299

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
            ++   VS++       L + G+IP+   +R+++   +  
Sbjct: 300 AFIREFVSNKASGESGYLLRKGMIPLPKSQRQAIEQRMNA 339


>gi|226952524|ref|ZP_03822988.1| phosphate transporter [Acinetobacter sp. ATCC 27244]
 gi|226836751|gb|EEH69134.1| phosphate transporter [Acinetobacter sp. ATCC 27244]
          Length = 348

 Score =  244 bits (623), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 139/321 (43%), Positives = 196/321 (61%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ I+AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TIDI N
Sbjct: 32  RDTIQIAGSSTVLPFASIVAEEFGNTFPQFKTPVVGSGGSSGGLKQFCQGVGDNTIDIAN 91

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR +  +E+  C K GV+ IQE+ IG+DGI+  S+ +  +  L    ++ A+A+ L  +
Sbjct: 92  SSRPMRSSEVPTCAKAGVNKIQEIKIGYDGIVFASNINKAAYKLKPYHVFTAIAAELPSN 151

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P   HGTREV ++K++  GC           + 
Sbjct: 152 GKMVPNPYTHWNQIDKSLPNEPITLVIPGSNHGTREVFQEKMVDAGCE------AYEYIK 205

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      ACT+ RQ G  IE+ GDYTETLAR+       G  GLSFY  N D L++  
Sbjct: 206 NLDKDAQKKACTTFRQGGRVIEIAGDYTETLARLRTTPSAVGVFGLSFYDQNRDKLRVAT 265

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  TI+SG YP+SRPL FYVK +H NS+ GL +YV F ++       S+L + G
Sbjct: 266 VNNVVPSEATILSGKYPVSRPLYFYVKGEHLNSIKGLPQYVEFFLNKRTSGKGSKLERAG 325

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LIP+S+ ER  +      GK 
Sbjct: 326 LIPLSDSERAKILADFKAGKV 346


>gi|294679019|ref|YP_003579634.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Rhodobacter capsulatus SB 1003]
 gi|294477839|gb|ADE87227.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacter capsulatus SB 1003]
          Length = 351

 Score =  244 bits (622), Expect = 1e-62,   Method: Composition-based stats.
 Identities = 145/344 (42%), Positives = 213/344 (61%), Gaps = 8/344 (2%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           F    +  + +     TG  AR++I+ AGSST+ PY+ I+AE F E F +FKTP VE GG
Sbjct: 3   FVKFGVSALAIVAASATGAAARDQIQAAGSSTVLPYATIVAEAFGENF-DFKTPVVEGGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K+ C G+G++TIDI NSS +I Q+++D CK +GV +I EV IG+DGI+  SD   
Sbjct: 62  SGAGRKKLCEGVGENTIDIANSSSRIKQSDIDTCKANGVDEIMEVRIGYDGIVFASDIKG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              + T  D++ A+++ ++ D K+V N  K W+E+    P   I  ++P  KHGTREV +
Sbjct: 122 PDFAFTPADIFGAISAKVVKDGKLVDNTAKTWAEVNAKLPAQDILTFIPGTKHGTREVFD 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA-----CTSVRQDGIAIEVDGDYTETLARI 238
            +VL+EGC  +  +       +   +          C ++R DG+A+++DGDYTETL+RI
Sbjct: 182 IEVLEEGCKATGAYDLYMATAEGADEDAKKKDVVKKCGALRTDGVAVDIDGDYTETLSRI 241

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           + NK+  G  GLSFY+NN D L++  I+GIVPS  TI  G YP+SRPL FYVK+ H   +
Sbjct: 242 DANKNAIGVFGLSFYQNNTDKLRVATINGIVPSTETIAKGDYPVSRPLYFYVKKAHLGVI 301

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
            GL+E+++F VSDEM  P+  L  YGL+  S+ E  + +  +  
Sbjct: 302 PGLKEFITFFVSDEMAGPEGPLAAYGLV--SDPELAATQAMVEA 343


>gi|294649819|ref|ZP_06727221.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Acinetobacter haemolyticus ATCC 19194]
 gi|292824302|gb|EFF83103.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Acinetobacter haemolyticus ATCC 19194]
          Length = 348

 Score =  244 bits (622), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 139/321 (43%), Positives = 196/321 (61%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ P++ I+AE F   FP+FKTP V SGGSS GLK+FC+G+GD+TIDI N
Sbjct: 32  RDTIQIAGSSTVLPFASIVAEEFGNTFPQFKTPVVGSGGSSGGLKQFCQGVGDNTIDIAN 91

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           SSR +  +E+  C K GV+ IQE+ IG+DGI+  S+ +  +  L    ++ A+A+ L  +
Sbjct: 92  SSRPMRSSEVSTCAKAGVNKIQEIKIGYDGIVFASNINKAAYKLKPYHVFTAIAAELPSN 151

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP   W++I    P   I + +P   HGTREV ++K++  GC           + 
Sbjct: 152 GKMVPNPYTHWNQIDKSLPNEPITLVIPGSNHGTREVFQEKMVDAGCE------AYEYIK 205

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +      ACT+ RQ G  IE+ GDYTETLAR+       G  GLSFY  N D L++  
Sbjct: 206 NLDKDAQKKACTTFRQGGRVIEIAGDYTETLARLRTTPSAVGVFGLSFYDQNRDKLRVAT 265

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ +VPS  TI+SG YP+SRPL FYVK +H NS+ GL +YV F ++       S+L + G
Sbjct: 266 VNNVVPSEATILSGKYPVSRPLYFYVKGEHLNSIKGLPQYVEFFLNKRTSGKGSKLERAG 325

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LIP+S+ ER  +      GK 
Sbjct: 326 LIPLSDSERAKILADFKAGKV 346


>gi|328544897|ref|YP_004305006.1| ABC phosphate transporter periplasmic component-like protein
           [polymorphum gilvum SL003B-26A1]
 gi|326414639|gb|ADZ71702.1| ABC-type phosphate transport system periplasmic component-like
           protein [Polymorphum gilvum SL003B-26A1]
          Length = 346

 Score =  243 bits (620), Expect = 2e-62,   Method: Composition-based stats.
 Identities = 114/344 (33%), Positives = 184/344 (53%), Gaps = 6/344 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA-RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+F  +V    + +      G    R++I++ GSST+FPY++ +AE ++        P +
Sbjct: 1   MKFKTLVSTVALAVAATAVAGAAQARDQIKVVGSSTVFPYTQGVAEEYANKTGSAA-PVL 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES G+  G K FC G+G D  D+  +SR I   E + CK +GV+D+ EV IG+DG+ +  
Sbjct: 60  ESTGTGGGFKVFCGGVGPDHPDMTGASRAIKDGEKELCKTNGVTDVTEVLIGYDGLSIAH 119

Query: 120 DRDMVSVSLTVEDLYKALASYLIVD-DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
                 +SLT E ++KALA+ L       V NP K WS+I    P V I ++ P    GT
Sbjct: 120 SVSGPELSLTNEQIFKALAAELPDGKGGFVANPNKSWSDIDASLPNVAITVFGPPPTSGT 179

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
           R+   +  + +GC        M D+ K + ++ +  C+ +RQDG  IE   +    + R+
Sbjct: 180 RDAFVELAMHDGCKGLPG---MADLQKADAKKWNEVCSRMRQDGAFIEAGENDNLIVQRL 236

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           + + +  G  G SF   N D LK V I+G++PS+  I SG Y +SRPL  YVK  H   +
Sbjct: 237 QADANALGIFGYSFLYENQDTLKGVAINGVLPSLEAIGSGDYVLSRPLFNYVKNAHRGVI 296

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
            GL E+++  VS++ +     L + GL+P+  + R+  R+++  
Sbjct: 297 PGLNEFLAEYVSEDAIGDGGYLSERGLVPLPADLREKTRETVTN 340


>gi|84684960|ref|ZP_01012860.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84667295|gb|EAQ13765.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodobacterales bacterium HTCC2654]
          Length = 343

 Score =  243 bits (619), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 145/343 (42%), Positives = 210/343 (61%), Gaps = 5/343 (1%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           F  +    + +         AR+++++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   FAKLTASTLAIAAMTTGVAVARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TIDI N+SR I + E+  C + GV+DI EV IG+DGI+  S  + 
Sbjct: 62  SSAGLKRFCEGVGENTIDIANASRAIREKEIAACAEAGVTDIIEVRIGYDGIVFASQLNG 121

Query: 124 VSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
               + T  D++ ALA  ++VD ++V NP  KWS+   D P+  I  ++P  KHGTREV 
Sbjct: 122 PEFTAFTESDIFNALAPKVMVDGELVDNPHTKWSDFNADLPDAEILAFIPGTKHGTREVF 181

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
           E+KV+  GC  +     M      +      AC  VR DG+++++DGDYTETLARI+ N 
Sbjct: 182 EEKVIAAGCEATGAMEAMIA-GGMSEDDAEDACLMVRTDGMSVDIDGDYTETLARIDANT 240

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           +  G  GL+FY+NN D LK+  + G+ P+  TI +G YP+SRPL FY+K+ H   + GL+
Sbjct: 241 NAIGVFGLAFYENNTDKLKVATMSGVEPTTETIAAGDYPVSRPLYFYIKKAHIGVIPGLK 300

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           EY  F V+DE+  PD  L  YGL+   + E  + +  IA  ++
Sbjct: 301 EYAEFFVADEIAGPDGPLSNYGLVA--DPELAATQAMIANEET 341


>gi|163743304|ref|ZP_02150685.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Phaeobacter gallaeciensis 2.10]
 gi|161383492|gb|EDQ07880.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Phaeobacter gallaeciensis 2.10]
          Length = 351

 Score =  243 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 145/344 (42%), Positives = 211/344 (61%), Gaps = 8/344 (2%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           F  +    + +     T   AR+++++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   FVKLTASALAISAVSATAAAARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TID+ N+SR+I   E+  C ++GV+DI EV IG+DGI+  +D   
Sbjct: 62  SSAGLKRFCEGVGENTIDVANASRRIKDKEIKACAENGVTDIIEVQIGYDGIVFANDIKG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            +   T  D + AL+  ++VD K+V NP K W+++   FP   I  ++P  KHGTREV E
Sbjct: 122 NAFEYTPTDWFLALSDEILVDGKMVANPNKTWADVNSAFPAQDIQAFIPGTKHGTREVFE 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA-----CTSVRQDGIAIEVDGDYTETLARI 238
            KV+  GC  +  F  +    + +  +         C S+R DG ++++DGDYTETLARI
Sbjct: 182 DKVILAGCEATGAFEHLLTHAEGDSDKAKKKAAEKACISLRTDGKSVDIDGDYTETLARI 241

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           E NKD  G  GL+FY+NN D L++  + GIVP+  +I  G YP+SRPL FYVK+ H   +
Sbjct: 242 ESNKDGIGVFGLAFYENNTDKLQVATMSGIVPTTESIAEGEYPVSRPLFFYVKKAHIGVI 301

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
            GL+EY  F V+DE+  PD  L +YGL+   + E    +  ++ 
Sbjct: 302 PGLKEYAEFFVADEVAGPDGPLAEYGLVA--DPELTKTQAVVSE 343


>gi|86138914|ref|ZP_01057486.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. MED193]
 gi|85824561|gb|EAQ44764.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. MED193]
          Length = 355

 Score =  243 bits (618), Expect = 4e-62,   Method: Composition-based stats.
 Identities = 144/326 (44%), Positives = 211/326 (64%), Gaps = 8/326 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 28  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I + E+  C + GV+DI EV IG+DGI+  SD +    + T  D + AL+  ++VD
Sbjct: 87  ASRAIKEKEIKACAEAGVTDIIEVRIGYDGIVFASDINGNEFAYTPTDWFLALSDEILVD 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP K W+++   FP   +  ++P  KHGTREV E KV+  GC  +  F  +    
Sbjct: 147 GKMVPNPNKTWADVNASFPAQSLQAFIPGTKHGTREVFEDKVILAGCEATGAFEHLLAQA 206

Query: 205 KYNV-----QQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           + +      +    AC ++R DG+++++DGDYTETLARIE NKD  G  GL+FY+NN D 
Sbjct: 207 EGDTPKAQKKAAEKACIALRTDGVSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDK 266

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           L++  + GIVPS  +I +G YP+SRPL FYVK+ H   + GL+EY  F +SDE+  PD  
Sbjct: 267 LQVATMSGIVPSTESIATGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFISDEVAGPDGP 326

Query: 320 LFQYGLIPISNEERKSVRDSIAVGKS 345
           L +YGL+   + E    ++++A   +
Sbjct: 327 LSEYGLVA--DPELSQTQETVANEAT 350


>gi|262376067|ref|ZP_06069298.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter lwoffii SH145]
 gi|262309161|gb|EEY90293.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter lwoffii SH145]
          Length = 343

 Score =  242 bits (617), Expect = 5e-62,   Method: Composition-based stats.
 Identities = 142/345 (41%), Positives = 212/345 (61%), Gaps = 6/345 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MRF  + L   V       T   AR+ I+IAGSST+ PY+ I+AE F   FP+FKTP V 
Sbjct: 1   MRFTNIALALAVTGATAVTTAHAARDTIQIAGSSTVLPYASIVAEEFGNTFPQFKTPVVG 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLK+FC G+GD+TIDI NSSR+I   EL ECKK+GV+ + E+ IG+DGI+  S+
Sbjct: 61  SGGSSGGLKQFCNGVGDNTIDIANSSRQIKSTELAECKKNGVNQVLEIKIGYDGIVFASN 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +  +  L  + ++ ALA+ L  + K+V NP  +W++I    P   I + +P+  HGTRE
Sbjct: 121 ANKAAYKLRPQHVFAALAAQLPSNGKMVANPYTRWNQIDKALPNEPITLVIPASNHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V ++K++  GC           +   +      ACT+ R+DG  +E+ GDYTETLAR++ 
Sbjct: 181 VFQEKMVDAGCET------YAAIKSLDKDAKKKACTTFRKDGRVVEIAGDYTETLARLKT 234

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +    G  GL FY  N D L++  ++ + PS  TI++G YP+SRPL FYVK +H  S+ G
Sbjct: 235 SPSAVGVFGLGFYDQNRDRLRVATVNNVAPSEKTILNGAYPVSRPLFFYVKGEHLKSIKG 294

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L ++  + ++ ++    S+L + GLI +S++ER +V  +   GK+
Sbjct: 295 LPQFTEYFLNKKVSGKGSKLEKAGLISMSDKERAAVLANFKAGKA 339


>gi|254475568|ref|ZP_05088954.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ruegeria sp. R11]
 gi|214029811|gb|EEB70646.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Ruegeria sp. R11]
          Length = 351

 Score =  242 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 149/347 (42%), Positives = 215/347 (61%), Gaps = 9/347 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M F        + +     T   AR+++++AGSST+ PY+ I+AE F E F +F TP VE
Sbjct: 1   MSFVKFT-ASALAISAVSATAAAARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLK FC G+G++TID+ N+SR+I   E+  C ++GV+DI EV IG+DGI+  SD
Sbjct: 59  SGGSSAGLKRFCEGVGENTIDVANASRRIKDKEIKACAENGVTDIIEVQIGYDGIVFASD 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +      T  D + AL+  ++VD K+V NP K W+++   FP   I  ++P  KHGTRE
Sbjct: 119 INGNGFEYTPSDWFLALSDEILVDGKMVANPNKTWADVNTAFPAQDIQAFIPGTKHGTRE 178

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA-----CTSVRQDGIAIEVDGDYTETL 235
           V E KV+  GC  +  F  +    + +  +         C S+R DG+++++DGDYTETL
Sbjct: 179 VFEDKVILAGCEATGAFDVLLAAAEGDSDKAKHKAAEKACISLRTDGVSVDIDGDYTETL 238

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHF 295
           ARIE NKD  G  GL+FY+NN D L++  + G+VPS  +I +G YP+SRPL FYVK+ H 
Sbjct: 239 ARIESNKDGIGVFGLAFYENNTDKLQVATMSGVVPSTESIATGEYPVSRPLFFYVKKAHI 298

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             + GL+EY  F V+DE+  PD  L +YGL+  S+ E    + ++A 
Sbjct: 299 GVIPGLKEYAEFFVADEVAGPDGPLAEYGLV--SDPELSKTQAAVAE 343


>gi|255318363|ref|ZP_05359596.1| ABC-type phosphate transport system, periplasmic component
           [Acinetobacter radioresistens SK82]
 gi|262378593|ref|ZP_06071750.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter radioresistens SH164]
 gi|255304355|gb|EET83539.1| ABC-type phosphate transport system, periplasmic component
           [Acinetobacter radioresistens SK82]
 gi|262299878|gb|EEY87790.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter radioresistens SH164]
          Length = 343

 Score =  242 bits (616), Expect = 6e-62,   Method: Composition-based stats.
 Identities = 137/321 (42%), Positives = 198/321 (61%), Gaps = 6/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ I+IAGSST+ PY+ I+AE F   FP+FKTP V SGG+S GLK+FC+G+GD+TIDI N
Sbjct: 27  RDTIQIAGSSTVLPYASIVAEEFGNTFPQFKTPVVGSGGTSGGLKQFCQGVGDNTIDIAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I   EL  CKK GV+ +QE+ IG+DGI+  S+ +  +  L    +Y ALA  L   
Sbjct: 87  ASREIKDTELASCKKAGVNKVQEIKIGYDGIVFASNANKAAFKLKPYHVYAALAEKLPSK 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K+V NP  +W++I    P   I + +P+  HGTREV ++K++  GC             
Sbjct: 147 GKLVANPYTRWNQIDKTLPNEPITLVIPASNHGTREVFQEKMVDLGC------KAYEYNK 200

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +       C++ R+DG  IE+ GDYTETL+R++ N    G  GL FY  N D L++  
Sbjct: 201 NLDKDTQKTVCSTFRKDGRVIEISGDYTETLSRLKTNPSAVGVFGLGFYDQNRDRLRVAT 260

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++ + PS  TI+SG YP+SRPL FYVK +H  SV GL +YV + ++ ++    S+L + G
Sbjct: 261 VNNVTPSEATILSGKYPVSRPLFFYVKGEHLKSVKGLEQYVEYFLNKKVSGKGSKLEKAG 320

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           LI +S+ ER  V  +   GK+
Sbjct: 321 LISLSDSERAKVLANFKAGKT 341


>gi|16125762|ref|NP_420326.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Caulobacter crescentus CB15]
 gi|221234520|ref|YP_002516956.1| phosphate-binding protein [Caulobacter crescentus NA1000]
 gi|13422894|gb|AAK23494.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Caulobacter crescentus CB15]
 gi|220963692|gb|ACL95048.1| phosphate-binding protein [Caulobacter crescentus NA1000]
          Length = 346

 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 108/342 (31%), Positives = 168/342 (49%), Gaps = 5/342 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M       +  V L         AR++I   GSST+FP+S  +AENF++     K+P +E
Sbjct: 1   MNKLI-GAVATVALLAVADQAHAARDQIWAVGSSTVFPFSTRVAENFAKKT-GKKSPRIE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           + G+  G+K FC G G+   DI N+SR++ ++E   C+K GV DI E+ IG DGI++ S+
Sbjct: 59  ALGTGGGIKMFCGGAGEKFPDIANASRQMKKSEFLACQKAGVKDIVEIKIGFDGIVVASN 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +     +  +E LY  LA   +   +VV  P K WSE+ P  P  RI  Y P    GTR+
Sbjct: 119 KKGPDFNFKLEQLYLGLADQTLRGGQVVKQPYKSWSEVGPGLPNARILAYGPPPTSGTRD 178

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              +  ++ G  +    +KM+     + ++     + +R DG  ++   +    +  IE 
Sbjct: 179 AWIELAIEGGAGKLPTLAKMKA---ADEKKFKATVSPMRTDGGWVDAGENDNAIVGTIEK 235

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
             +  G  G SF + N   +K   I+G+ P+  TI SG YP+SR L  YVK+       G
Sbjct: 236 TPNALGVFGYSFLEENGSRIKGASINGVKPTAQTIASGQYPLSRSLYIYVKKSQVGVTPG 295

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           L+E+VS  VSD        L   G+IP+       ++     
Sbjct: 296 LKEFVSEFVSDAATGRGGYLQNRGMIPLPPAVHIQMKQKANA 337


>gi|83951999|ref|ZP_00960731.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseovarius nubinhibens ISM]
 gi|83837005|gb|EAP76302.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseovarius nubinhibens ISM]
          Length = 352

 Score =  241 bits (615), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 150/347 (43%), Positives = 216/347 (62%), Gaps = 9/347 (2%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F +    + +     T   AR+ +++AGSST+ PY+ I+AE F E F +F TP VESGGS
Sbjct: 4   FTLSTSALAILAVSATAAAARDNVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGS 62

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
           S GLK FC G+G++TID+ NSSRKI + E+  C + GV+DI EV IG+DGI+  S +   
Sbjct: 63  SAGLKRFCEGVGENTIDVANSSRKIREKEIKACAEAGVTDIIEVRIGYDGIVFASQKTGP 122

Query: 125 SVS-LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
             +  T  DL+ AL+  +++D K+V NP +KWS+   D P+V IA ++P  KHGTREV E
Sbjct: 123 EFTTFTQADLFNALSPKVVIDGKLVDNPYQKWSDFNADLPDVEIATFIPGTKHGTREVFE 182

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA-----CTSVRQDGIAIEVDGDYTETLARI 238
           +KVL +GC  +  +  ++   +    +         C +VR DG ++++DGDYTETLAR+
Sbjct: 183 EKVLVQGCEDTGAYELLKAEAEGEDDKAKGKAAHKACYNVRTDGKSVDIDGDYTETLARL 242

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           + N +  G  GL+FY+NN D LK+  +  + PS  TI SG YP+SRPL FYVK+ H   +
Sbjct: 243 DSNSNGVGVFGLAFYENNTDKLKVATMADVAPSTETIASGEYPVSRPLYFYVKKAHIGVI 302

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
            GL+EY  F VSDE+  PD  L  YGL+  S+ E  + +  +A   +
Sbjct: 303 PGLKEYAEFFVSDEIAGPDGPLSDYGLV--SDPELAATQTLVADEAT 347


>gi|163736450|ref|ZP_02143869.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Phaeobacter gallaeciensis BS107]
 gi|161390320|gb|EDQ14670.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Phaeobacter gallaeciensis BS107]
          Length = 351

 Score =  241 bits (613), Expect = 1e-61,   Method: Composition-based stats.
 Identities = 144/344 (41%), Positives = 210/344 (61%), Gaps = 8/344 (2%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           F  +    + +     T   AR+++++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   FVKLTASALAISAVSATAAAARDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TID+ N+SR+I   E+  C ++GV+DI EV IG+DGI+  +D   
Sbjct: 62  SSAGLKRFCEGVGENTIDVANASRRIKDKEVKACAENGVTDIIEVQIGYDGIVFANDIKG 121

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            +   T  D + AL+  ++ D K+V NP K W+++   FP   I  ++P  KHGTREV E
Sbjct: 122 NAFEYTPTDWFLALSDEILADGKMVANPNKTWADVNSAFPAQDIQAFIPGTKHGTREVFE 181

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA-----CTSVRQDGIAIEVDGDYTETLARI 238
            KV+  GC  +  F  +    + +  +         C S+R DG ++++DGDYTETLARI
Sbjct: 182 DKVILAGCEATGAFEHLLAHAEGDSDKAKKKAAEKACISLRTDGKSVDIDGDYTETLARI 241

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           E NKD  G  GL+FY+NN D L++  + GIVP+  +I  G YP+SRPL FYVK+ H   +
Sbjct: 242 ESNKDGIGVFGLAFYENNTDKLQVATMSGIVPTTESIAEGEYPVSRPLFFYVKKAHIGVI 301

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
            GL+EY  F V+DE+  PD  L +YGL+   + E    +  ++ 
Sbjct: 302 PGLKEYAEFFVADEVAGPDGPLAEYGLVA--DPELTKTQAVVSE 343


>gi|254480671|ref|ZP_05093918.1| hypothetical protein GPB2148_3762 [marine gamma proteobacterium
           HTCC2148]
 gi|214039254|gb|EEB79914.1| hypothetical protein GPB2148_3762 [marine gamma proteobacterium
           HTCC2148]
          Length = 380

 Score =  241 bits (613), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 118/377 (31%), Positives = 181/377 (48%), Gaps = 34/377 (9%)

Query: 1   MRFFFVVLMCFVVLEVYCGT-GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M    +  M   V            R+ + I GSST++P++ ++AE F      FK P +
Sbjct: 1   MIKQLLGAMALAVGFSGVANVQAQGRDSVSIVGSSTVYPFATVVAERFGRSTS-FKAPKI 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES GS  GLK FC+G+G  T DI NSSR+I ++E D+C+ +GV+D+ EV IG+DGI + +
Sbjct: 60  ESTGSGGGLKLFCKGVGAGTPDITNSSRRIKKSEYDDCQSNGVTDVIEVLIGYDGIAIAN 119

Query: 120 DRDMVSVSLTVEDLYKALASYLIV-DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
            R    ++++++DLY ALA  +   D +++ NP + W++I P  P  +I +  P    GT
Sbjct: 120 SRRAPQLAISLKDLYLALAKDIPDADGQLIPNPHQSWNDINPALPATKIEVMGPPPTSGT 179

Query: 179 REVLEKKVLQEGCVRSR-------------------------------NFSKMRDMFKYN 207
           R+   +  L  G                                     + + +      
Sbjct: 180 RDAFAELALGGGAKSIPALKTLSGFDSSQEQEIKSAMEQLGIPVSVYQAYVESKGKKPKG 239

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                    SVR+DG  IE   +    + ++E N +  G  G SF   N D ++   IDG
Sbjct: 240 KDIFKTVAYSVREDGAYIEAGENDNLIVQKLEANPNALGIFGFSFLDENGDKVQGSVIDG 299

Query: 268 IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIP 327
           + PS  TI  G YP+SRPL FY+K  H   + G++EY     S + M+ D  L + GLIP
Sbjct: 300 VEPSFDTIADGDYPVSRPLYFYIKSAHVGRIPGIQEYAMEFASAKAMSEDGYLPEKGLIP 359

Query: 328 ISNEERKSVRDSIAVGK 344
           +S EE   V+  +   K
Sbjct: 360 LSKEELAQVQADVKSLK 376


>gi|167645748|ref|YP_001683411.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Caulobacter sp. K31]
 gi|167348178|gb|ABZ70913.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Caulobacter sp. K31]
          Length = 346

 Score =  240 bits (612), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 104/344 (30%), Positives = 169/344 (49%), Gaps = 7/344 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+         + L     +   AR+ +  AGSST+FP+S   AENF++     K P +E
Sbjct: 1   MKTLL-GATAALGLLAGASSAHAARDYVWAAGSSTVFPFSTRTAENFAKKT-GKKAPKIE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G+K FC G+G+   DI N+SR + ++E D C+  GV++I E+ IG DGI++  D
Sbjct: 59  SLGTGGGVKMFCGGMGEKFPDIANASRPMKKSEFDACRAKGVNNIVELKIGFDGIVVAMD 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +     +  VE LY  L   ++   + V NP K W ++    P  RI +Y P    GTR+
Sbjct: 119 KSSPDYNFKVEHLYLGLGQTVLRGGQFVANPYKTWKDVGAGLPANRILVYGPPPTSGTRD 178

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              +  ++ G  +   F   + +   + +        +R DG  ++   +    +  IE 
Sbjct: 179 AFVELAIEGGAKK---FPTAKALHDTDEKAFKAKVDPLRTDGAWVDAGENDNAIIGTIEK 235

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
                G  G SF + NA+ +K   ++G+ P+   I SG YP+SR L  YVK+       G
Sbjct: 236 TPGALGVFGYSFLEENANKIKGASVNGVKPTAQAIASGQYPLSRSLYIYVKKDQVGVTPG 295

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           L+E+++  VSD        L   GLIP+   + ++++   A GK
Sbjct: 296 LKEFIAEFVSDSATGRGGYLQDRGLIPLPPAQHEAMKA--AAGK 337


>gi|126736263|ref|ZP_01752005.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. CCS2]
 gi|126714084|gb|EBA10953.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. CCS2]
          Length = 344

 Score =  240 bits (611), Expect = 2e-61,   Method: Composition-based stats.
 Identities = 145/319 (45%), Positives = 208/319 (65%), Gaps = 4/319 (1%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
           +FAR+ +++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC GIG +T+D
Sbjct: 20  SFARDNVQVAGSSTVLPYAAIVAEIFGENF-DFPTPVVESGGSSAGLKRFCEGIGANTLD 78

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR I   E++ C ++GV+DI EV IG+DGI+  SD +  S   T ED YKALA+  
Sbjct: 79  IANASRAIRPAEIEVCAENGVTDIIEVRIGYDGIVFASDINGNSFEFTPEDWYKALANEH 138

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
            +D  +V N  + W ++ PDFP   I  ++P  KHGTREV E+KV+  GC     F  M 
Sbjct: 139 FIDGALVANTFETWDQVNPDFPAQPIQAFIPGTKHGTREVFEEKVILAGCEDGGFFQAML 198

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
           D    +       C ++R DG ++++DGDYTETLARIE + +  G  GLSFY+NN D L+
Sbjct: 199 DA-GVDEDTAEGKCMAIRTDGRSVDIDGDYTETLARIEADTNGIGVFGLSFYENNTDKLQ 257

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           +  ++G+VP+  +I +  YP+SRPL FY+K  H   + G++E+  F VSD++  PD  L 
Sbjct: 258 VATMNGVVPTTESIAAAEYPVSRPLYFYIKAGHIGVIPGVKEFAEFFVSDDIAGPDGPLA 317

Query: 322 QYGLIPISNEERKSVRDSI 340
           +YGL+  S+ E   V++++
Sbjct: 318 EYGLV--SDPELSEVQETV 334


>gi|126737847|ref|ZP_01753577.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. SK209-2-6]
 gi|126721240|gb|EBA17944.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. SK209-2-6]
          Length = 355

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 147/326 (45%), Positives = 214/326 (65%), Gaps = 8/326 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 28  RDQVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SRKI   E+  C ++GV+DI EV IG+DGI+  SD +  S   T  D + AL+  ++VD
Sbjct: 87  ASRKIKAKEVKACAENGVTDIIEVRIGYDGIVFASDINANSFEYTPTDWFLALSDKIMVD 146

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD-- 202
            ++V NP K W+++  +FP V I  +VP  KHGTREV E KV+  GC  +  F  +    
Sbjct: 147 GQLVDNPNKTWADVNSNFPAVEIQAFVPGTKHGTREVFEDKVILAGCEATGAFEHLLAHA 206

Query: 203 ---MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
                K   +    AC ++R DG ++++DGDYTETLARIE NKD  G  GL+FY+NN D 
Sbjct: 207 EGETAKAKKKAAEKACIALRTDGRSVDIDGDYTETLARIESNKDGIGVFGLAFYENNTDK 266

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           L++  + GIVPS  +I +G YP+SRPL FYVK+ H   + GL+EY  F V++E+   D  
Sbjct: 267 LQVATMSGIVPSTESIATGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVAEEVAGEDGP 326

Query: 320 LFQYGLIPISNEERKSVRDSIAVGKS 345
           L +YGL+   + E ++ +++++  K+
Sbjct: 327 LAEYGLVA--DPELEATQEAVSDEKT 350


>gi|159044082|ref|YP_001532876.1| periplasmic-binding protein [Dinoroseobacter shibae DFL 12]
 gi|157911842|gb|ABV93275.1| periplasmic binding protein [Dinoroseobacter shibae DFL 12]
          Length = 341

 Score =  240 bits (611), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 145/321 (45%), Positives = 210/321 (65%), Gaps = 4/321 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++T+DI N
Sbjct: 24  RDQVQVAGSSTVLPYAAIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTLDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I   E+  C ++GV++I EV IG+DGI+  SD +  S + T ED YKALA+   +D
Sbjct: 83  ASRQIRDAEVAVCAENGVTEIIEVRIGYDGIVFASDINGPSFAFTPEDWYKALAAEHFID 142

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            ++V N L+ W ++ PDFP   I  +VP  KHGTREV E+KV+ +GC     F  M D  
Sbjct: 143 GELVANSLETWDQVNPDFPAQPIQAFVPGTKHGTREVFEEKVILQGCQDGGFFQAMLDA- 201

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
             +       C S+R DG ++++DGDYTETLARI  + +  G  GL+FY+NN D L++  
Sbjct: 202 GVDEDTAEEKCMSLRTDGRSVDIDGDYTETLARIASDTNGIGVFGLAFYENNTDKLQVAT 261

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           ++G+VP+   I +G YP+SRPL FY+K+ H   + GL+E+  F V+DE+  PD  L  YG
Sbjct: 262 MNGVVPTTEAIAAGDYPVSRPLFFYIKKAHIGVIPGLQEFAEFFVADEIAGPDGPLAAYG 321

Query: 325 LIPISNEERKSVRDSIAVGKS 345
           L+  S+      +  +A G+S
Sbjct: 322 LV--SDPALGETQTLVASGQS 340


>gi|163731860|ref|ZP_02139307.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter litoralis Och 149]
 gi|161395314|gb|EDQ19636.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter litoralis Och 149]
          Length = 336

 Score =  239 bits (610), Expect = 3e-61,   Method: Composition-based stats.
 Identities = 145/322 (45%), Positives = 206/322 (63%), Gaps = 5/322 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E F EF TP VESGGSS GLK FC G+G++T+DI N
Sbjct: 14  RDQVQVAGSSTVLPYAAIVAEAFGENF-EFPTPVVESGGSSAGLKRFCEGVGENTVDIAN 72

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIV 143
           +SR+I + E+  C ++GV+DI EV IG+DGI+  S +   +       D Y ALA+ L V
Sbjct: 73  ASRQIREREIAACAENGVTDIIEVRIGYDGIVFASQQTGPAFTEFQPSDWYTALAAELPV 132

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D K++ NP   W  +    P V IA ++P  KHGTREV E+KVL +GC  +     M DM
Sbjct: 133 DGKMIANPNATWDSVNAALPAVDIAAFIPGTKHGTREVFEEKVLLQGCEDTGAMQAMMDM 192

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC +VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK+ 
Sbjct: 193 -GMDEDAAESACMAVRTDGKSVDIDGDYTETLARIDSNTNGIGVFGLAFYENNTDKLKVA 251

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + G+ P+  TI +G YP+SRPL FY+K+ H   + GL+++  F VSDE+  PD  L +Y
Sbjct: 252 TMGGVQPTTETISTGDYPVSRPLFFYIKKAHIGVIPGLKDFAEFFVSDEIAGPDGPLAEY 311

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+  S+      + ++A  K 
Sbjct: 312 GLV--SDPALSETQAAVADEKV 331


>gi|118589311|ref|ZP_01546717.1| phosphate ABC transporter, periplasmic binding protein [Stappia
           aggregata IAM 12614]
 gi|118438011|gb|EAV44646.1| phosphate ABC transporter, periplasmic binding protein [Stappia
           aggregata IAM 12614]
          Length = 330

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 116/337 (34%), Positives = 171/337 (50%), Gaps = 24/337 (7%)

Query: 14  LEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCR 73
           L         AR+R+ I GSST+FP+S  +AE         K P VES GS  G   FC 
Sbjct: 4   LFCLVSLSAEARDRLLIVGSSTVFPFSTAVAEAVG--NSGMKFPIVESTGSGAGFALFCS 61

Query: 74  GIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDL 133
           G+G+ T DI N+SR++   EL+ C  +GV+   EV IG+DGI+L + R     +LTVE +
Sbjct: 62  GVGEHTPDITNASRRMKAPELETCHANGVTP-VEVQIGYDGIVLANSRKGPKFTLTVEQI 120

Query: 134 YKALA--------SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
           ++ALA          L  + ++V NP   WS+I    P+ +I +  P    GTR+  E+ 
Sbjct: 121 FEALAEKLPEKQPGKLPANGQLVDNPNLAWSDIDATLPQEKIEVLGPPPTSGTRDAFEEL 180

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           V++EGC   ++                  CT +R+DG  +E   +    +  +E N    
Sbjct: 181 VMEEGCKAVKDLE-------------KGGCTRIRRDGSFVEAGENDDLIVGALEANPVTV 227

Query: 246 GFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           G  G SF   N D ++ V ++G+ P+   I SG YP+SRPL FY+K++H   + G+  Y+
Sbjct: 228 GIFGYSFLMQNRDKIQSVGVNGVEPTFEKIASGEYPVSRPLFFYIKKEHVGLIPGMEAYI 287

Query: 306 SFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           S   SDE    D  L   GLIP+S E+R+        
Sbjct: 288 SAFTSDEAWGDDGYLAGKGLIPLSAEKRRQQAAEAQA 324


>gi|295688995|ref|YP_003592688.1| phosphate-binding protein [Caulobacter segnis ATCC 21756]
 gi|295430898|gb|ADG10070.1| phosphate-binding protein [Caulobacter segnis ATCC 21756]
          Length = 346

 Score =  239 bits (610), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 110/346 (31%), Positives = 177/346 (51%), Gaps = 10/346 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M      +    +L V       AR+ +  AGSST+FP+S  +AEN+S+     K+P +E
Sbjct: 1   MNKLLGAVATIALLAV-ADQAHAARDYVWAAGSSTVFPFSTRVAENYSKKT-GKKSPKIE 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G+K FC G G+   DI N+SR + ++E   C+K GV DI E+ IG DGI++ +D
Sbjct: 59  SLGTGGGIKMFCGGTGEKFPDIANASRPMKKSEFQACQKAGVKDIVEIKIGFDGIVVATD 118

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +     +  +E LY  LA   +   ++V  P K W+E+ P+ P+ RI  Y P    GTR+
Sbjct: 119 KQGPDFNFKLEQLYLGLADQTLRGGQLVKQPYKNWNEVGPNLPKARILAYGPPPTSGTRD 178

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              +  ++ G  +    +KM+     + ++     + +R DG  ++   +    +  IE 
Sbjct: 179 AWIELGIEGGAAKLPTLAKMKA---ADEKKFKATVSPMRTDGGWVDAGENDNAIVGTIEK 235

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
             +  G  G SF + NA  +K   I+G+ P+   I SG YP+SR L  YVK+       G
Sbjct: 236 TPNALGVFGYSFLEENASRIKGASINGVKPTAQAIASGQYPLSRSLYIYVKKSQVGVTPG 295

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           L+E+V+  VSD        L   GLIP+   + ++++     GK+G
Sbjct: 296 LKEFVTEFVSDAATGRGGYLQGRGLIPLPPAQHQAMK-----GKAG 336


>gi|120556534|ref|YP_960885.1| phosphate ABC transporter periplasmic binding protein [Marinobacter
           aquaeolei VT8]
 gi|120326383|gb|ABM20698.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Marinobacter aquaeolei VT8]
          Length = 349

 Score =  239 bits (609), Expect = 4e-61,   Method: Composition-based stats.
 Identities = 108/344 (31%), Positives = 172/344 (50%), Gaps = 12/344 (3%)

Query: 1   MRFFFVVLMCFVVLEVYC-GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+    +    +   V        AR+ I I GSST++P++ ++AE F     +F TP +
Sbjct: 1   MKLNKALATVALAGSVAALSAPAMARDTISIVGSSTVYPFATVVAERFGA-NTDFPTPKL 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES GS  GLK FC+G+G    DI N+SR++  +E D C+ +GV DI E  IG DGI++ S
Sbjct: 60  ESTGSGGGLKLFCQGVGTQHPDITNASRRMKPSEFDLCQSNGVKDITEFRIGSDGIVIAS 119

Query: 120 DRDMVSVSLTVEDLYKALASYLIVD---DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKH 176
            ++  ++ +T+E L+ AL   +      ++++ NP K WS+I    P   I +  P    
Sbjct: 120 SKEAENLEVTLEQLFLALGKEVPNPKNENELIANPYKNWSDIDSSLPNKPIRVMGPPPTS 179

Query: 177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
           GTR+   +  LQ GC      + M      +   +   C S+R+DG  IE   +    + 
Sbjct: 180 GTRDSFNELALQGGCEDLPAVANM------SEDDMEGVCQSIREDGAFIEAGENDNLIVQ 233

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFN 296
           ++  +  ++G  G SF + NAD L+   ++G VP+   I +  YP++R L FYVK+ H  
Sbjct: 234 KLIGDTGMYGVFGYSFLEENADRLQAATLNGKVPTAEGIAADEYPVARSLFFYVKKAHVG 293

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLI-PISNEERKSVRDS 339
            V G++EY         M P+  L   GLI P  +        +
Sbjct: 294 VVPGIQEYAQEFTGMGAMGPNGYLKSVGLIVPPRDALMDLQEKA 337


>gi|50084401|ref|YP_045911.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter sp. ADP1]
 gi|49530377|emb|CAG68089.1| putative phosphate transporter (ABC superfamily, peri-bind)
           [Acinetobacter sp. ADP1]
          Length = 343

 Score =  238 bits (607), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 144/347 (41%), Positives = 209/347 (60%), Gaps = 8/347 (2%)

Query: 1   MRF--FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           MR     + +   V       T   AR+ I+IAGSST+ PY+ I+AE F   FP+FKTP 
Sbjct: 1   MRLNPRHLAIAFAVSGAAIATTANAARDTIQIAGSSTVLPYASIVAEEFGNTFPQFKTPV 60

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           V SGG+S GLK+FC+G+GD+TIDI N+SRK+   EL  CKK GV+ +QE+ IG+DGI+  
Sbjct: 61  VGSGGTSGGLKQFCQGVGDNTIDIANASRKVKDTELAACKKAGVNQVQEIKIGYDGIVFA 120

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           S+       L    ++ ALA  L  + ++V NP  +W++I    P   I + +P+  HGT
Sbjct: 121 SNLSKPVYKLKPAFVFAALAEKLPSNGQLVANPYTRWNQIDKSLPNEPITLVIPASNHGT 180

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
           REV ++K+++ GC     F KM      + ++   AC++ R+DG  IE+ GDYTETLAR+
Sbjct: 181 REVFQEKMVEAGCEAYDYFKKM------DKEEQKKACSAFRKDGRVIEISGDYTETLARL 234

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           + +    G  GL FY  N D L++  ++ + PS  TI++G YP+SRPL FYVK +H  S+
Sbjct: 235 KTSPSAVGVFGLGFYDQNRDKLRVATVNNVAPSEKTILNGSYPVSRPLFFYVKGEHVKSI 294

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
            GL +YV F ++ +     S+L + GLI +S+ ER  V      GKS
Sbjct: 295 KGLPQYVEFFLNKKTSGKGSKLEKAGLISMSDSERAKVLADFKAGKS 341


>gi|260427703|ref|ZP_05781682.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Citreicella sp. SE45]
 gi|260422195|gb|EEX15446.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Citreicella sp. SE45]
          Length = 346

 Score =  238 bits (606), Expect = 9e-61,   Method: Composition-based stats.
 Identities = 143/322 (44%), Positives = 203/322 (63%), Gaps = 5/322 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ ++IAGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TIDI N
Sbjct: 24  RDNVQIAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIV 143
           +SR I + E+  C   GV+DI +V IG+DGI+  S +      +    DLY ALA  ++V
Sbjct: 83  ASRAIREKEIAACADAGVTDIIQVRIGYDGIVFASQKTGPEFTAFEPADLYNALAEQVLV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D ++  NP   W+E   + P+V IA ++P  KHGTREV E+KVL +GC  +     M D 
Sbjct: 143 DGEMKPNPYNTWAEFNSELPDVEIAAFIPGTKHGTREVFEEKVLLQGCEDTGAMQAMID- 201

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC +VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK+ 
Sbjct: 202 GGMSEDDAEGACMAVRTDGKSVDIDGDYTETLARIDSNANGVGVFGLAFYENNTDKLKVA 261

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + G+ P+  TI  G YP+SRPL FY+K+ H   + GL+E+  F VSDE+  P   L  Y
Sbjct: 262 TMSGVQPTTETIAEGEYPVSRPLFFYIKKAHIGVIPGLKEFAEFFVSDEIAGPSGPLANY 321

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+  S+ E  + +  ++  ++
Sbjct: 322 GLV--SDPELAATQAQVSEEET 341


>gi|167644235|ref|YP_001681898.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Caulobacter sp. K31]
 gi|167346665|gb|ABZ69400.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Caulobacter sp. K31]
          Length = 347

 Score =  238 bits (606), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 105/346 (30%), Positives = 162/346 (46%), Gaps = 7/346 (2%)

Query: 1   MRFFFVVLMCFVVLE-VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+         V L  +       AR+ +  AGSST+FP++   AENF++     K P V
Sbjct: 1   MKKLLSCAAAAVALSGLAAAPAHAARDYVWAAGSSTVFPFATRTAENFAKKT-GKKAPKV 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES G+  G+K FC G G+   DI N+SR + ++E D C   GV DI  + +G DGI++ +
Sbjct: 60  ESLGTGGGIKLFCSGTGEGFPDIANASRPMKKSEFDACAAKGVKDIVAIKVGFDGIVVAT 119

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           D++    +   E LY  LA  ++   + V NP K W EI    P  RI +Y P    GTR
Sbjct: 120 DKEGADYNFKTEHLYLGLAKTVLKGGQFVANPYKTWDEIGSGLPGNRINVYGPPPTSGTR 179

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   +  ++ G  +      +R     N ++       +R DG  I+   +    +  + 
Sbjct: 180 DAFVELAIEAGARKFPTADAIRS---DNEKKFKSLVDPLRNDG-WIDAGENDNAIVGTLT 235

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
                 G  G S+ + N D +K   ++G+ PS  TI  G YP+SR L  YVK+ +     
Sbjct: 236 KTPGSLGVFGWSYLEENMDKIKGASVNGVRPSAQTIADGSYPLSRSLYIYVKKANIGVTP 295

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           GL E++S   SD        L   GLIP+   +    +  +A  K+
Sbjct: 296 GLAEFLSEFTSDAASGRGGYLQGRGLIPLPPGQHD-AQKQVAANKT 340


>gi|197105955|ref|YP_002131332.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Phenylobacterium zucineum HLK1]
 gi|196479375|gb|ACG78903.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Phenylobacterium zucineum HLK1]
          Length = 361

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 99/326 (30%), Positives = 167/326 (51%), Gaps = 4/326 (1%)

Query: 17  YCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIG 76
                  A+ ++  AGSST+FP++  +AE  +          VES G+  G+K FC G G
Sbjct: 31  GAAPKGGAQGQVWAAGSSTVFPFATRVAETVARTTGGAP-AKVESLGTGGGIKLFCGGAG 89

Query: 77  DDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKA 136
            +  D+ N+SR++ ++E + C+ +GV+DI EV IG+DGI++ + ++  +  LT E +Y+A
Sbjct: 90  RNFPDVANASRRMKKSEWEACQANGVTDILEVKIGYDGIVIANAKNAPTFHLTREQIYRA 149

Query: 137 LASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
           LA+ +        N    WS + P  P  RI  Y P    GTR+   +  +++G  +   
Sbjct: 150 LAAEVPQGSGFATNTAATWSAVAPGLPNERIVAYGPPPTSGTRDAFVELAMEKGAEKVPA 209

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
              M  +   + +       ++R+DG  I+   +    +  +E   +  G  G SF +NN
Sbjct: 210 ---MAALKSSDEEAFKQRAHTLRKDGAWIDAGENDNVIVQTLEKTPNAVGVFGYSFLENN 266

Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            D +K   I+G+ P++  I +G YP+SR L  YVKR +     GL+E+V   +S+  +  
Sbjct: 267 MDKVKAADIEGVSPTLENISTGKYPLSRSLYIYVKRANIGVTPGLKEFVDGFLSEAAVGR 326

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAV 342
              L Q GLIP+  +E  + RD+   
Sbjct: 327 GGYLLQRGLIPLPADELTAQRDAAKA 352


>gi|225630208|ref|YP_002726999.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Wolbachia sp. wRi]
 gi|225592189|gb|ACN95208.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Wolbachia sp. wRi]
          Length = 338

 Score =  237 bits (605), Expect = 1e-60,   Method: Composition-based stats.
 Identities = 115/334 (34%), Positives = 182/334 (54%), Gaps = 4/334 (1%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSV 66
           +L+ FV +     +   AR  IRI GSST+FP+   IAE F+  F  FKTP VES GS  
Sbjct: 5   LLLIFVFVLFTPLSNADARKYIRIVGSSTVFPFISFIAEEFNRVFS-FKTPVVESIGSGS 63

Query: 67  GLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV 126
           G K FC GIG+DT DI  SSR + + E + CK++ ++++ E+ IG+DGI++ +       
Sbjct: 64  GFKMFCSGIGEDTPDITTSSRPMKEVERELCKRNKINEVIEIIIGYDGIVIANSNQSHRF 123

Query: 127 SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKV 186
             T +DL++ L++Y   +DK+V N  K WS++    P+  I IY P    GT E L   +
Sbjct: 124 DFTKKDLFETLSAYSQENDKLVKNNKKFWSDVNQALPKTEIEIYGPHQNTGTYETLVNSI 183

Query: 187 LQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFG 246
           + +      +  ++      + ++   AC ++R DG  IEV  +    + +++ NK+  G
Sbjct: 184 MLDQYSCMNS--RIFKENYKDQEERKQACGNIRDDGRYIEVGINENIIIQKLKSNKNALG 241

Query: 247 FVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVS 306
               SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H ++V GLRE+V 
Sbjct: 242 IFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPLYLYIKKEHLDTVDGLREFVK 301

Query: 307 FSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
             +    +     L + GLIP+S+E+ K     +
Sbjct: 302 EIIDSIGI-EGGYLSRLGLIPLSSEDIKKASAKV 334


>gi|254450420|ref|ZP_05063857.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Octadecabacter antarcticus 238]
 gi|198264826|gb|EDY89096.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Octadecabacter antarcticus 238]
          Length = 328

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 145/325 (44%), Positives = 208/325 (64%), Gaps = 4/325 (1%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
             T   AR+ ++IAGSST+ PY+ I+AE F E   +F TP VESGGSS GLK FC G+G+
Sbjct: 2   SATVAAARDNVQIAGSSTVLPYAAIVAEFFGE-NTDFPTPVVESGGSSAGLKRFCEGVGE 60

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKAL 137
           +TIDI N+SR I  +E+  C ++GV+DI EV IG+DGI+  SD +  S + T  D Y AL
Sbjct: 61  NTIDIANASRAIKDSEIAICAENGVTDIVEVRIGYDGIVFASDINGNSFAFTPSDWYTAL 120

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
           A+ + +D  +V N    WS++  DF +  I  ++P  KHGTREV E+KVL +GC  +   
Sbjct: 121 AAEMPMDGAMVANLNTDWSQVNADFADQPIVSFIPGTKHGTREVFEEKVLLQGCEDTGAM 180

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
           + M +M   +      AC +VR DG+++++DGDYTETLARIE + +  G  GLSFY+NN 
Sbjct: 181 AAMIEM-GMDEDTAEGACMAVRTDGLSVDIDGDYTETLARIEADTNGIGVFGLSFYENNT 239

Query: 258 DVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           D L++  +  +VP+  +I +G YP+SRPL FY+K  H   + GL+E+ SF V+DE+  P 
Sbjct: 240 DKLQVATMSDVVPTTQSISTGEYPVSRPLYFYIKAAHVGVIPGLKEFASFFVADELAGPS 299

Query: 318 SQLFQYGLIPISNEERKSVRDSIAV 342
             L  YGL+  S+ E    + ++A 
Sbjct: 300 GPLADYGLV--SDPELADTQAAVAN 322


>gi|149914851|ref|ZP_01903380.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. AzwK-3b]
 gi|149811039|gb|EDM70876.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseobacter sp. AzwK-3b]
          Length = 346

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 151/339 (44%), Positives = 207/339 (61%), Gaps = 5/339 (1%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           +F +    + +     T   AR+ +++AGSST+ PY+ I+AE F E F +F TP VESGG
Sbjct: 3   YFKMTASTLAIAAVSATAAAARDNVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGG 61

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           SS GLK FC G+G++TIDI N+SR I + E+  C + GV+DI EV IG+DGI+  S  D 
Sbjct: 62  SSSGLKRFCEGVGENTIDIANASRAIREKEVKACAEAGVTDIIEVRIGYDGIVFASQIDG 121

Query: 124 VSV-SLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
            +  +    D Y ALA  ++ D  +V NP   WSE   D P V IA ++P  KHGTREV 
Sbjct: 122 PAFTAFEPADWYNALAPKVLKDGALVDNPYTMWSEFNADLPAVEIAAFIPGTKHGTREVF 181

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
           E+KVL  GC  +     M +    +   +  AC +VR DG ++++DGDYTETLARI+ N 
Sbjct: 182 EEKVLAHGCEATGAMKAMEEA-GMDEDAIEDACIAVRTDGRSVDIDGDYTETLARIDSNA 240

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           +  G  GL+FY+NN D LK+  +  + PS  TI SG YP+SRPL FYVK+ H   + GL+
Sbjct: 241 EGVGVFGLAFYENNTDKLKVATMSDVAPSTETIASGEYPVSRPLFFYVKKAHIGVIPGLK 300

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           E+  F VSDE+  PD  L  YGL+  S+ E    +  I+
Sbjct: 301 EFAEFFVSDEIAGPDGPLANYGLV--SDPELAQTQAKIS 337


>gi|42520255|ref|NP_966170.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42409993|gb|AAS14104.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Wolbachia endosymbiont of Drosophila
           melanogaster]
          Length = 338

 Score =  237 bits (604), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 117/340 (34%), Positives = 184/340 (54%), Gaps = 6/340 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M   F+++  FV+      +   AR  IRI GSST+FP+   IAE F+  F  FKTP VE
Sbjct: 1   MLRNFLLIFVFVLFTPL--SNADARKYIRIVGSSTVFPFISFIAEEFNRVFS-FKTPVVE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G K FC GIG+DT DI  SSR + + E + CK++ ++++ E+ IG+DG+++ + 
Sbjct: 58  SIGSGSGFKMFCSGIGEDTPDITTSSRPMKEVERELCKRNKINEVIEIIIGYDGVVIANS 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                   T +DL++ L++Y   +DK+V N  K WS +    P+  I IY P    GT E
Sbjct: 118 NQSHRFDFTKKDLFETLSAYSQENDKLVKNNKKFWSNVNQALPKTEIEIYGPHQNTGTYE 177

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            L   ++ +      +  ++      + ++   AC ++R DG  IEV  +    + +++ 
Sbjct: 178 TLVNSIMLDQYSCMNS--RIFKENYKDQEERKKACGNIRDDGRYIEVGINENIIIQKLKS 235

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+KR+H ++V G
Sbjct: 236 NKNALGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPLYLYIKRKHLDTVDG 295

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           LRE+V   +    +  D  L + GLIP+S+E+ K     +
Sbjct: 296 LREFVKEIIDSIGI-EDGYLSRLGLIPLSSEDIKKASAKV 334


>gi|114765349|ref|ZP_01444466.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pelagibaca bermudensis HTCC2601]
 gi|114542329|gb|EAU45358.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Roseovarius sp. HTCC2601]
          Length = 346

 Score =  237 bits (603), Expect = 2e-60,   Method: Composition-based stats.
 Identities = 143/322 (44%), Positives = 204/322 (63%), Gaps = 5/322 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ +++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TIDI N
Sbjct: 24  RDNVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDIAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIV 143
           +SR I   E++ C  +GV+DI EV IG+DGI+  S +      +    DLY ALA  ++V
Sbjct: 83  ASRAIRAGEVETCAANGVTDIIEVRIGYDGIVFASQQTGPEFTAFEPSDLYNALAEQVLV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D ++V NP   W++   D P+V IA ++P  KHGTREV E+KVL +GC  +     M   
Sbjct: 143 DGELVANPHTTWADFNGDLPDVEIAAFIPGTKHGTREVFEEKVLLQGCEDTGAMEAMVA- 201

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC +VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK+ 
Sbjct: 202 GGMSEDDAEDACMAVRTDGKSVDIDGDYTETLARIDSNPNGIGVFGLAFYENNTDKLKVA 261

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + G+ P+  TI  G YP+SRPL FYVK+ H   + GL+EY  F V++E+  P+  L  Y
Sbjct: 262 TMSGVQPTTETIAEGEYPVSRPLFFYVKKAHIGVIPGLKEYAEFFVANEIAGPNGPLANY 321

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+  S+ E    +  ++  ++
Sbjct: 322 GLV--SDPELADTQSKVSNEET 341


>gi|295691117|ref|YP_003594810.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Caulobacter segnis ATCC 21756]
 gi|295433020|gb|ADG12192.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS, putative [Caulobacter segnis ATCC 21756]
          Length = 347

 Score =  236 bits (601), Expect = 3e-60,   Method: Composition-based stats.
 Identities = 101/346 (29%), Positives = 164/346 (47%), Gaps = 7/346 (2%)

Query: 1   MRFFFVVLMCFVVLE-VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+         V L  +       AR+ +  AGSST+FP++   AENF++     K P V
Sbjct: 1   MKKLLSCAAAAVALSGLAAAPAHAARDYVWAAGSSTVFPFATRTAENFAKK-SGKKAPKV 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES G+  G+K FC G G+   DI N+SR + ++E D C   GV DI ++ IG DGI++ +
Sbjct: 60  ESLGTGGGIKLFCGGTGEGFPDIANASRPMKKSEFDACAAKGVKDILQIKIGFDGIVVAT 119

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
           D+D    +  +E LY+ L+  ++   + V NP K W ++    P  RI +Y P    GTR
Sbjct: 120 DKDGADYNFKLEHLYQGLSKQVLKGGQFVANPNKTWDDVAGGLPGNRIQVYGPPPTSGTR 179

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   +  ++ G  +   +  +  +   N ++       +R DG  ++   +    +  + 
Sbjct: 180 DAFVELAIEAGARK---YPTLDAIRSDNEKKFKALVDPLRNDG-WVDAGENDNAIVGTLT 235

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
                 G  G S+ + N D +K   ++G+ PS  TI  G YP+SR L  YVK+ +     
Sbjct: 236 KTPGSVGVFGWSYLEENMDKIKGASVNGVRPSAQTISDGSYPLSRSLYIYVKKANIGVTP 295

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           GL E++    SD        L   GLIP+   +    +  I   K+
Sbjct: 296 GLEEFLKEFTSDAATGRGGYLQGRGLIPLPPGQHD-AQKGIVNNKT 340


>gi|262368531|ref|ZP_06061860.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter johnsonii SH046]
 gi|262316209|gb|EEY97247.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Acinetobacter johnsonii SH046]
          Length = 341

 Score =  236 bits (601), Expect = 4e-60,   Method: Composition-based stats.
 Identities = 144/345 (41%), Positives = 208/345 (60%), Gaps = 6/345 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR   + L   V       T   AR+ I+IAGSST+ PY+ I+AE F   FP+FK P V 
Sbjct: 1   MRLNHIALAVVVSGAAVATTANAARDTIQIAGSSTVLPYASIVAEEFGNTFPQFKAPVVG 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSS GLK+FC G+GD+TIDI N+SRKI   EL  CKK GV+ + E+ IG+DGI+  S+
Sbjct: 61  SGGSSGGLKQFCNGVGDNTIDIANASRKIKDTELAACKKAGVNQVIEIKIGYDGIVFASN 120

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
               +  L  + +Y ALA+ L  + K+V NP  +W++I    P   I + +P+  HGTRE
Sbjct: 121 ASKAAYKLRPQHVYAALAAQLPSNGKMVANPYTRWNQIDKSLPNEPITLVIPASNHGTRE 180

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V ++K++  GC        M      +      AC++ R+DG  IE+ GDYTETLAR++ 
Sbjct: 181 VFQEKMVDAGCETYAAIKAM------DKDAQKKACSTFRKDGKVIEIAGDYTETLARLKT 234

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +    G  GL FY  N D L++  ++ + PS  TI++G YP+SRPL FYVK +H  S+ G
Sbjct: 235 SPSAVGVFGLGFYDQNRDKLRVATVNNVAPSEKTILNGSYPVSRPLFFYVKGEHLKSIKG 294

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L+EY  + +S ++    S+L + GLI +S++ER +V  +   GK+
Sbjct: 295 LKEYTEYFISKKVSGKGSKLERAGLISMSDKERAAVLANFKAGKA 339


>gi|268680478|ref|YP_003304909.1| periplasmic phosphate binding protein [Sulfurospirillum deleyianum
           DSM 6946]
 gi|268618509|gb|ACZ12874.1| periplasmic phosphate binding protein [Sulfurospirillum deleyianum
           DSM 6946]
          Length = 346

 Score =  236 bits (600), Expect = 5e-60,   Method: Composition-based stats.
 Identities = 101/341 (29%), Positives = 166/341 (48%), Gaps = 14/341 (4%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
             +    ++       G  AR++I+I GSST++P++  +AE F        TP VES G+
Sbjct: 3   IKMSAIALLSVAALSVGANARDQIKIVGSSTVYPFTSYVAEEFKATTGN-PTPVVESTGT 61

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G+K FC G G DT D  N+SR +  +E   C ++GV+DI  + +G DGI +   +   
Sbjct: 62  GGGMKIFCSGNGLDTPDFTNASRPMKASEFKICAENGVTDITGMMVGFDGIAVAQSKTNG 121

Query: 125 SVSLTVEDLYKALASYLI--VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
           ++SLT E L+ ALA  +       ++ NP K W+EI    P  +I +Y P    GTR+  
Sbjct: 122 AISLTKEHLFLALAEEVPSKDGKSLIKNPYKTWNEIDAKLPNRKITVYGPPATSGTRDSF 181

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
           ++ V++    +   +                   ++RQDG+ +    +    + ++  + 
Sbjct: 182 DEMVMEAASKKLDAY-----------GDKKGKYKAIRQDGVFVPAGENDNLIVQKLTKDT 230

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
             FG  G SF + N D +    +DG+ P+   I SG YPISR L  Y K  H   V G+ 
Sbjct: 231 SAFGIFGYSFLEENGDKINGADVDGVAPTSENISSGKYPISRSLYIYAKNSHRGQVKGMD 290

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           E++   V  +M+     L   GL+P++ +E K V+ ++   
Sbjct: 291 EFLKLYVDAKMIGQKGVLKTIGLVPMTEDELKKVQAAVLAK 331


>gi|254420275|ref|ZP_05033999.1| hypothetical protein BBAL3_2585 [Brevundimonas sp. BAL3]
 gi|196186452|gb|EDX81428.1| hypothetical protein BBAL3_2585 [Brevundimonas sp. BAL3]
          Length = 355

 Score =  235 bits (599), Expect = 7e-60,   Method: Composition-based stats.
 Identities = 103/316 (32%), Positives = 165/316 (52%), Gaps = 5/316 (1%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I  AGSST+FP++  +AENF+        P VES G+  G++ FC+G+G +T DI N+SR
Sbjct: 35  IWSAGSSTVFPFATRVAENFARTAGGAA-PRVESLGTGGGIQAFCQGVGPNTPDIANASR 93

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV-DDK 146
            +  +E D C+K+GV+DI E+ IG DGI++ + R+    +  + DLY+ LA  +   D +
Sbjct: 94  PMKASEFDLCQKNGVTDIVEIKIGFDGIVVATARNGNGFNFELNDLYEGLAKEVPGPDGQ 153

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
            V NP K W+E+    P  RI +Y P    GTR+   +  +  G       + +    K 
Sbjct: 154 FVANPAKTWNEVNKGLPNQRIQVYGPPPTSGTRDAFLELGMTPGAKLVPAAAAVE---KA 210

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
           +  +      ++R+DG  I+   +    +  +       G  G SF + N D +K   ID
Sbjct: 211 DKDRFEALAHTLREDGAWIDSGENDNAIVQTLTRTPGSLGVFGYSFLEQNLDTVKAETID 270

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLI 326
           G+ P+  TI SG YP+SR L  YVK+ H   + GL++Y+   +S+        L   GLI
Sbjct: 271 GVTPNADTIASGEYPLSRSLFIYVKKAHIGVIPGLQQYIQEFLSEGAAGKGGYLADRGLI 330

Query: 327 PISNEERKSVRDSIAV 342
           P+  ++  + R + + 
Sbjct: 331 PLPEDQLVAQRATASA 346


>gi|254420525|ref|ZP_05034249.1| hypothetical protein BBAL3_2835 [Brevundimonas sp. BAL3]
 gi|196186702|gb|EDX81678.1| hypothetical protein BBAL3_2835 [Brevundimonas sp. BAL3]
          Length = 355

 Score =  235 bits (598), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 102/316 (32%), Positives = 166/316 (52%), Gaps = 5/316 (1%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I  AGSST+FP++  +AENF+        P VES G+  G++ FC+G+G +T DI N+SR
Sbjct: 35  IWSAGSSTVFPFATRVAENFARTAGGAA-PRVESLGTGGGIQAFCQGVGPNTPDIANASR 93

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV-DDK 146
            +  +E D C+K+GV+DI E+ IG DGI++ + R+    +  + DLY+ LA  +   D +
Sbjct: 94  PMKASEFDLCQKNGVTDIVEIKIGFDGIVVATARNGNGFNFELNDLYEGLAKEVPGPDGQ 153

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
            + NP K W+E+    P  RI +Y P    GTR+   +  +  G   +   + +    K 
Sbjct: 154 FIANPAKTWNEVNKGLPNQRIQVYGPPPTSGTRDAFLELGMTPGAKLAPAAAAVE---KA 210

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
           +  +      ++R+DG  I+   +    +  +       G  G SF + N D +K   ID
Sbjct: 211 DKDRFEALAHTLREDGAWIDSGENDNAIVQTLTRTPGSLGVFGYSFLEQNLDTVKAETID 270

Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLI 326
           G+ P+  TI SG YP+SR L  YVK+ H   + GL++Y+   +S+        L   GLI
Sbjct: 271 GVTPNADTIASGEYPLSRSLFIYVKKAHIGVIPGLQQYIQEFLSEGAAGKGGYLADRGLI 330

Query: 327 PISNEERKSVRDSIAV 342
           P+  ++  + R + + 
Sbjct: 331 PLPEDQLVAQRATASA 346


>gi|58584551|ref|YP_198124.1| ABC-type phosphate transport system, periplasmic component
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
 gi|58418867|gb|AAW70882.1| ABC-type phosphate transport system, periplasmic component
           [Wolbachia endosymbiont strain TRS of Brugia malayi]
          Length = 338

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 120/340 (35%), Positives = 188/340 (55%), Gaps = 6/340 (1%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M   F+++  F VL     +   AR  +RI GSST+FP+   IAE+F+  F  FKTP VE
Sbjct: 1   MFRSFLLIFVFTVLIPL--SNADARKYVRIVGSSTVFPFISFIAEDFNRIFS-FKTPVVE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS  G K FC GIG++T DI  SSR + + E++ CK++ V+++ EV IG+DGI++ + 
Sbjct: 58  SIGSGPGFKMFCSGIGENTPDIATSSRPVKEAEIELCKRNKVNEVVEVIIGYDGIVVANS 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                   T +DL++ L++Y   + K+V N  K WS++    P+  I IY P    GT E
Sbjct: 118 NQSHKFDFTKKDLFETLSAYSQDNGKLVKNNKKFWSDVNQTLPKTGIEIYGPHQNTGTYE 177

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            L   V+ +      +  ++      + ++   AC+++R DG  IEV  +    + +++ 
Sbjct: 178 TLVNFVMTDQYSCMNS--RIFKESYKDPEERKKACSNIRDDGRYIEVGINENIVIQKLKS 235

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK+  G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H N+V G
Sbjct: 236 NKNALGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPLYLYIKKEHLNTVDG 295

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           LRE++   + D +      L + GLIP+SNE+ K V   +
Sbjct: 296 LREFIREVI-DSISTEGGYLSRLGLIPLSNEDIKRVLAKV 334


>gi|110635450|ref|YP_675658.1| phosphate ABC transporter periplasmic substrate-binding protein
           [Mesorhizobium sp. BNC1]
 gi|110286434|gb|ABG64493.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Chelativorans sp. BNC1]
          Length = 346

 Score =  234 bits (597), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 145/326 (44%), Positives = 206/326 (63%), Gaps = 8/326 (2%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
               +R+ I+IAGSST+ P++ I+AE F   FPEFKTP V SGGSS GL++FC+G+G++T
Sbjct: 22  AAAQSRDTIQIAGSSTVLPFASIVAEEFGNAFPEFKTPVVGSGGSSGGLRQFCQGVGENT 81

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
           IDI NSSR+I  +E++ C + GV+ I E+ IG DGI+  +  D    +L    ++KA+A+
Sbjct: 82  IDIANSSRRIRASEIEACNQAGVNQILEIQIGFDGIVFATSADKGDFALEPVHVFKAVAA 141

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            + V+ ++V NP K WSEI    P+  IA+ +P+  HGTREV E+KVL  GC        
Sbjct: 142 KVPVEGEMVDNPYKSWSEIDSSLPDQPIAVAIPASNHGTREVFEEKVLHAGCE------- 194

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
             ++ +   + +  ACT++RQD + +E+ GDYTETLAR++ N D  G  GLSFY  N D 
Sbjct: 195 AAELPEMEEEAMEAACTAIRQD-VVVEIAGDYTETLARLQSNPDTVGVFGLSFYDQNRDT 253

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           LK+  + G+ PS+ TI SG YP+SRPL FYVK +H   V G+ EYV F +SD+M      
Sbjct: 254 LKVATMSGVTPSLETIASGEYPVSRPLYFYVKGEHIGQVPGIEEYVEFFMSDQMAGAGGT 313

Query: 320 LFQYGLIPISNEERKSVRDSIAVGKS 345
           L   G+IP   E+   V D+    K+
Sbjct: 314 LEGAGMIPQPEEKTAEVVDAFKERKA 339


>gi|190571623|ref|YP_001975981.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
 gi|190357895|emb|CAQ55355.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Wolbachia endosymbiont of Culex quinquefasciatus Pel]
          Length = 338

 Score =  234 bits (596), Expect = 1e-59,   Method: Composition-based stats.
 Identities = 115/337 (34%), Positives = 182/337 (54%), Gaps = 4/337 (1%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
              + + F  + +   +   AR  IRI GSST+FP+   I+E FS  F  FKTP VES G
Sbjct: 2   LKRLFLIFAFVLLIPLSNVDARRYIRIVGSSTVFPFISFISEEFSRIFS-FKTPVVESIG 60

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K FC GIG+ T DI  SSR + + E + CK++ V+++ E+ IG+DGI++ +    
Sbjct: 61  SGSGFKMFCSGIGEGTPDITTSSRPMKEVERELCKRNKVNEVIEIIIGYDGIVIANSNQS 120

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
                T  DL++ L+SY   +D++V N  K WS++    P+  I IY P    GT E L 
Sbjct: 121 HRFDFTKNDLFETLSSYSEDNDRLVKNNKKFWSDVNQALPKTEIKIYGPHQNTGTHETLI 180

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             ++ +      +  ++      + ++   AC+++R DG  IEV  +    + +++ NK+
Sbjct: 181 NFIMLDQYSCMNS--RIFKENYQDQEKRKKACSNIRDDGRYIEVGINENIIIQKLKSNKN 238

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLRE 303
             G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H ++V GLRE
Sbjct: 239 ALGIFSFSFLAKNQDEIQGSTIAGIEPTYKNISSGEYMLARPLYLYIKKEHLDTVDGLRE 298

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           ++   V D +      L + GLIP+S+E  K V + +
Sbjct: 299 FIREVV-DSISTEGGYLSRLGLIPLSSENIKKVLEKV 334


>gi|126731223|ref|ZP_01747030.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sagittula stellata E-37]
 gi|126708134|gb|EBA07193.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Sagittula stellata E-37]
          Length = 346

 Score =  234 bits (595), Expect = 2e-59,   Method: Composition-based stats.
 Identities = 146/322 (45%), Positives = 199/322 (61%), Gaps = 5/322 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ +++AGSST+ PY+ I+AE F E F +F TP VESGGSS GLK FC G+G++TIDI N
Sbjct: 23  RDNVQVAGSSTVLPYASIVAEAFGENF-DFPTPVVESGGSSAGLKRFCEGVGENTIDIAN 81

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIV 143
           +SR I + E+  C   GV+DI EV IG+DGI+  S  D  +  +    D+Y ALA  ++ 
Sbjct: 82  ASRAIREKEIAACADAGVTDIIEVRIGYDGIVFASQIDGPAFTAFEPADIYNALAPKVVK 141

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D ++V NP   WSE   D PE  I  ++P  KHGTREV E+KVL  GC  +     M D 
Sbjct: 142 DGELVDNPYTMWSEFNGDLPEAEIMAFIPGTKHGTREVFEEKVLAAGCEATGALQAMLD- 200

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC +VR DG ++++DGDYTETLA I+ N +  G  GL+FY+NN D LK+ 
Sbjct: 201 SGMSEDDAEDACIAVRTDGRSVDIDGDYTETLASIDSNSNGIGVFGLAFYENNTDKLKVA 260

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + GI P   TI SG YP+SRPL FY+K+ H   + GL+EY  F V+DE+  PD  L  Y
Sbjct: 261 TVSGIEPKTETIASGEYPVSRPLYFYIKKAHLGVIPGLKEYAEFFVADEIAGPDGPLSAY 320

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+   + E    ++ +A   +
Sbjct: 321 GLVA--DPELAQTQEKVANETT 340


>gi|94495743|ref|ZP_01302323.1| phosphate binding protein, putative [Sphingomonas sp. SKA58]
 gi|94425131|gb|EAT10152.1| phosphate binding protein, putative [Sphingomonas sp. SKA58]
          Length = 354

 Score =  232 bits (592), Expect = 4e-59,   Method: Composition-based stats.
 Identities = 103/335 (30%), Positives = 180/335 (53%), Gaps = 8/335 (2%)

Query: 8   LMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVG 67
           ++               R++IR  GSST++P++   AE F +  P  K+P +ES G+  G
Sbjct: 18  VLSLAACGDQSSGAGGTRDQIRAVGSSTVYPFATAAAELFVQSNPGVKSPIIESTGTGGG 77

Query: 68  LKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS 127
           +K FC G+G    DI ++SR++ ++E D+C+ +GV DI EV IG DG+     ++   +S
Sbjct: 78  MKLFCAGVGAQHPDIEDASRRMKKSEFDQCQANGVKDIIEVQIGVDGLAFAESKEGPGLS 137

Query: 128 LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL 187
           LT + +Y+ALA+     D    N  + W ++    P + I+++ P    GTR+ L + +L
Sbjct: 138 LTPKIVYEALAANPYGKDA---NKAQTWKDVDASLPAIPISVFGPPSTSGTRDSLAELIL 194

Query: 188 QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGF 247
           ++GC        M  + + N  +    CT +R+DG  ++   +    + ++  N +  G 
Sbjct: 195 EKGCQSDPA---MAALKEKNEDEYKATCTRIREDGKYVDSGENDNLIVQKLGANPNAVGV 251

Query: 248 VGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSF 307
            G SF + N + LK VPI+GI  +  T+ +G YP +RPL  YVK+ H  +V GL+ Y++ 
Sbjct: 252 FGFSFLEENKNTLKDVPINGIPATYDTVSTGQYPGARPLYIYVKKAHMQAVPGLQAYLNI 311

Query: 308 SVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             S+    P   L + G++P S++ RK+  +++  
Sbjct: 312 FASN--WGPGGVLAKRGMVPASDDVRKANAETVKS 344


>gi|84501122|ref|ZP_00999357.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanicola batsensis HTCC2597]
 gi|84391189|gb|EAQ03607.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanicola batsensis HTCC2597]
          Length = 346

 Score =  232 bits (592), Expect = 5e-59,   Method: Composition-based stats.
 Identities = 140/319 (43%), Positives = 203/319 (63%), Gaps = 5/319 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+++++AGSST+ PY+ I+AE F E   ++ TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDQVQVAGSSTVLPYASIVAELFGE-NTDYPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIV 143
           +SR I + E+  C  +GV+DI EV IG+DGI+  S +   +  +    D++ A+ + ++V
Sbjct: 83  ASRAIREKEVAACADNGVTDIIEVRIGYDGIVFASQQSGPAFTAFEPTDIFNAIGAQVLV 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D ++V NP   W+E   + P+  IA+++P  KHGTREV E+KVL  GC  +     M D 
Sbjct: 143 DGEIVDNPYNTWAEFNSELPDTEIAMFIPGTKHGTREVFEEKVLLIGCEETGAMQAMID- 201

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC  VRQDG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK+ 
Sbjct: 202 GGMSEDDAEDACLDVRQDGKSVDIDGDYTETLARIDANTNGIGVFGLAFYENNTDKLKVA 261

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            + G+ PS  TI SG YP+SRPL FYVK+ H   + GL+EY  F V+DE+  P   L  Y
Sbjct: 262 TMSGVSPSTETIASGEYPVSRPLFFYVKKAHIGVIPGLKEYAQFFVADEIAGPGGPLSNY 321

Query: 324 GLIPISNEERKSVRDSIAV 342
           GL+   + E    ++ +A 
Sbjct: 322 GLVA--DPELAETQNMVAN 338


>gi|260574719|ref|ZP_05842722.1| phosphate ABC transporter, periplasmic binding protein [Rhodobacter
           sp. SW2]
 gi|259023136|gb|EEW26429.1| phosphate ABC transporter, periplasmic binding protein [Rhodobacter
           sp. SW2]
          Length = 352

 Score =  232 bits (590), Expect = 8e-59,   Method: Composition-based stats.
 Identities = 120/342 (35%), Positives = 186/342 (54%), Gaps = 5/342 (1%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
             +    + +     T   AR+++R+ GSST+FPY++  AENF+        P VES G+
Sbjct: 4   MKLAASVLTIAAVSATAAAARDQVRVVGSSTVFPYAQAAAENFANAT-GMAAPVVESTGT 62

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD-M 123
             G+K FC GIG+   D+ N+SR + ++E + C K+GV+DI EV +G+DG+ L   RD  
Sbjct: 63  GGGMKIFCEGIGEGFADVTNASRAMKKSEYELCAKNGVTDITEVMLGYDGLTLAVSRDST 122

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
            + +LT + +Y+ALA+ + VD K V NP KKWSEI P  P+V I  Y P    GTR+   
Sbjct: 123 YAWALTEKQIYQALAAEVDVDGKWVANPYKKWSEIDPSLPDVAIIAYGPPPTSGTRDAFV 182

Query: 184 KKVLQEGCVRSRNFSKMR--DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
           +  + +GC +      M+     +   + ++ +C+ +RQDG  +E   +    + RIE +
Sbjct: 183 ELAMHDGCKQLDYVKAMKETASKEDYDKFITDSCSRMRQDGPFVEAGENDNLIVQRIEAD 242

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL 301
               G  G SF   N D LK +P+DG+ P+  TI    Y ++RPL  Y+K  H   + GL
Sbjct: 243 PTAVGIFGYSFLFENGDKLKGIPVDGVEPTAETIADFSYGVARPLFIYIKNAHRGVIPGL 302

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
            E+V   VSD  M     + + GL P+  E+    + ++A G
Sbjct: 303 NEFVEEFVSDAAMGDGGYMQERGLTPLDAEKLA-AQQAVATG 343


>gi|85375200|ref|YP_459262.1| phosphate binding protein, putative [Erythrobacter litoralis
           HTCC2594]
 gi|84788283|gb|ABC64465.1| phosphate binding protein, putative [Erythrobacter litoralis
           HTCC2594]
          Length = 350

 Score =  231 bits (589), Expect = 1e-58,   Method: Composition-based stats.
 Identities = 102/344 (29%), Positives = 182/344 (52%), Gaps = 14/344 (4%)

Query: 1   MRFFFVVLMCFVVLEVYC-----GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFK 55
           M+    + +              G+ +  R+ IR  GSST++P++K++AENF+   PEF 
Sbjct: 1   MKMIKNIALVATASLALAACGDTGSSSGTRDSIRAVGSSTVYPFAKLVAENFARNHPEFG 60

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
           +P +ES G+  G+  FC G+G  T D+ N+SR++  +E D C+++GV+DI E+ +G DGI
Sbjct: 61  SPLIESTGTGGGVALFCSGVGPSTPDMANASRRMKDSEFDTCQENGVTDIIELQVGLDGI 120

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
              S +  + ++LT + +Y+A+A+     ++      + WS++ P  P++ I +Y P   
Sbjct: 121 AFASAQGGIDMNLTPDIVYRAIAANPYGKEQ----TNETWSDVDPSLPDLPILVYGPPST 176

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GTR+ L++ VL+  C   +  ++M  + + +       CT VR DG  ++        +
Sbjct: 177 SGTRDALKELVLEAAC---KENAEMEALKESDEDAYDRTCTEVRSDGKYVDQGEQDNLIV 233

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHF 295
            +I+ N +  G  G S+ + NAD ++ + ++G+ P+   I S  YP +RPL  YVK+ H 
Sbjct: 234 QKIQGNPNAVGIFGYSYLEENADKVQGLSMNGVEPTYENIASFAYPGARPLYVYVKKAHV 293

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           +++ GL EY+    +  M      L   GL+    +ER      
Sbjct: 294 DAIPGLAEYLEQWTT--MWDKGGPLASIGLVATPEDERALNLQK 335


>gi|329888515|ref|ZP_08267113.1| protein sphX [Brevundimonas diminuta ATCC 11568]
 gi|328847071|gb|EGF96633.1| protein sphX [Brevundimonas diminuta ATCC 11568]
          Length = 358

 Score =  230 bits (586), Expect = 2e-58,   Method: Composition-based stats.
 Identities = 105/329 (31%), Positives = 162/329 (49%), Gaps = 4/329 (1%)

Query: 15  EVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRG 74
                    AR  I  AGSST+FP++  +AE F+        P VES G+  G++ FC G
Sbjct: 25  GGGAPGSQKARTGIWAAGSSTVFPFATRVAETFARNGGGGSAPRVESLGTGGGIQAFCSG 84

Query: 75  IGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLY 134
           +G  T DI N+SR + Q+E D C ++GV+DI E+ IG+DGI++ + R   S +L + DLY
Sbjct: 85  VGPSTPDIANASRPMKQSEFDRCVENGVTDIVEIKIGYDGIVVATARTGQSFNLELNDLY 144

Query: 135 KALASYLIV-DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVR 193
           +ALA      D ++  N  K W+E+    P  RI +Y P    GTR+   +  +  G   
Sbjct: 145 EALAKETPGADGQLGPNAAKTWNEVNKALPATRIQVYGPPPTSGTRDAFLELGMAPGAKL 204

Query: 194 SRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFY 253
               + +    K +  +      ++R+DG  I+   +    +  +       G  G SF 
Sbjct: 205 IPAVAAIE---KQDKTRFETVAHTLREDGAWIDSGENDNAIVQTLNRTPGSLGVFGFSFL 261

Query: 254 KNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
           + N D +K   IDG+ PS+ TI  G YP++R L  YVK+ H     GL ++V   +SD  
Sbjct: 262 EQNMDTVKAETIDGVAPSVATIADGSYPLARSLYIYVKKAHIGVTPGLEQFVQEFMSDGS 321

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIAV 342
                 L   GL+P+  +E  + R   + 
Sbjct: 322 AGRGGYLQDRGLVPLVADELAAERAKASA 350


>gi|149184837|ref|ZP_01863155.1| phosphate binding protein, putative [Erythrobacter sp. SD-21]
 gi|148832157|gb|EDL50590.1| phosphate binding protein, putative [Erythrobacter sp. SD-21]
          Length = 349

 Score =  228 bits (581), Expect = 8e-58,   Method: Composition-based stats.
 Identities = 100/324 (30%), Positives = 189/324 (58%), Gaps = 9/324 (2%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
             G  +R++I+  GSST++P++K ++E F+   P+FK+P +ES G+  G+K FC G+G +
Sbjct: 25  AGGGASRDQIKAVGSSTVYPFAKAVSETFTRSNPDFKSPIIESTGTGGGMKLFCAGVGAE 84

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
           T DI N+SR++  +E + C+++GV+D+ E+ +G DGI L S +  ++++LT + +Y+A+A
Sbjct: 85  TPDIANASRRMKASEFETCQQNGVTDVIEIQVGLDGIALASAKGGITMNLTPKMVYEAIA 144

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
           +    +++      +KWS++    P+V I +Y P    GTR+ L++ +L+ GC  +   +
Sbjct: 145 ARPYGEEQ----TNQKWSDVDSSLPDVDILVYGPPSTSGTRDALKELILEVGCDTN---A 197

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
           +M+ +   +  Q +  CT VR DG  ++        + +IE N +  G  G S+ + NAD
Sbjct: 198 EMKALKDSDEDQHAQLCTEVRSDGAYVDQGEQDNLIVQKIEGNPNAVGIFGYSYLEENAD 257

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
            ++ + ++G+ P+   I S  YP +RPL  YVK+ H +++ GL+E++    +  M   D 
Sbjct: 258 KVQGLNMNGVAPTYENIASFEYPGARPLYVYVKKAHLDAIPGLKEFLGQWTT--MWNRDG 315

Query: 319 QLFQYGLIPISNEERKSVRDSIAV 342
           +L + GL+   ++       +   
Sbjct: 316 ELAKIGLVANPDDVMARSMSAATN 339


>gi|254509599|ref|ZP_05121666.1| putative phosphate ABC transporter periplasmic phosphate-binding
           protein [Rhodobacteraceae bacterium KLH11]
 gi|221533310|gb|EEE36298.1| putative phosphate ABC transporter periplasmic phosphate-binding
           protein [Rhodobacteraceae bacterium KLH11]
          Length = 346

 Score =  228 bits (581), Expect = 9e-58,   Method: Composition-based stats.
 Identities = 141/322 (43%), Positives = 196/322 (60%), Gaps = 5/322 (1%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R+ +++AGSST+ PY+ I+AE F E   +F TP VESGGSS GLK FC G+G++TID+ N
Sbjct: 24  RDNVQVAGSSTVLPYASIVAELFGE-NTDFPTPVVESGGSSAGLKRFCEGVGENTIDVAN 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIV 143
           +SR I + E+  C ++GV+DI EV IG+DGI+  S +   +  +    D+Y A+ S ++ 
Sbjct: 83  ASRAIREKEIKACAENGVTDIMEVRIGYDGIVFASQQAGPAFTAFQPADIYNAIGSKVMK 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
           D  +V N    W+E   D P+V IA+++P  KHGTREV E KVL  GC  +     M   
Sbjct: 143 DGALVDNSYNSWAEFNGDLPDVEIAMFIPGTKHGTREVFEDKVLLAGCESTGAMEAMIA- 201

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              +      AC  VR DG ++++DGDYTETLARI+ N +  G  GL+FY+NN D LK+ 
Sbjct: 202 GGMSEDDAEDACLDVRADGKSVDIDGDYTETLARIDTNPNGIGVFGLAFYENNTDKLKVA 261

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            +  I PS  TI SG YP+SRPL FYVK+ H   + GL+EY  F   DE+      L  Y
Sbjct: 262 TMGDIAPSTETIASGEYPVSRPLFFYVKKAHIGVIPGLKEYAQFFTHDEIAGGSGPLANY 321

Query: 324 GLIPISNEERKSVRDSIAVGKS 345
           GL+   + E    +D+IA   +
Sbjct: 322 GLVA--DPELAKTQDAIANEVT 341


>gi|85710043|ref|ZP_01041108.1| phosphate ABC transporter, periplasmic binding protein-like
           [Erythrobacter sp. NAP1]
 gi|85688753|gb|EAQ28757.1| phosphate ABC transporter, periplasmic binding protein-like
           [Erythrobacter sp. NAP1]
          Length = 360

 Score =  227 bits (579), Expect = 1e-57,   Method: Composition-based stats.
 Identities = 104/340 (30%), Positives = 176/340 (51%), Gaps = 9/340 (2%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++ +  + L      G  AR+ IR  GSST++P++K +AENF+   PE K+P +ES GS 
Sbjct: 10  LLGIAAITLSACDAGGGGARDSIRAVGSSTVYPFAKQVAENFARSNPELKSPLIESTGSG 69

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G++ FC G+G DT D+VN+SR++  +E D C+ + V DI E+ +G DGI   S    + 
Sbjct: 70  NGIQLFCSGLGADTPDMVNASRRMKSSEFDRCQANNVQDIIELQVGLDGIAFASKNGGIE 129

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
           ++L+ + +Y+ALA+     ++      + WS++ P  P+  I +Y P    GTR+ L++ 
Sbjct: 130 LNLSPKIVYEALAARPYGGEQ----TTQLWSDVDPSLPDDPILVYGPPSTSGTRDALKEL 185

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           VL+ GC  +    +M+ + + +       CT VR DG  ++        + +IE N    
Sbjct: 186 VLEVGCDTNP---EMKALKEEDKDLHLQLCTEVRSDGAYVDQGEQDNLIVQKIESNPRAV 242

Query: 246 GFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYV 305
           G  G S+   N D +  +P++G+ P+   I +  YP +RPL  YVK+ H  ++ GL  ++
Sbjct: 243 GIFGFSYLDENTDKVTGLPMNGVDPTYENISNFAYPGARPLYVYVKKAHMRAIPGLDLFL 302

Query: 306 SFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
              V +     D  L   GL+     E       +    +
Sbjct: 303 QEWVKN--WKVDGPLAAIGLVASPPAEMAMNERRVNELLT 340


>gi|222474892|ref|YP_002563307.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. Florida]
 gi|255002864|ref|ZP_05277828.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. Puerto Rico]
 gi|255003995|ref|ZP_05278796.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. Virginia]
 gi|222419028|gb|ACM49051.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. Florida]
          Length = 338

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 113/348 (32%), Positives = 177/348 (50%), Gaps = 12/348 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M  + +  + FV L +  G      ++IR+ GSST+FP+   +AE F   F  ++TP +E
Sbjct: 1   MGLWGLSFVAFVALALGAG-----ADQIRVVGSSTVFPFISSVAEEFGR-FSAYRTPVIE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS +G   FC G   DT DI  SSR+I   E++ C  +GV D+ E+ +G+DGI++ S 
Sbjct: 55  SVGSGMGFNMFCAGSSSDTPDIAMSSRRIKDAEVELCGMNGVKDMIEIGLGYDGIVVAST 114

Query: 121 RDMVSVSLTVEDLYKALASYL--IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           +    V  ++ DL+ AL+ Y       KV  N    WSE+RP  PE  I IY P    GT
Sbjct: 115 KQKEEVDFSLVDLFGALSKYSLSDEYGKVPLNKHSMWSEVRPGLPEHEIEIYGPHKNTGT 174

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
            ++L    +   C+ ++NF         + ++    C+S+R DG  IEV       + +I
Sbjct: 175 YDILVDTAISGVCMSAKNFVD----SYPDWEERKRVCSSIRNDGKYIEVATSENVVIHKI 230

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
             N + FG +  SF   N   ++   + G+ PS  TI SG Y +SRP+  YVK++H ++ 
Sbjct: 231 SKNSNAFGILSFSFLVKNQGEIQGNKVAGVAPSYDTISSGKYVLSRPIYIYVKKEHLDTT 290

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            GLRE+V   +  E +     L   G +P+  E+ +     +    +G
Sbjct: 291 PGLREFVKEVMRPESIGSSGYLVNLGFVPLQKEQLEQTSQRVNELLAG 338


>gi|88607657|ref|YP_505607.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Anaplasma phagocytophilum HZ]
 gi|88598720|gb|ABD44190.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Anaplasma phagocytophilum HZ]
          Length = 339

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 116/343 (33%), Positives = 177/343 (51%), Gaps = 14/343 (4%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           RF F +    + LEV         + IR+ GSS++FP+   IAE F   F  ++TP +ES
Sbjct: 5   RFVFFLACALISLEVRA-------DHIRVVGSSSVFPFISSIAEEFGR-FSSYRTPVIES 56

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            GS +G   FC G    T D+  SSRKI   EL  C  +GV D+ E+ +G+DGI++ S R
Sbjct: 57  VGSGMGFNMFCAGANPGTPDVAMSSRKIKDAELALCASNGVHDVIEIGLGYDGIVIASSR 116

Query: 122 DMVSVSLTVEDLYKALASY--LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
               + L ++DLY AL+ Y       ++  N   KWSEIR D PE  I +Y P    GT 
Sbjct: 117 QKAQIDLRLKDLYSALSKYSLTDEYGQIPMNKYGKWSEIRSDLPEHDIEVYGPHKNAGTY 176

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           ++L   V++  CV ++NF         +V++    C+ +R DG  IEV       + ++ 
Sbjct: 177 DILLDYVVRAVCVSAKNFVDTYH----DVEERKSICSEIRNDGKYIEVATSENVIIQKVS 232

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            N   FG +  SF   N + ++   + G+ P+  TI SG Y +SRP+  YVK++H N+  
Sbjct: 233 KNSSAFGILSFSFLIKNQNEVQGNKVAGVEPTYETIASGKYVLSRPMYIYVKKEHLNTTA 292

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           GLRE++   +  E +     L   G IP++ E+ +  R  +  
Sbjct: 293 GLREFIKEVLRPESIGSGGYLVNLGFIPLTEEKLQETRSVVEK 335


>gi|114799207|ref|YP_761667.1| putative phosphate ABC transporter periplasmic phosphate-binding
           protein [Hyphomonas neptunium ATCC 15444]
 gi|114739381|gb|ABI77506.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Hyphomonas neptunium ATCC 15444]
          Length = 365

 Score =  226 bits (576), Expect = 3e-57,   Method: Composition-based stats.
 Identities = 105/357 (29%), Positives = 171/357 (47%), Gaps = 23/357 (6%)

Query: 1   MRFFFVVLMCFVVLEVYCGT-----------------GTFARNR-IRIAGSSTLFPYSKI 42
           M      L+   +L V                        ARN+ I+I GSST+ P+S+ 
Sbjct: 1   MLTRLSCLLGAALLLVSACGQSELSQIDTGEPGVKPVPAIARNQKIKIVGSSTVAPFSRT 60

Query: 43  IAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV 102
           +AE F      F TP VE+ G+  G K FC G+G  +  I N+SR +  +E + C K GV
Sbjct: 61  VAERFGAV-SGFPTPIVETTGTGGGFKAFCEGVGPVSPSIANASRPMKDSERELCAKAGV 119

Query: 103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD-DKVVFNPLKKWSEIRPD 161
             I EV +G+DGI++ + +      LT E LY ALA  +       + NP K W ++ PD
Sbjct: 120 KAITEVALGYDGIVVANSKLGPDFDLTKEQLYLALAKEIPDGKGGFMPNPHKNWQDVSPD 179

Query: 162 FPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQD 221
            P   I +  P    GTR+   +  +++G        +++ + + +    +    +VR D
Sbjct: 180 LPNGPIVVLGPPPTSGTRDAFVELGMEKGAE---AIPQLKALKESDGDAFAERAHTVRTD 236

Query: 222 GIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYP 281
           G+ ++   + +  +  +  + +  G +G SF + N D +K   + G+  S   IVSG Y 
Sbjct: 237 GVWVDFGENDSAIVQSLVKSPEAIGVLGFSFLEQNGDRVKGARLAGVEASFDNIVSGDYG 296

Query: 282 ISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRD 338
           ++R + FYVK Q+   V GL E+VS SV +     D  L + GLIP+   + ++ + 
Sbjct: 297 LARIMFFYVKDQNLPLVEGLAEFVSASVDEGAAGNDGYLIEKGLIPLPEADLETQQA 353


>gi|294012872|ref|YP_003546332.1| phosphate transport system substrate-binding protein [Sphingobium
           japonicum UT26S]
 gi|292676202|dbj|BAI97720.1| phosphate transport system substrate-binding protein [Sphingobium
           japonicum UT26S]
          Length = 350

 Score =  226 bits (574), Expect = 5e-57,   Method: Composition-based stats.
 Identities = 97/318 (30%), Positives = 173/318 (54%), Gaps = 8/318 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++IR  GSST++P++  IAE F +  P  K+P VES G+  G+K FC+G+G    DI N
Sbjct: 31  RDQIRAVGSSTVYPFATAIAEMFVQGNPGMKSPIVESTGTGGGMKLFCQGVGAQHPDIAN 90

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR++ ++E ++C+K+GV+DI E+ IG DG+     ++   + LT   +Y+ALA+     
Sbjct: 91  ASRRMKKSEFEDCRKNGVTDIVEIQIGVDGLAFAESKNGPGLKLTPRIVYEALAANPYGK 150

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                N  + W ++ P  P   I+++ P    GTR+ L + +L +GC        M+ + 
Sbjct: 151 G---PNKAQSWKDVDPSLPATPISVFGPPSTSGTRDSLAELILTKGCESDPA---MKALK 204

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           + +  +    CT +R+DG  ++   +    + ++  N +  G  G SF + N D LK V 
Sbjct: 205 EKSEDEFKATCTRIREDGKYVDSGENDNLIVQKLGANPNALGVFGYSFLEENKDRLKDVS 264

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           I+G+  +  T+ +  YP +RPL  YVK+ H  ++ GL+ Y+    ++    P+  L + G
Sbjct: 265 INGVEATYETVSTSQYPGARPLYIYVKKAHMQAIPGLQAYLDTFAAN--WDPNGALTRRG 322

Query: 325 LIPISNEERKSVRDSIAV 342
           ++    + RK+   ++  
Sbjct: 323 MVAAPEDVRKASAATVKS 340


>gi|307294608|ref|ZP_07574450.1| phosphate transport system substrate-binding protein [Sphingobium
           chlorophenolicum L-1]
 gi|306879082|gb|EFN10300.1| phosphate transport system substrate-binding protein [Sphingobium
           chlorophenolicum L-1]
          Length = 351

 Score =  225 bits (572), Expect = 8e-57,   Method: Composition-based stats.
 Identities = 98/318 (30%), Positives = 175/318 (55%), Gaps = 8/318 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++IR  GSST++P++  IAE F    P  K+P +ES G+  G+K FC+G+G    DI N
Sbjct: 32  RDQIRAVGSSTVYPFATAIAEMFVASNPGMKSPIIESTGTGGGMKLFCQGVGAQFPDIAN 91

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR+I ++E ++C+K+GV DI E+ +G DG+     +    + LT + +Y+ALA+     
Sbjct: 92  ASRRIKKSEFEDCQKNGVKDIIEIQVGVDGLAFAESKSGPGLKLTPKIVYEALAANPYGK 151

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                N  + W ++ P  P   I+++ P    GTR+ L + +L +GC        M+ + 
Sbjct: 152 G---PNKAQSWKDVDPSLPATPISVFGPPSTSGTRDSLAELILTKGCETDPA---MKALK 205

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
           + +  +    CT VR+DG  ++   +    + ++  N +  G  G SF + N D+LK V 
Sbjct: 206 EKSEDEFKATCTRVREDGKYVDSGENDNLIVQKLGANPNALGVFGYSFLEENKDMLKDVS 265

Query: 265 IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           I+G+  +  T+ +G YP +RPL  YVK+ H  ++ GL+ Y++   ++    P+  L + G
Sbjct: 266 INGVEATYETVSTGQYPGARPLYIYVKKAHMQAIPGLQAYLAAFAAN--WNPNGALTKRG 323

Query: 325 LIPISNEERKSVRDSIAV 342
           ++    + RK+  +++  
Sbjct: 324 MVAAPEDVRKASTETVKS 341


>gi|296282171|ref|ZP_06860169.1| phosphate binding protein, putative [Citromicrobium bathyomarinum
           JL354]
          Length = 369

 Score =  225 bits (572), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 101/326 (30%), Positives = 173/326 (53%), Gaps = 9/326 (2%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
             C +    R  IR  GSST++P++K+++E+FS   P  ++P +ES GS  G+  FC+G+
Sbjct: 18  TGCDSSGGTRESIRAVGSSTVYPFAKLVSESFSRSNPGMRSPLIESTGSGGGIALFCKGV 77

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
           G DT D+ N+SR++  +E + C+ +GV+DI E+ +G DGI   S +  + ++LT E +YK
Sbjct: 78  GADTPDMANASRRMKVSEFETCQSNGVNDITEIQVGLDGIAFASAQGGIMMNLTPEIVYK 137

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
           ALA+     ++      + W+++ P  P   I +Y P    GTR+ L++ VL  GC    
Sbjct: 138 ALAANPYGKEQ----TNETWADVDPSLPATPILVYGPPSTSGTRDALKELVLTAGCETDP 193

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
               ++D    +       CT VR DG  ++        + +I+ NK+  G  G S+ + 
Sbjct: 194 AMEALKD---SDEDAFERTCTEVRSDGKYVDQGEQDNLIVQKIQGNKNAVGIFGYSYLEE 250

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           N   ++ +P++G+ P+   I S  YP +RPL  YVK  H  ++ GL+ Y+   +  +M  
Sbjct: 251 NEGKVQGLPMNGVEPTYDNIASFKYPGARPLYIYVKLAHLQAIPGLQAYLDQWM--DMWD 308

Query: 316 PDSQLFQYGLIPISNEERKSVRDSIA 341
            D  L + GL+ +     + +   I 
Sbjct: 309 RDGPLAKIGLVALPAGTMEEMASRIK 334


>gi|296535818|ref|ZP_06897979.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Roseomonas cervicalis ATCC 49957]
 gi|296263886|gb|EFH10350.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Roseomonas cervicalis ATCC 49957]
          Length = 374

 Score =  224 bits (571), Expect = 1e-56,   Method: Composition-based stats.
 Identities = 101/343 (29%), Positives = 171/343 (49%), Gaps = 7/343 (2%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           R   +V      L V        R   ++ GSST+ P+S+ +AE   +     +   V S
Sbjct: 29  RLLALVGTAAAFLGVAASAQAQTREVTQVTGSSTVAPFSRAVAEAVGKAAGGERVR-VAS 87

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            G+  G  +FCR  G  + D+ ++SR+IT  E   C ++G+++I E+ IG DGI++   +
Sbjct: 88  TGTVHGFAQFCRSNGLGSPDVQDASRRITSGEFTLCLRNGINEIMEIPIGFDGIVVAHRK 147

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
            + S + T+  L+  +A  +  D ++V NP   W +I PD P+  I +  P    GTR+ 
Sbjct: 148 GLASPNFTLAQLWLGVAKEVPRDGRLVPNPYTSWRQISPDLPDWPIRVIGPPPTSGTRDS 207

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI-EV 240
             +  +  GC  +     +      +  + S  CTSVR+DG   +   D    +A+I + 
Sbjct: 208 FTELAMMAGCQAAPEVQAI-----ADAAERSRVCTSVREDGRWTDAGEDDQAIVAKIADG 262

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
                G  G SF +   D ++   + GI  +  TI SG YP+SRPL  YVKR + + V G
Sbjct: 263 ADGTLGIFGFSFLEAARDRIEGSMVGGIDDTAETISSGRYPLSRPLFLYVKRPNIDRVPG 322

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           L+E+++  VSD  +  D  L + GL+P   +  ++++D++   
Sbjct: 323 LKEFLAEYVSDRALGQDGYLARIGLVPPPADRLRAIQDAVRER 365


>gi|57238885|ref|YP_180021.1| putative protein sphX precursor [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578814|ref|YP_197026.1| putative protein sphX precursor [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58616873|ref|YP_196072.1| putative protein sphX precursor [Ehrlichia ruminantium str. Gardel]
 gi|57160964|emb|CAH57870.1| putative exported protein [Ehrlichia ruminantium str. Welgevonden]
 gi|58416485|emb|CAI27598.1| Putative protein sphX precursor [Ehrlichia ruminantium str. Gardel]
 gi|58417440|emb|CAI26644.1| Putative protein sphX precursor [Ehrlichia ruminantium str.
           Welgevonden]
          Length = 342

 Score =  222 bits (565), Expect = 6e-56,   Method: Composition-based stats.
 Identities = 109/323 (33%), Positives = 176/323 (54%), Gaps = 8/323 (2%)

Query: 23  FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
                I + GSST FP+   IAE F   F ++ TP +ES GS +G   FC+G+ + T DI
Sbjct: 19  SNAEHIHVVGSSTAFPFIAAIAEEFGR-FSDYGTPIIESVGSGMGFSMFCQGVENSTPDI 77

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI 142
             SSRKI   E++ CK + V DI E+ IG+DGI++ +  +   +  T +DL+KAL+ Y  
Sbjct: 78  AMSSRKIKDAEVELCKSNDVHDIIEIIIGYDGIVIANSNNSNKLDFTKKDLFKALSKYAT 137

Query: 143 VDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            ++    +  N  K WSEI   FP + I +Y P    GT  +L ++++Q+ C+  +NF +
Sbjct: 138 SEEYTHSIPANDFKYWSEINNRFPNIDIEVYGPYKNTGTYNILIEEIMQDSCMNHKNFIE 197

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           +      ++++   AC+ +R DG  IEV  +    + +I  N   FG    SF   N D 
Sbjct: 198 VY----PDLKKRQHACSMIRNDGKYIEVAANENIIIQKIAKNNAAFGIFSFSFLIQNQDK 253

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           +    I G+ P+  TI SG Y +SRP+  Y+K++H N+  GL+E++   +  E +  +  
Sbjct: 254 IHGNKIAGVEPTYETISSGKYILSRPIYVYIKQKHLNNSPGLKEFIKVILKQESIGKNGY 313

Query: 320 LFQYGLIPISNEERKSVRDSIAV 342
           L   G IP+S+++ ++ R  I  
Sbjct: 314 LISLGFIPLSDKDLENTRTRITN 336


>gi|332184993|ref|ZP_08386742.1| putative lipoprotein [Sphingomonas sp. S17]
 gi|332014717|gb|EGI56773.1| putative lipoprotein [Sphingomonas sp. S17]
          Length = 348

 Score =  221 bits (563), Expect = 1e-55,   Method: Composition-based stats.
 Identities = 103/323 (31%), Positives = 165/323 (51%), Gaps = 8/323 (2%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
           G G   R++I   GSST++P++ IIAE F    PE K P +ES G+  G+K FC GIG  
Sbjct: 22  GGGAGVRDQITAVGSSTVYPFTTIIAERFVAADPEAKAPVIESTGTGAGMKLFCAGIGAG 81

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
             DI N+SR++  +E  +C  HGV  + EV IG DGI     +    ++LT  D+Y+ALA
Sbjct: 82  HPDIENASRRMKASEYRDCASHGVKALLEVQIGIDGIAFAVSKRGPRMALTTADIYRALA 141

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
           +          N  + W ++ P  P + I +Y P    GTR+ L + ++  GC       
Sbjct: 142 ARPGGQ----PNNARTWRDVNPALPAIPIQVYGPPATSGTRDALAELIMAHGCDAVE--P 195

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
           +  ++ K + +   + CT VR++G  I+   +    + +++ N +  G  G S+ + N  
Sbjct: 196 EAAELAKRDPEAHHLMCTRVRENGAYIDAGENDNLIVQKLQSNPNAIGIFGYSYLEENRH 255

Query: 259 VLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
           ++  V I+G+ PS   I    YP SRPL  YVK+ H +++ GLR+++   +  +      
Sbjct: 256 IVDGVAINGVAPSYQAIAEDRYPGSRPLYVYVKKAHLDAIPGLRQFL--ILYADNWGQKG 313

Query: 319 QLFQYGLIPISNEERKSVRDSIA 341
            L + GLI      +   R  IA
Sbjct: 314 PLVRRGLIASPPAIQARSRAIIA 336


>gi|83859248|ref|ZP_00952769.1| phosphate ABC transporter-like protein, periplasmic binding protein
           [Oceanicaulis alexandrii HTCC2633]
 gi|83852695|gb|EAP90548.1| phosphate ABC transporter-like protein, periplasmic binding protein
           [Oceanicaulis alexandrii HTCC2633]
          Length = 405

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 97/353 (27%), Positives = 158/353 (44%), Gaps = 33/353 (9%)

Query: 15  EVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRG 74
               G G   R  +R+ GSST+FP++  +AENF      F TP VES G+  G+  FC G
Sbjct: 45  SANLGAGVGGREGLRMVGSSTVFPFATAVAENFGAK-SAFPTPVVESTGTGGGMNLFCAG 103

Query: 75  IGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLY 134
           +G    D+  +SR I   E   C+ +GV  I E+ IG+DGI+L +     ++ +    L+
Sbjct: 104 VGLGFPDLTGASRPIKATEYQLCQDNGVVAITEIPIGYDGIVLGNSVVSDAMDIERVQLF 163

Query: 135 KALASYLIV-----------------------------DDKVVFNPLKKWSEIRPDFPEV 165
            AL +   +                              D  + NP ++WS+I  + P  
Sbjct: 164 LALVAETPMPVDAEGRPLFDGRGEISEGRNYGEIAGFSCDSFITNPFQRWSDISAELPSQ 223

Query: 166 RIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI 225
           RI ++ P    GTR+   +  + EG     +   + ++   +        + +R+DG  +
Sbjct: 224 RIEVFGPPPTSGTRDAFVELDMIEGAQ---HVPCLDELSDTDAHMFERLASRIREDGAWV 280

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRP 285
           +   +    +  +  +   FG  G SF + N D ++   IDGI P+   I +G+YP SR 
Sbjct: 281 DAGENDNTIVQTLANSPSAFGIFGYSFLEQNGDRIQAARIDGIEPTYENISNGVYPGSRS 340

Query: 286 LLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRD 338
           L  YVK QH     GL+ +V    S++   P   L + GLI +    R+   +
Sbjct: 341 LFVYVKNQHDGVAPGLQAFVEELTSEDAWGPFGYLAERGLIALPEARRQQAAE 393


>gi|283956026|ref|ZP_06373515.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 1336]
 gi|283792502|gb|EFC31282.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 1336]
          Length = 331

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 98/344 (28%), Positives = 176/344 (51%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+     ++   V          A + ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKK----ILSLSVASFALCGALNAAD-LKIAGSSTVYPFTSFVAEEYASI-KNTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGIMIGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TIEELVMSDVSKKIPEY--------------KGEYKTLRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF  +N+D + +  IDG+ PS   I    Y ++R L  Y+      +   
Sbjct: 217 DKDAFGIFGYSFLVSNSDKINVATIDGVTPSEENIADEKYELARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             ++    +SD++     +L + GLIP+S+++ K+ +  I   K
Sbjct: 275 AFDFAKIYMSDDLAKSGGELEKIGLIPLSDDKLKASQKHIEDRK 318


>gi|86153532|ref|ZP_01071736.1| periplasmic phosphate binding protein [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|157414895|ref|YP_001482151.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|85843258|gb|EAQ60469.1| periplasmic phosphate binding protein [Campylobacter jejuni subsp.
           jejuni HB93-13]
 gi|157385859|gb|ABV52174.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 81116]
 gi|284925874|gb|ADC28226.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni IA3902]
 gi|307747533|gb|ADN90803.1| Phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni M1]
 gi|315931814|gb|EFV10769.1| phosphate binding family protein [Campylobacter jejuni subsp.
           jejuni 327]
          Length = 331

 Score =  220 bits (559), Expect = 3e-55,   Method: Composition-based stats.
 Identities = 97/344 (28%), Positives = 176/344 (51%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  + L      G      ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKKILSLSVASLAL-----CGALNAADLKIAGSSTVYPFTSFVAEEYASI-KNTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGIMIGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TIEELVMSDVSKKIPEY--------------KGEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+      +   
Sbjct: 217 DKDAFGIFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             E+    +SD++     +L + GL+P+S+++ K+ +  +   K
Sbjct: 275 AFEFAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRK 318


>gi|301063523|ref|ZP_07204055.1| phosphate ABC transporter, periplasmic phosphate-binding family
           protein [delta proteobacterium NaphS2]
 gi|300442462|gb|EFK06695.1| phosphate ABC transporter, periplasmic phosphate-binding family
           protein [delta proteobacterium NaphS2]
          Length = 342

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 93/339 (27%), Positives = 168/339 (49%), Gaps = 8/339 (2%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR     L+    + V C     AR++IRI GS+++ P+ +IIAENFS +  +F  P +E
Sbjct: 1   MRHLMRNLIIAGAVFVLCIGSAHARDQIRIVGSNSVLPFMQIIAENFS-HHWDFPPPSIE 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G + F  G+     DIV + R +T++E   C+KHGV  + E+ IG D ++L + 
Sbjct: 60  DTGTGRGFRLFGSGVSFQFPDIVATPRPMTESEWAFCEKHGVDAVTEIVIGLDAVVLTNP 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +     + T+  L+ A+A  +  + +VV NP  +W+ I  + P++ I I  P       +
Sbjct: 120 KASPQHNFTISQLFNAMAEKVQKEGRVVSNPYARWNRIDKELPDMPIEIMRPQPGSPVED 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQ-DGIAIEVDGDYTETLARIE 239
            + + V+ +GC               + Q+    C   R      ++     ++ L  + 
Sbjct: 180 AVVQLVMIKGCESFPAI------LLLDEQESFRVCRMFRPYSKNFVKALKHTSQMLHWLS 233

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            N + F F+  + Y++  D L    ++G+  ++ +I +  YP+SRP+  YVK  H  +V 
Sbjct: 234 QNPNAFIFLPYAVYRDYTDRLMANAVNGVPATLESISTRAYPLSRPIYLYVKIPHVEAVP 293

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRD 338
           GL++++  + S+  + PD  L   G +P+ +  R   RD
Sbjct: 294 GLQKFLYETTSERAIGPDGYLVDKGFVPLDDRGRNQARD 332


>gi|88597073|ref|ZP_01100309.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 84-25]
 gi|88190762|gb|EAQ94735.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 84-25]
          Length = 331

 Score =  219 bits (558), Expect = 4e-55,   Method: Composition-based stats.
 Identities = 98/344 (28%), Positives = 176/344 (51%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  + L      G      ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKKILSLSVASLAL-----CGALNAADLKIAGSSTVYPFTSFVAEEYASI-KNTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGIMIGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNAPLNITKKELFLALAKEIPQNGKLMPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TIEELVMSDVSKKIPEY--------------KGEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+      +   
Sbjct: 217 DKDAFGIFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             E+    +SD++     +L + GLIP+S+++ K+ +  +   K
Sbjct: 275 AFEFAKIYMSDDLAKSGGELEKIGLIPLSDDKLKASQKHVEDRK 318


>gi|153952378|ref|YP_001398149.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Campylobacter jejuni subsp. doylei 269.97]
 gi|152939824|gb|ABS44565.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Campylobacter jejuni subsp. doylei 269.97]
          Length = 331

 Score =  219 bits (557), Expect = 5e-55,   Method: Composition-based stats.
 Identities = 96/344 (27%), Positives = 178/344 (51%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+     ++   V  +   +   A + ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKK----ILSLSVASLALCSALNAAD-LKIAGSSTVYPFTSFVAEEYASI-KNTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEG----TTDISNASRPMKLSEFETCKKEGVTDIVGIMIGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TIEELVMSDVSKKIPEY--------------KGEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+      +   
Sbjct: 217 DKDAFGIFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             ++    +SD++     +L + GL+P+S+++ K+ +  +   K
Sbjct: 275 AFDFAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRK 318


>gi|269959061|ref|YP_003328850.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma centrale str. Israel]
 gi|269848892|gb|ACZ49536.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma centrale str. Israel]
          Length = 341

 Score =  219 bits (556), Expect = 7e-55,   Method: Composition-based stats.
 Identities = 110/323 (34%), Positives = 169/323 (52%), Gaps = 7/323 (2%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
           ++IR+ GSST+FP+   +AE F   F  ++TP +ES GS +G   FC G G  T DI  S
Sbjct: 24  DQIRVVGSSTVFPFISSVAEEFGR-FSAYRTPVIESVGSGMGFNMFCAGSGRGTPDIAMS 82

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL--IV 143
           SR+I   E++ C  +GV D+ EV +G+DGI++ S +    V  ++ DL+ AL+ Y     
Sbjct: 83  SRRIKDAEVELCGNNGVRDMIEVGLGYDGIVVASAKQKERVDFSLVDLFGALSKYSLSDE 142

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
             KV  N    WSE+RP  PE  I IY P    GT ++L    +   C+ ++NF      
Sbjct: 143 YGKVPMNKYSMWSEVRPSLPEHEIEIYGPHKNTGTYDILVDTAISGVCMSAKNFVD---- 198

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
              N+++    C+S+R DG  IEV       + +I  N + FG +  SF   N   ++  
Sbjct: 199 SYPNLEERKKVCSSIRNDGKYIEVATSENVVIHKISKNSNAFGILSFSFLVKNQGEIQGN 258

Query: 264 PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
            I G+ PS  TI SG Y +SRP+  YVK++H ++  GL+E+V   +  E +     L   
Sbjct: 259 RIAGVEPSYDTISSGKYVLSRPIYIYVKKEHLDTTPGLKEFVKEVMRPESIGSSGYLVNL 318

Query: 324 GLIPISNEERKSVRDSIAVGKSG 346
           G +P+  E+ +     +    +G
Sbjct: 319 GFVPLQKEQLEQTSQRVNELLAG 341


>gi|56416524|ref|YP_153598.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. St. Maries]
 gi|56387756|gb|AAV86343.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Anaplasma marginale str. St. Maries]
          Length = 338

 Score =  218 bits (555), Expect = 8e-55,   Method: Composition-based stats.
 Identities = 111/348 (31%), Positives = 176/348 (50%), Gaps = 12/348 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M  + +  + FV L +  G      ++IR+ GSST+FP+   +AE F   F  ++TP +E
Sbjct: 1   MGLWGLSFVAFVALALGAG-----ADQIRVVGSSTVFPFISSVAEEFGR-FSAYRTPVIE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS +G   FC G   DT DI  SSR+I   E++ C  +GV D+ E+ +G+DGI++ S 
Sbjct: 55  SVGSGMGFNMFCAGSSSDTPDIAMSSRRIKDAEVELCGMNGVKDMIEIGLGYDGIVVAST 114

Query: 121 RDMVSVSLTVEDLYKALASYL--IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           +    V  ++ DL+ AL+ Y       KV  N    WSE+RP  PE  I IY P    GT
Sbjct: 115 KQKEEVDFSLVDLFGALSKYSLSDEYGKVPLNKHSMWSEVRPGLPEHEIEIYGPHKNTGT 174

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
            ++L    +   C+ ++NF         + ++    C+S+R DG  IEV       + +I
Sbjct: 175 YDILVDTAISGVCMSAKNFVD----SYPDWEERKRVCSSIRNDGKYIEVATSENVVIHKI 230

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
             N + FG +  SF   N   ++   + G+ PS  TI SG + +SRP+  YVK++  ++ 
Sbjct: 231 SKNSNAFGILSFSFLVKNQGEIQGNKVAGVAPSYDTISSGKHVLSRPIYIYVKKERLDTT 290

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            GLRE+V   +  E +     L   G +P+  E+ +     +    +G
Sbjct: 291 PGLREFVKEVMRPESIGSSGYLVNLGFVPLQKEQLEQTSQRVNELLAG 338


>gi|315927349|gb|EFV06693.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni DFVF1099]
          Length = 331

 Score =  218 bits (555), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 95/344 (27%), Positives = 176/344 (51%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  + L      G      ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKKILSLSVASLAL-----CGALNAADLKIAGSSTVYPFTSFVAEEYAAI-KNTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G    T DI N+SR +  +E + CKK G++DI  + IG+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEG----TTDISNASRPMKLSEFETCKKAGITDIVGMMIGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TIEELVMSDVSKKIPEY--------------KGEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+      +   
Sbjct: 217 DKDAFGIFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             ++    +SD++     +L + GL+P+S+++ K+ +  +   K
Sbjct: 275 AFDFAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRK 318


>gi|148925969|ref|ZP_01809656.1| possible periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|205355463|ref|ZP_03222234.1| possible periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|145844955|gb|EDK22059.1| possible periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni CG8486]
 gi|205346697|gb|EDZ33329.1| possible periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni CG8421]
 gi|315928594|gb|EFV07888.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 305]
          Length = 331

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 96/344 (27%), Positives = 176/344 (51%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  + L      G      ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKKILSLSVASLAL-----CGALNAADLKIAGSSTVYPFTSFVAEEYASI-KNTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGMMIGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TIEELVMSDVSKKIPEY--------------KGEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+      +   
Sbjct: 217 DKDAFGIFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             ++    +SD++     +L + GL+P+S+++ K+ +  +   K
Sbjct: 275 AFDFAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRK 318


>gi|88658150|ref|YP_507764.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Ehrlichia chaffeensis str. Arkansas]
 gi|88599607|gb|ABD45076.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Ehrlichia chaffeensis str. Arkansas]
          Length = 339

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 111/343 (32%), Positives = 188/343 (54%), Gaps = 13/343 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M  F +V +  + L         +  +IR+ GSST FP+   IAE F   F ++ TP +E
Sbjct: 1   MGRFLLVFLSLITLAF-----NSSAQQIRVVGSSTAFPFISAIAEEFGR-FSDYGTPIIE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS +G   FC+G+G +T DIV SSRKI   E+  C+ + +++I E+ IG+DGI++ + 
Sbjct: 55  SVGSGMGFSMFCQGVGKNTPDIVMSSRKIKDAEVKLCQSNNINNIIEIIIGYDGIVIANS 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           +D   +  T +DL+KAL+ Y   ++    +  N  + WSEI   FP + I IY P    G
Sbjct: 115 KDSAKLDFTKKDLFKALSKYSTSNEYVETIPSNNFRYWSEINNRFPNIDIEIYGPYKNTG 174

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T  +L ++++Q+ C+ ++NF  +      +  +    C+ +R DG  IEV  +    + +
Sbjct: 175 TYNILVEEIMQDACMNNQNFIDVYS----DPTKRRRICSIMRNDGKYIEVAANENIIIQK 230

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           I  N+D FG +  SF   N D +    I GI P+  TI SG Y +SRP+  Y+K++H + 
Sbjct: 231 IAKNQDAFGILSFSFLVKNQDKIHANKIAGIEPNYETISSGKYILSRPIYLYIKQEHISF 290

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
              L+E++   + ++ +  +  L   G IP+S+++ +  ++ I
Sbjct: 291 SPSLKEFIKVILREDSIGKNGYLIGLGFIPLSDKDLQDTKNRI 333


>gi|294084775|ref|YP_003551533.1| phosphate binding protein [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292664348|gb|ADE39449.1| phosphate binding protein, putative [Candidatus Puniceispirillum
           marinum IMCC1322]
          Length = 350

 Score =  218 bits (554), Expect = 1e-54,   Method: Composition-based stats.
 Identities = 106/336 (31%), Positives = 173/336 (51%), Gaps = 16/336 (4%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR     ++  V+  +       AR+ I I+GSST+ P++ I+AE      P+FKTP VE
Sbjct: 1   MRKSI--IISGVLAGMMLAGTAQARDYISISGSSTVLPFATIVAERLGR-NPDFKTPVVE 57

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           SGGSSVG K  C G+G +  DI N+S ++ + EL  C  +GV  + E+ +G+DGI++   
Sbjct: 58  SGGSSVGKKSVCDGVGTEFTDIGNASSRMKEKELAYCGTNGVK-LTEIKVGYDGIVVAGS 116

Query: 121 RDMVSVSLTVEDLYKALASYLI-------VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPS 173
           +    ++++  DL KAL + +          D +V NP  KWSEI PD P++ I +Y P 
Sbjct: 117 KAGELLTISKADLGKALTAMVPASEVRNYKTDVMVPNPFTKWSEINPDLPDIAIRVYGPP 176

Query: 174 GKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTE 233
              GTR    + V ++G     + +K        + + +  C ++R DG+ +E       
Sbjct: 177 TTSGTRASFAEMVNEKGYCGKDDEAKR---VLKIMGEKAKICRAMRTDGVYVEAGEQDNL 233

Query: 234 TLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
            + +++ +   +G  G S+   NAD L+   I G  P+   I +  Y +SR L FYVK Q
Sbjct: 234 IVQKLQEDPTSYGIFGFSYLDQNADTLQGAVISGTAPTFDNIATDNYSVSRALYFYVKHQ 293

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPIS 329
           H   + G+ +Y++     +    D  L + G+IP+ 
Sbjct: 294 HMGVIPGVADYMNEWT--KHWDEDGILAESGMIPMP 327


>gi|86151698|ref|ZP_01069912.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315124133|ref|YP_004066137.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|85841327|gb|EAQ58575.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315017855|gb|ADT65948.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
          Length = 331

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 96/344 (27%), Positives = 176/344 (51%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  + L      G      ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKKILSLSVASLAL-----CGALNAADLKIAGSSTVYPFTSFVAEEYASI-KNTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGMMIGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TIEELVMSDVSKKIPEY--------------KSEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+      +   
Sbjct: 217 DKDAFGIFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             ++    +SD++     +L + GL+P+S+++ K+ +  +   K
Sbjct: 275 AFDFAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRK 318


>gi|57238191|ref|YP_178728.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni RM1221]
 gi|57166995|gb|AAW35774.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni RM1221]
 gi|315058027|gb|ADT72356.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Campylobacter jejuni subsp. jejuni S3]
          Length = 331

 Score =  217 bits (553), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 93/344 (27%), Positives = 172/344 (50%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  + L      G      ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKKILSLSVASLAL-----CGALNAADLKIAGSSTVYPFTSFVAEEYAAIH-NTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC GI     DI N+SR +  +E + CKK GV+DI  + +G+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEGI----TDISNASRAMKFSEFETCKKAGVTDIVGIMVGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TVEELVMSDISKKIPEY--------------KGEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G  F  +N D +    IDG+      I  G Y ++R L  Y+      +   
Sbjct: 217 DKDAFGLFGYGFLVSNVDKINAADIDGVKADEKNIADGKYDLARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             ++    +SD++     +L + GL+P+S+++ K+ +  +   K
Sbjct: 275 AFDFAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRK 318


>gi|283954105|ref|ZP_06371630.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 414]
 gi|283794384|gb|EFC33128.1| phosphate transport system substrate-binding protein [Campylobacter
           jejuni subsp. jejuni 414]
          Length = 331

 Score =  217 bits (552), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 96/344 (27%), Positives = 175/344 (50%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+     ++   V          A + ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKK----ILSLSVASFAFCGVLNAAD-LKIAGSSTVYPFTSFVAEEYASI-KNAKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGIMIGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNTPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TIEELVMSDVSKKIPEY--------------KGEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+      +   
Sbjct: 217 DKDAFGIFGYSFLVSNSDKINAAIIDGVTPSEESIADEKYELARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             ++    +SD++     +L + GL+P+S+++ K  +  +   K
Sbjct: 275 AFDFAKIYMSDDLAKSGGELEKIGLVPLSDDKLKISQKHVEDRK 318


>gi|121613740|ref|YP_001000315.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 81-176]
 gi|167005264|ref|ZP_02271022.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 81-176]
 gi|218562264|ref|YP_002344043.1| putative periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni NCTC 11168]
 gi|87250126|gb|EAQ73084.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni 81-176]
 gi|112359970|emb|CAL34759.1| putative periplasmic phosphate binding protein [Campylobacter
           jejuni subsp. jejuni NCTC 11168]
          Length = 331

 Score =  217 bits (551), Expect = 2e-54,   Method: Composition-based stats.
 Identities = 96/344 (27%), Positives = 177/344 (51%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+     ++   V  +       A + ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKK----ILSLSVTSLALCGALNAVD-LKIAGSSTVYPFTSFVAEEYASI-KNTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC G    T DI N+SR +  +E + CKK GV+DI  + IG+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEG----TTDISNASRPMKLSEFETCKKAGVTDIVGMMIGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TIEELVMSDVSKKIPEY--------------KGEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G SF  +N+D +    IDG+ PS  +I    Y ++R L  Y+      +   
Sbjct: 217 DKDAFGIFGYSFLVSNSDKINAANIDGVTPSEESIADEKYELARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             ++    +SD++     +L + GL+P+S+++ K+ +  +   K
Sbjct: 275 AFDFAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRK 318


>gi|57167642|ref|ZP_00366782.1| probable periplasmic phosphate binding protein Cj0613
           [Campylobacter coli RM2228]
 gi|305433147|ref|ZP_07402303.1| phosphate ABC superfamily ATP binding cassette transporter,
           periplasmic phosphate binding protein [Campylobacter
           coli JV20]
 gi|57020764|gb|EAL57428.1| probable periplasmic phosphate binding protein Cj0613
           [Campylobacter coli RM2228]
 gi|304443848|gb|EFM36505.1| phosphate ABC superfamily ATP binding cassette transporter,
           periplasmic phosphate binding protein [Campylobacter
           coli JV20]
          Length = 331

 Score =  216 bits (550), Expect = 4e-54,   Method: Composition-based stats.
 Identities = 94/344 (27%), Positives = 172/344 (50%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+     ++   V          A + ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKK----ILALSVASFALAGALNAAD-LKIAGSSTVYPFTSFVAEEYAAIH-NTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC GI     DI N+SR +  +E + CKK GV+DI  + +G+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEGI----TDISNASRAMKFSEFETCKKAGVTDIVGIMVGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++T ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KANAPLNITKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TVEELVMSDISKKIPEY--------------KGEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G  F  +N D +    IDG+      I  G Y ++R L  Y+      +   
Sbjct: 217 DKDAFGLFGYGFLVSNVDKINAADIDGVKADEKNIADGKYDLARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             E+    +SD++     +L + GL+P+S+++ K+ +  +   K
Sbjct: 275 AFEFAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRK 318


>gi|84514493|ref|ZP_01001857.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Loktanella vestfoldensis SKA53]
 gi|84511544|gb|EAQ07997.1| ABC phosphate transporter, periplasmic phosphate-binding protein
           [Loktanella vestfoldensis SKA53]
          Length = 335

 Score =  216 bits (548), Expect = 5e-54,   Method: Composition-based stats.
 Identities = 122/338 (36%), Positives = 183/338 (54%), Gaps = 14/338 (4%)

Query: 14  LEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCR 73
           +         +R  ++ AGSST+ PY+ I+AE F     +F TP VE GGSS G +  C 
Sbjct: 1   MMSAAAVSAQSRANVQAAGSSTVLPYANIVAEAFGAET-DFATPVVEGGGSSTGRRMLCE 59

Query: 74  GIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDL 133
           G+G+ TIDI NSS  +  +E + C   G++ I EV  G+DGI+  SD +  S +      
Sbjct: 60  GVGEGTIDIANSSSLMKDSERETCIAAGITPI-EVRFGYDGIVFASDINGASFAFEPVHW 118

Query: 134 YKALASYLIVDDKVVFNPLKKWSEIRP---------DFPEVRIAIYVPSGKHGTREVLEK 184
           + ALA+   +D  +V N L  W+++           D P+  I  ++P   HGTREV  +
Sbjct: 119 HIALAAEHFIDGALVPNTLTNWAQVAEIAQSLGVAGDLPDQEINAFIPGTNHGTREVFNE 178

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
           KVL +GC +    + M      +      AC + R DG +++++GDY +TLA ++     
Sbjct: 179 KVLLDGCEQGGFLAAMLAA-GVDEDTAEDACMNTRTDGRSVDIEGDYPQTLANLDSTPTG 237

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREY 304
            G  GLSFY+NN D L++  + G+ PS  TI  G YP+SRPL FYVK++H   + GL E+
Sbjct: 238 IGVFGLSFYENNTDRLQVATMSGVTPSTETISVGEYPVSRPLQFYVKQEHIGVIPGLLEF 297

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           V F +SDE+  P   L  YGL+P  + +    +  +A 
Sbjct: 298 VEFFISDEIAGPGGPLSDYGLVP--DPKLAETQAMVAA 333


>gi|86149779|ref|ZP_01068008.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni CF93-6]
 gi|85839597|gb|EAQ56857.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Campylobacter jejuni subsp. jejuni CF93-6]
          Length = 331

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 92/344 (26%), Positives = 171/344 (49%), Gaps = 26/344 (7%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  + L      G      ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKKILSLSVASLAL-----CGALNAADLKIAGSSTVYPFTSFVAEEYAAIH-NTKTPIVE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC GI     DI N+SR +  +E + CKK GV+DI  + +G+DGI+L  +
Sbjct: 55  SLGTGGGFKVFCEGI----TDISNASRAMKFSEFETCKKAGVTDIVGIMVGYDGIVLAQN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++  ++L+ ALA  +  + K++ NP   W++I  + P  +I++Y P    GTR+
Sbjct: 111 KTNAPLNIAKKELFLALAKEIPQNGKLIPNPYTNWNQINKNLPNRKISVYGPPSSSGTRD 170

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ +
Sbjct: 171 TVEELVMSDISKKIPEY--------------KGEYKTIRQDGAYIPSGENDNLIVSKLTI 216

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +KD FG  G  F  +N D +    IDG+      I  G Y ++R L  Y+      +   
Sbjct: 217 DKDAFGLFGYGFLVSNVDKINAADIDGVKADEKNIADGKYELARSLFIYIN--AKKNPKE 274

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             ++    +SD++     +L + GL+P+S+++ K+ +  +   K
Sbjct: 275 AFDFAKIYMSDDLAKSGGELEKIGLVPLSDDKLKASQKHVEDRK 318


>gi|87200290|ref|YP_497547.1| phosphate binding protein, putative [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135971|gb|ABD26713.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 353

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 98/325 (30%), Positives = 174/325 (53%), Gaps = 10/325 (3%)

Query: 17  YCGTGTFA-RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
            CG+   A R+++R  GSST++P++K +AE+ ++     K+P +ES G+  G+K FC G+
Sbjct: 26  GCGSQEGATRDQVRAVGSSTVYPFAKAVAESLAKSDASLKSPIIESTGTGAGMKLFCAGV 85

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
           G    DI N+SR++ ++E ++C+K+GV DI E+ +G DG+     +    ++LT ED+YK
Sbjct: 86  GAQHPDIANASRRMKKSEFEDCQKNGVKDIVEIQVGLDGVAFAEAQKGPGIALTPEDVYK 145

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
           ALA           N  K W ++ P  P   I +Y P    GTR+ L++ +L +GC    
Sbjct: 146 ALAKNPYGK----PNAFKTWKDVNPSLPAEPILVYGPPSTSGTRDALKELILMKGCD--- 198

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
             ++M+ +   +  +    C  VR DG  ++   +    + +IE N    G  G S+ + 
Sbjct: 199 ENAEMKALKDSDKDKHDKICGEVRDDGAYVDAGENDNLIVQKIEANPKAIGIFGFSYLEE 258

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           N+  +K + + GI P+  TI    YP +RPL  YVK+ H  ++ GL+ +V+     ++  
Sbjct: 259 NSSRIKGLTMKGIAPTYATISDFTYPGARPLYIYVKKAHLKAIPGLQAFVTEW--SKLWG 316

Query: 316 PDSQLFQYGLIPISNEERKSVRDSI 340
            D  L + G++   ++   +   ++
Sbjct: 317 KDGSLAKLGMVVAPDDVLAASAKAV 341


>gi|326387437|ref|ZP_08209046.1| phosphate binding protein, putative [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208093|gb|EGD58901.1| phosphate binding protein, putative [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 360

 Score =  215 bits (547), Expect = 7e-54,   Method: Composition-based stats.
 Identities = 100/340 (29%), Positives = 168/340 (49%), Gaps = 9/340 (2%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
            F V+     +    C +G   R+++R  GSST++P++K +AE  +      K+P +ES 
Sbjct: 20  LFPVLASALTLALSGCDSGDVVRDQVRAVGSSTVYPFAKAVAEELARSDSTLKSPIIEST 79

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           G+  G+K FC G+G    DI ++SR++ ++E DEC ++GV DI E+ +G DG+     + 
Sbjct: 80  GTGAGMKLFCAGVGPQFPDIEDASRRMKKSEFDECARNGVRDIVEIEVGLDGVAFARSQA 139

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
              + LT E +Y+ALA           N  + W ++ P  P + I +Y P    GTR+ L
Sbjct: 140 GGDLPLTPERVYRALAKNPYG----HPNTARTWHDVDPAMPSIPILVYGPPSTSGTRDAL 195

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
           ++ +L  GC        M+ +   +  +    C  VR+DG  ++   +    + +IE N 
Sbjct: 196 KELILTRGCDSDPA---MKALATSDPARHGTICGEVREDGAYVDAGENDNLIVQKIEANS 252

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           D  G  G S+ + NAD L  + +  + PS  TI    YP +RPL  YVK+ H  ++ GL 
Sbjct: 253 DAIGIFGYSYLEQNADRLTGLTMSSVRPSYATIADFSYPGARPLYIYVKKAHLRAIPGLS 312

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
            YV+      M +    L + G++   ++        +A 
Sbjct: 313 AYVTEW--SRMWSKGGTLARLGMVIAPDDVLAGSARKVAE 350


>gi|73666783|ref|YP_302799.1| phosphate ABC transporter, periplasmicphosphate-binding protein,
           putative [Ehrlichia canis str. Jake]
 gi|72393924|gb|AAZ68201.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Ehrlichia canis str. Jake]
          Length = 340

 Score =  215 bits (546), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 112/345 (32%), Positives = 182/345 (52%), Gaps = 13/345 (3%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M  FF+V +  + L            +IR+ GSST  P+   IAE F   F ++ TP +E
Sbjct: 1   MSRFFLVFLVLITLAF-----NVNAQQIRVVGSSTASPFISAIAEEFGR-FSDYGTPIIE 54

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S GS +G   FC G+G +T DIV SSRKI   E+  CK + + +I E+ IG+DGI++ + 
Sbjct: 55  SVGSGMGFSMFCEGVGKNTPDIVMSSRKIKDAEVKLCKSNNIENIIEIIIGYDGIVIANS 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVF---NPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           +D   +  T +DL+KAL+ Y   ++ V     N  + WSEI    P   I +Y P    G
Sbjct: 115 KDSNKLDFTKQDLFKALSKYSTSNEYVETMSTNYFRYWSEINNRLPNTDIEVYGPYKNTG 174

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T  +L ++++Q  C+ ++NF  +      ++++   AC  +R DG  IEV  +    + +
Sbjct: 175 TYNILVEEIMQASCIHNQNFIDVY----PDLKRRQRACGIMRNDGKYIEVAANENIIIQK 230

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           I  N D FG +  SF   N D +    I G+ P+  TI SG Y +SRP+  Y+K++H N 
Sbjct: 231 IAKNHDAFGILSFSFLIKNQDKIHANKIAGVEPNYETISSGKYILSRPIYLYIKQEHINL 290

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
              ++E++   + +E +  +  L   G IP+S+++    ++ I  
Sbjct: 291 SSSIKEFIKVILREESIGKNGYLIGLGFIPLSDKDLLDTKNRITN 335


>gi|103486316|ref|YP_615877.1| phosphate binding protein, putative [Sphingopyxis alaskensis
           RB2256]
 gi|98976393|gb|ABF52544.1| phosphate binding protein, putative [Sphingopyxis alaskensis
           RB2256]
          Length = 353

 Score =  214 bits (545), Expect = 1e-53,   Method: Composition-based stats.
 Identities = 111/342 (32%), Positives = 163/342 (47%), Gaps = 13/342 (3%)

Query: 1   MRFFFVVLMCFVVLEVY---CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           M        C + L        +G  AR+ I   GSST++P++  + E F+E     KTP
Sbjct: 9   MLGVAGAATCALALSACQDQASSGGGARDYISAVGSSTVYPFATAVGEKFAEATGN-KTP 67

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            ++S G+  G + FC G+G DT DI N+SR+I + E D C  +GV DI E+ IG DGI L
Sbjct: 68  KIDSTGTGGGFERFCAGVGGDTPDIANASRRIKKKEFDTCVANGVKDIVEIQIGIDGIAL 127

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
                     LT ED+YKALA+          N  K W ++ P  P V I+++ P    G
Sbjct: 128 GEATRGPGFKLTEEDVYKALAANPYGK----PNTAKTWKDVNPALPAVAISVFGPPSTSG 183

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  ++ +L  GC       +M+ +   N  +    CT++R     +E   +    +++
Sbjct: 184 TYDAFKELILGRGCD---ANPEMKALKASNADEHEATCTTLRGSPYYVEQGENDNLIISK 240

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           ++ N    G  G S+   N D +K VPI G+ P+   I  G YP SRPL  YVK+ H   
Sbjct: 241 LDKNPTSLGIFGFSYLDANKDKIKAVPIQGVAPTYAAIADGSYPGSRPLFIYVKKAHVGV 300

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           V GL EYV+  +  +  A    L   GLI          R +
Sbjct: 301 VPGLAEYVAEFL--KGAADGGYLNAKGLIVSPKAIADKARAA 340


>gi|222823805|ref|YP_002575379.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Campylobacter lari RM2100]
 gi|222539027|gb|ACM64128.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Campylobacter lari RM2100]
          Length = 327

 Score =  209 bits (532), Expect = 4e-52,   Method: Composition-based stats.
 Identities = 99/343 (28%), Positives = 168/343 (48%), Gaps = 30/343 (8%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+         + L V C     A   ++IAGSST++P++  +AE ++      KTP VE
Sbjct: 1   MKK-------LLALSVACFVSLNAAE-LKIAGSSTVYPFTSFVAEEYASI-KNTKTPIVE 51

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+  G K FC GI     DI N+SR I  +E + CKK GVSDI  + IG+DGI+L  +
Sbjct: 52  SLGTGGGFKVFCEGI----TDISNASRAIKPSEFETCKKSGVSDIVGIMIGYDGIVLAQN 107

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +    +++++++L+ ALA  +  D K++ NP   W +I  + P  +I IY P    GTR+
Sbjct: 108 KINAPLNISMQELFLALAKEIPQDGKLIPNPYTNWQQINKNLPNRKITIYGPPSSSGTRD 167

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            +E+ V+ +   +   +                   ++RQDG  I    +    ++++ V
Sbjct: 168 SIEELVMVDISKKIPEY--------------KGVYKTIRQDGAFIPSGENDNLIVSKLSV 213

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           +K+ FG  G  F  +N D +    IDG+      I  G Y ++R L  Y+  +       
Sbjct: 214 DKEAFGLFGYGFLASNDDKINAAYIDGVKADEKNISEGKYKLARSLFIYMNAK---KNPE 270

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           + E+    +SD++    ++L + GL+P+  +  K  +  I   
Sbjct: 271 VFEFAKIYMSDDLAKSGAELEKIGLVPLDEKTLKQTQKHIEEK 313


>gi|158341427|ref|YP_001522592.1| phosphate transporter binding protein [Acaryochloris marina
           MBIC11017]
 gi|158311668|gb|ABW33278.1| phosphate transporter binding protein [Acaryochloris marina
           MBIC11017]
          Length = 754

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 79/339 (23%), Positives = 138/339 (40%), Gaps = 50/339 (14%)

Query: 13  VLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFC 72
           V      T    +  I I GSS++FP S++IAE F     + K   V   G+  G K+FC
Sbjct: 444 VSSDLSTTSINLKGSIAIDGSSSVFPISEVIAEEFQSVNKDVKI-TVGISGTGGGFKKFC 502

Query: 73  RGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVED 132
            G      +I ++SR I Q E+  C K+ +  I+         ++V   +  +  +T  +
Sbjct: 503 SG----ETEISDASRPIKQREIALCAKNNIEYIELPVAYDVLSVVVHKDNDWADCMTTNE 558

Query: 133 LYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCV 192
           L  A +             + KW+++ P++P+V + +Y P    GT +   + +  E   
Sbjct: 559 LKTAWSKS-------AQGNISKWNQVNPNYPDVPLTLYGPGTDSGTFDYFNEAITGEEG- 610

Query: 193 RSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSF 252
              +F+                               D    +  +  +K+  G++G  +
Sbjct: 611 SRGDFAT----------------------------SEDNNTIVRGVSGDKNAMGYLGYVY 642

Query: 253 YKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSF 307
           Y+ N D LK V ID     I PS  TI  G Y P++RP+  YV +   +    ++ ++ F
Sbjct: 643 YEENKDSLKAVQIDDGDGCIAPSDETISKGTYSPLARPMFIYVSKVAID-RPEVKSFIEF 701

Query: 308 SVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            ++         +   G IP+S+E           GK+G
Sbjct: 702 YLNP---KNRQLVANVGYIPLSDEIYAKALARFQEGKTG 737


>gi|53802738|ref|YP_115489.1| phosphate binding protein [Methylococcus capsulatus str. Bath]
 gi|53756499|gb|AAU90790.1| putative phosphate binding protein [Methylococcus capsulatus str.
           Bath]
          Length = 383

 Score =  208 bits (528), Expect = 1e-51,   Method: Composition-based stats.
 Identities = 109/349 (31%), Positives = 168/349 (48%), Gaps = 15/349 (4%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGT--FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           M   F       VL  +  T    F R  + IAGSST+FP +  +A++ S    + + P 
Sbjct: 1   MLKRFPAYAAASVLFFHAATAQAEFGRPYLLIAGSSTIFPLASAVADHVSAS-GKIRKPK 59

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           VES G+  G+K FC G G +  DIV +SR + + E +EC  +GV++I E+ IG+DGI++ 
Sbjct: 60  VESTGTGGGIKLFCEGTGRNYPDIVLASRMMKKVEREECGLNGVNEITELKIGYDGIVVA 119

Query: 119 SDRDMVSVSLTVEDLYKALASYLIV------DDKVVFNPLKKWSEIRPDFPEVRIAIYVP 172
             R     +LT  DLY ALA  +         D+++ NP +KWSE+ P  P++ I ++ P
Sbjct: 120 QSRKDGPWNLTNRDLYLALAKMVPDPKCSGSCDRLIPNPYRKWSEVNPALPDLPIVVWGP 179

Query: 173 SGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYT 232
               GTR+   + VL+ GC     F  M+ M   N  +    C S+R+DG+         
Sbjct: 180 PLSSGTRDTFAEDVLEAGCAG---FPAMKQMMLANEARFKKLCQSIREDGVYESEPESS- 235

Query: 233 ETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKR 292
             +     +    G +       +   L   PI+GI P+  ++ S  YP+ RPL  YVK+
Sbjct: 236 --IIDHVASGHGLGIIDFGVLAKHRSELVAAPIEGIEPTYESVKSQRYPVGRPLYMYVKQ 293

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
            H     G+  Y+    SD     +  L   GLIP+ + ER    + + 
Sbjct: 294 AHLGLAPGMEAYLKEFTSDRAWGDEGYLIADGLIPMPSAERTIELEKLK 342


>gi|328950118|ref|YP_004367453.1| phosphate binding protein [Marinithermus hydrothermalis DSM 14884]
 gi|328450442|gb|AEB11343.1| phosphate binding protein [Marinithermus hydrothermalis DSM 14884]
          Length = 319

 Score =  206 bits (522), Expect = 5e-51,   Method: Composition-based stats.
 Identities = 84/351 (23%), Positives = 152/351 (43%), Gaps = 56/351 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR   + +   ++      +G  A+  IR+ GSST++P +  IAE F+   P+ +   V 
Sbjct: 1   MRNLAIPVALVLM------SGALAQGDIRVDGSSTVYPITLAIAEEFAIENPKARV-TVA 53

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G K+FC G      DI ++SR I Q+E++ C+++GV  I+         ++V+ 
Sbjct: 54  FSGTGGGFKKFCAG----ETDINDASRPIKQSEIEMCRENGVEFIEIPVAFDGVTVVVNR 109

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +  +  L+VE+L +                ++ WS++RP++P+  I +Y P    GT +
Sbjct: 110 ENTFAECLSVEELRRIWEPNS---------TVRYWSDVRPEWPKEEIVLYGPGTDSGTFD 160

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + V+ E      ++                                D    +A +E 
Sbjct: 161 YFTEAVVGETGAIRTDY----------------------------FPSEDDNVLVAGVEG 192

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
           +    GF G ++Y   AD L  + ID     + P+  TI +G Y P+SRPL  YV++   
Sbjct: 193 SPYAMGFFGYAYYVEEADRLNAIAIDNGQGCVAPTEETINNGTYAPLSRPLFIYVRKDAL 252

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                L E+V F +S++       +   G +P+ +E  +   +      +G
Sbjct: 253 GHNPLLVEFVRFYLSEDA---REFIADTGYVPLPDEAYELALERFEQRVTG 300


>gi|254796463|ref|YP_003081299.1| ABC-type phosphate transport system, periplasmic component
           [Neorickettsia risticii str. Illinois]
 gi|254589691|gb|ACT69053.1| ABC-type phosphate transport system, periplasmic component
           [Neorickettsia risticii str. Illinois]
          Length = 339

 Score =  205 bits (520), Expect = 9e-51,   Method: Composition-based stats.
 Identities = 104/328 (31%), Positives = 176/328 (53%), Gaps = 10/328 (3%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
                AR  +R+ GSST+FP+   I+E F++ +   KTP VES G+S G K FC G+GD 
Sbjct: 15  AGFADAREYVRVVGSSTVFPFMSAISEEFAKTY-RVKTPIVESTGTSAGFKLFCTGVGDA 73

Query: 79  TIDIVNSSRKITQNELDECKKHGVS--DIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYK 135
             DIV SSR++ + EL  CK + +   DI E+ +G D +++ S          ++ D+++
Sbjct: 74  HPDIVVSSRRMNEVELALCKVYSIDSGDIMEIELGRDALVVASSSGSGLDYEFSIRDIFE 133

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRP-DFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
           A++ Y+    ++V NP K+W  I    F +  I IY P+   GT E ++K +L   C+  
Sbjct: 134 AISFYVADGVRLVKNPNKRWGNIDDGKFYDSEIKIYGPTRNTGTFESVKKMILLSQCLNE 193

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
             F        Y  ++L   C+ VR DG+ +EV  +    + ++  N + FG +  SF+ 
Sbjct: 194 PAF-----NLAYGPEKLRKICSVVRDDGVYVEVSNNENLMVQKLVRNSNAFGLLSYSFFI 248

Query: 255 NNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
            N+D LK   ++G+ P+  +I+SG Y   RP+  YVK  H   V GL++ ++  +S+  +
Sbjct: 249 RNSDALKAHSVNGVRPTYESIMSGQYDFVRPVYLYVKLTHLGLVRGLKDLLNEVLSENAL 308

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAV 342
                L   G++P+ ++E  + R+ +A 
Sbjct: 309 GTYGYLRAIGMVPMPDQELGAAREKVAS 336


>gi|288931341|ref|YP_003435401.1| phosphate binding protein [Ferroglobus placidus DSM 10642]
 gi|288893589|gb|ADC65126.1| phosphate binding protein [Ferroglobus placidus DSM 10642]
          Length = 317

 Score =  204 bits (519), Expect = 1e-50,   Method: Composition-based stats.
 Identities = 74/352 (21%), Positives = 147/352 (41%), Gaps = 53/352 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR-----NRIRIAGSSTLFPYSKIIAENFSEYFPEFK 55
           M+   + L   ++  +  G     +       +++AGSST++P +  +AE F++ +P   
Sbjct: 1   MKKLLLGLSLVLIASLLAGCSQEGKKGEISGEVKVAGSSTVYPITIAMAEEFNKLYPNV- 59

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
              V+S G+  G K F         DI ++SR I   EL+  KK+GV  I+ +       
Sbjct: 60  VVSVQSTGTGGGFKNF---FIPGYADINDASRPIKPEELEAAKKNGVEPIEFLVAYDALT 116

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
           ++V+  +     L+ E+L K                + KWS++ P++P+  + +Y P+  
Sbjct: 117 VIVNPENDWVDCLSFEELRKIWGPE-------ATGNITKWSDVNPEWPDEEMHLYGPTSA 169

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GT +   + V+ +     +++                                +    +
Sbjct: 170 SGTFDFFTEVVIGKEDAHRKDY----------------------------HGTEEDNTII 201

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLYPISRPLLFYV 290
             +E ++   G++GL++Y  N D +K V I       + PS+ T  SG YP++RPL  YV
Sbjct: 202 QAVERDRYAMGYLGLAYYLENKDKVKAVKIKNEKGVCVEPSIETARSGEYPLTRPLYIYV 261

Query: 291 KRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
            ++       +RE+V F + +        + + G +P+  + ++        
Sbjct: 262 NKESL-KKPAVREFVRFYLEN---LDSGIVEEIGYVPVDEKTKEENLKKFEE 309


>gi|221633805|ref|YP_002523031.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Thermomicrobium roseum DSM 5159]
 gi|221155820|gb|ACM04947.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermomicrobium roseum DSM 5159]
          Length = 388

 Score =  204 bits (517), Expect = 2e-50,   Method: Composition-based stats.
 Identities = 73/333 (21%), Positives = 137/333 (41%), Gaps = 52/333 (15%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
                  I I GSST+FP S+ +AE F + +P+ K   V   G+  G K+FC        
Sbjct: 81  AQQLSGTITIDGSSTVFPISEAVAEEFQKKYPQVKV-TVGISGTGGGFKKFCN----KET 135

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           DI ++SR I  +E++ C+K G   I+         ++V  ++     LTVE+L       
Sbjct: 136 DISDASRPIKDSEVEACQKSGREYIELPVAFDGLAVVVHPQNDWVDHLTVEELNLIWKPE 195

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
                      + +W+++RP++P+  + +Y      GT +   + +  +      +++  
Sbjct: 196 S-------QGVITRWNQVRPNWPDAPLNLYGAGTDSGTFDYFTEAINGKAGASRGDYTA- 247

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                                        D    +  +  +K+  G+ GL++   N   +
Sbjct: 248 ---------------------------SEDDNVLVQGVAGDKNALGYFGLAYAIENKGRV 280

Query: 261 KLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
           K+VPI        + P++ T+ +G Y P+SRPL  YV R   +    ++ +V F + +  
Sbjct: 281 KIVPIVNPKTGKPVEPNLETVKTGQYQPLSRPLFIYVARDQAD-RPEVQAFVEFYLDNAA 339

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                   + G IP+ +E  +  +      K+G
Sbjct: 340 ----ELSQEVGYIPLPDEAYQLAKKRFQARKTG 368


>gi|85710044|ref|ZP_01041109.1| phosphate binding protein, putative [Erythrobacter sp. NAP1]
 gi|85688754|gb|EAQ28758.1| phosphate binding protein, putative [Erythrobacter sp. NAP1]
          Length = 359

 Score =  202 bits (513), Expect = 7e-50,   Method: Composition-based stats.
 Identities = 102/345 (29%), Positives = 173/345 (50%), Gaps = 12/345 (3%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFAR-NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
              +V     VL    G+   A    I I GSST++P+++ +AE++         P + S
Sbjct: 9   RNLLVGASLAVLAACGGSEVEAGPEPISIVGSSTVYPFAQKVAEDYVAGNEGAAAPVIVS 68

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            G+  G++EFC G G +T DIVN+SR++TQ+E + C+ +GVSDI EV +G DGI+ VS  
Sbjct: 69  TGTGEGIEEFCAGQGPETADIVNASRQMTQSEFERCRTNGVSDIIEVKVGRDGIVFVSAM 128

Query: 122 D-MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           D  + + LT   +Y ALA+  + +++   N    WS++    P   I +Y P    GTR+
Sbjct: 129 DEGIELELTPGIIYNALAAMPLGEEQTAEN----WSDVDSSLPSEPIIVYGPPETSGTRD 184

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
            L   ++   C R+    +M  + + +  Q    C  +R D   ++        + ++  
Sbjct: 185 ALLDVIMTPACRRNS---EMAALEESDPAQFERDCHELRSDEAYLDQGEQDDLLVRKVAN 241

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N    G +G S+   NA+ +K +PI G+  S  TI  G Y  SR L  YVK+ H     G
Sbjct: 242 NPRAIGVLGYSYLDENAESVKGLPIGGVEASAETIADGSYAGSRALYIYVKKAHIGVTPG 301

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L  Y+  +   +    +  L   GL+P+++ ++ +   ++  G++
Sbjct: 302 LENYL--AQWAQSWGTEGPLADIGLVPLTDADQAAS-AAVIEGQT 343


>gi|88608594|ref|YP_505964.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Neorickettsia sennetsu str. Miyayama]
 gi|88600763|gb|ABD46231.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Neorickettsia sennetsu str. Miyayama]
          Length = 338

 Score =  201 bits (509), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 106/328 (32%), Positives = 177/328 (53%), Gaps = 10/328 (3%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
                 R  +R+ GSST+FP+   I+E F++ +   KTP VES G+S G K FC G+GD 
Sbjct: 14  AGFADTREYVRVVGSSTVFPFMSAISEEFAKTY-RVKTPIVESTGTSAGFKLFCMGVGDA 72

Query: 79  TIDIVNSSRKITQNELDECKKHGVS--DIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYK 135
             DIV SSR+I + EL  CK + +   DI E+ +G D +++ S          ++ D+++
Sbjct: 73  HPDIVVSSRRINEVELALCKVYSIDSGDIMEIELGRDALVVASSSGSGLDYEFSIRDIFE 132

Query: 136 ALASYLIVDDKVVFNPLKKW-SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
           A++ Y+    ++V NP K+W S     F +  I IY P+   GT E +++ VL   C+  
Sbjct: 133 AISFYVADGVRLVKNPNKRWGSIDDGKFYDSEIKIYGPTRNTGTFESVKRMVLLSQCLNE 192

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
             F        Y +++L   C+ VR DG+ +EV  +    + ++  N + FG +  SF+ 
Sbjct: 193 PAF-----NLAYGLEKLRKICSVVRDDGVYVEVSNNENLMVQKLARNHNAFGLLSYSFFI 247

Query: 255 NNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
            N+D LK   ++G+ P+  +I+SG Y   RP+  YVK  H + V GLR+ ++  +S+  +
Sbjct: 248 RNSDALKAHSVNGVRPTYESIMSGQYDFVRPVYLYVKLTHLDFVRGLRDLLNEVLSENAL 307

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAV 342
                L   G++P+ N+E   +R+ +A 
Sbjct: 308 GTYGYLRAVGMVPMPNQELGVIREKVAS 335


>gi|159030676|emb|CAO88346.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 341

 Score =  200 bits (508), Expect = 2e-49,   Method: Composition-based stats.
 Identities = 80/351 (22%), Positives = 149/351 (42%), Gaps = 48/351 (13%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M F  + +    +L         A   I+I GSST++P ++ +AE F    P      V+
Sbjct: 11  MVFSALSIFGISLLSACGIGEFPANKSIKIDGSSTVYPITQAVAEKFKSSQPGTAEVSVK 70

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G++ G +EFC G      DI N+SR I  +E+  C ++GV  I+         ++V+ 
Sbjct: 71  FSGTTGGFREFCEG----KTDISNASRPIQADEMSLCNRYGVRYIELPVAFDALTVVVNQ 126

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +    S+T+E+L K         +      +  W++IRP+FP   + ++      GT +
Sbjct: 127 ENNWIDSITLEELKKMW-------EPAAEGKITNWNQIRPEFPNKPLNLFGAGQDSGTFD 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + V+ +     +++                                D    +  +  
Sbjct: 180 YFTEAVVGKSGASRKDYVA----------------------------SEDDNTLVQGVSQ 211

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
           + +  G+ GL++Y+ N   LK + ID     I+PS  T+V+  Y P++RPL  YV  +  
Sbjct: 212 DPNALGYFGLAYYEQNPQKLKALGIDSGKGAILPSRETVVNSQYQPLARPLFIYVNAEKA 271

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                L+E+V + + +     +S + + G IP+++E       +   G+ G
Sbjct: 272 QKSRALQEFVEYYLDNA----ESIVKEVGYIPLTDEHYHLATVTFFNGEVG 318


>gi|313201600|ref|YP_004040258.1| phosphate-binding protein [Methylovorus sp. MP688]
 gi|312440916|gb|ADQ85022.1| phosphate binding protein [Methylovorus sp. MP688]
          Length = 334

 Score =  200 bits (507), Expect = 3e-49,   Method: Composition-based stats.
 Identities = 77/353 (21%), Positives = 146/353 (41%), Gaps = 51/353 (14%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRI-RIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           +F   + +  VV  ++      A  +I +I GSST++P ++ +AE F +         V 
Sbjct: 4   KFVQSMGLAAVVASLFAIPTAHAAEKIVKIDGSSTVYPITEAVAEEFQKAKKGAIKVTVG 63

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G K+FCRG      DI  +SR I + E+D CK+ G+  I+         ++V+ 
Sbjct: 64  ISGTGGGFKKFCRG----ETDISEASRPILKKEMDACKEAGIQYIELPVAYDALTVVVNP 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++    S+TVE+L K  A             +K W ++   +P+  + ++ P    GT +
Sbjct: 120 KNDWIKSITVEELNKMWAP-------AAQGSVKTWKQVNATWPDKPLKLFGPGADSGTFD 172

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + V+ +      +F+                               D    +  +  
Sbjct: 173 YFTEAVVGKAKSSRGDFTA----------------------------SEDDNVLVQGVSS 204

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +    G+ G +++  N D L+ VPI        + PS  T+++G Y P+SRPL  YV   
Sbjct: 205 DIGGLGYFGYAYFDENRDKLRAVPIVAKTGAPAVSPSPETVMNGTYQPLSRPLFIYVNAT 264

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                  ++E+++F +++      +   +   +P+   E  +V +     K G
Sbjct: 265 AGAFKPEVKEFINFYLANAA----ALTKEVKYVPLPASEYAAVVEHWKSLKPG 313


>gi|253999565|ref|YP_003051628.1| phosphate-binding protein [Methylovorus sp. SIP3-4]
 gi|253986244|gb|ACT51101.1| phosphate binding protein [Methylovorus sp. SIP3-4]
          Length = 334

 Score =  199 bits (505), Expect = 5e-49,   Method: Composition-based stats.
 Identities = 76/353 (21%), Positives = 146/353 (41%), Gaps = 51/353 (14%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRI-RIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           +F   + +  +V  ++      A  +I +I GSST++P ++ +AE F +         V 
Sbjct: 4   KFVQSMGLAAIVASLFAIPTAHAAEKIVKIDGSSTVYPITEAVAEEFQKAKKGAIKVTVG 63

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G K+FCRG      DI  +SR I + E+D CK+ G+  I+         ++V+ 
Sbjct: 64  ISGTGGGFKKFCRG----ETDISEASRPILKKEMDACKEAGIQYIELPVAYDALTVVVNP 119

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++    S+TVE+L K  A             +K W ++   +P+  + ++ P    GT +
Sbjct: 120 KNDWIKSITVEELNKMWAP-------AAQGSVKTWKQVNATWPDKPLKLFGPGADSGTFD 172

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + V+ +      +F+                               D    +  +  
Sbjct: 173 YFTEAVVGKAKSSRGDFTA----------------------------SEDDNVLVQGVSS 204

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +    G+ G +++  N D L+ VPI        + PS  T+++G Y P+SRPL  YV   
Sbjct: 205 DIGGLGYFGYAYFDENRDKLRAVPIVAKTGAPAVSPSPETVMNGTYQPLSRPLFIYVNAT 264

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                  ++E+++F +++      +   +   +P+   E  +V +     K G
Sbjct: 265 AGAFKPEVKEFINFYLANAA----ALTKEVKYVPLPASEYAAVVEHWKSLKPG 313


>gi|159030672|emb|CAO88342.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 339

 Score =  198 bits (502), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 74/333 (22%), Positives = 140/333 (42%), Gaps = 51/333 (15%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
              + +RN I+I GSST++P ++ +AE F +   + +   V   G+  G K+FC G    
Sbjct: 30  AVNSQSRNTIKIDGSSTVYPITEAVAEEFQKINRQTQV-TVGISGTGGGFKKFCAG---- 84

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
             DI N+SR I  +E   C K+GV  + E+ I  D + +V +R     S+ V +L K   
Sbjct: 85  ETDISNASRPIKDSERQLCAKNGVKFL-ELPIAFDALTVVVNRQNPLNSIKVSELKKMW- 142

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                 +      + KW+++   +P   + ++ P    GT +   + ++ E      +F+
Sbjct: 143 ------EPAAQGKITKWNQVNSKWPNANLKLFGPGADSGTFDYFTEAIVGESKKSRTDFT 196

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
                                          D    +  +  +++  G+ G ++Y+ N  
Sbjct: 197 P----------------------------SEDDNVLVQGVIRDRNALGYFGYAYYEANKG 228

Query: 259 VLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
            LK + ID     I PS   + +G Y P+SRP+  YV   +      ++ +V F +++  
Sbjct: 229 RLKALAIDNGKGAISPSAENVNNGKYNPLSRPVFIYVN-ANAAKRPEVKSFVEFFINNAP 287

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                 + +   +P+     +SV  +    K+G
Sbjct: 288 K----LVREVKYVPLPANVYQSVMRNFRNNKTG 316


>gi|158333405|ref|YP_001514577.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Acaryochloris marina MBIC11017]
 gi|158303646|gb|ABW25263.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Acaryochloris marina MBIC11017]
          Length = 337

 Score =  197 bits (499), Expect = 3e-48,   Method: Composition-based stats.
 Identities = 82/365 (22%), Positives = 142/365 (38%), Gaps = 64/365 (17%)

Query: 1   MRFFFVVLMCFVVLEVYC--------------GTGTFARNRIRIAGSSTLFPYSKIIAEN 46
           M  F  V +  +V  V                GT      +I I GSST+ P ++ +AE 
Sbjct: 1   MNLFRYVSLAVLVASVSACAGGETTSDGPSSTGTDANLSGKITIDGSSTVLPIAEAMAEE 60

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           F     + K   V   G+  G K+FC G      +I N+SR I Q E+D C +  +  I+
Sbjct: 61  FQAANSDVKI-TVGKSGTGGGFKKFCAG----ETEISNASRPIKQKEIDLCAEKNIEYIE 115

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
                    ++V+  +  +  +TV++L  A A             + KW+++   +P+  
Sbjct: 116 IPVAYDALSVVVNKDNDWAECMTVDELKTAWAKG-------AQGKISKWNQVNSKYPDAP 168

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           + +Y P    GT +   + +  E      +F+                            
Sbjct: 169 LTLYGPGTDSGTFDYFNEAITDEEG-SRGDFAT--------------------------- 200

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV----PSMGTIVSGLY-P 281
              D    +  +  +K+  G+ G S+Y+ N D L+ V IDG      PS  T++ G Y P
Sbjct: 201 -SEDDNTIVRGVAGDKNAMGYFGYSYYEENKDSLRAVQIDGGDGCITPSDATVLDGTYSP 259

Query: 282 ISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           ++RPL  YV +   +    ++ +V F +     A    +   G  P+ ++          
Sbjct: 260 LARPLFIYVSKTAMD-RPEMKSFVEFYLDP---ANKELVADVGYFPMPDDIYGKALARAQ 315

Query: 342 VGKSG 346
            GK+G
Sbjct: 316 EGKTG 320


>gi|268317381|ref|YP_003291100.1| phosphate binding protein [Rhodothermus marinus DSM 4252]
 gi|262334915|gb|ACY48712.1| phosphate binding protein [Rhodothermus marinus DSM 4252]
          Length = 338

 Score =  196 bits (497), Expect = 4e-48,   Method: Composition-based stats.
 Identities = 72/352 (20%), Positives = 136/352 (38%), Gaps = 61/352 (17%)

Query: 9   MCFVVLEVYCGTGTFARNRIR----IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           +  V++   CG G     ++     I GSST++P ++ +AE F + +P  +   V   G+
Sbjct: 4   VLLVLMVAGCGRGQQQEGQLTGSVQIDGSSTVYPLTEAVAEEFMKQYPGVRV-TVGISGT 62

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G  +F         DI ++SR I   E    +++GV  I+         ++V+ ++  
Sbjct: 63  GGGFSKFV----RKETDINDASRPIRPVEDSLARQNGVEYIELPVAYDGIAVVVNPQNDW 118

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
              LTVE+L +                + +W+++R  FP   + +Y      GT +    
Sbjct: 119 VECLTVEELRRIWEPNS---------TITRWNQVRSSFPNRPLNLYGAGTDSGTYDYFTA 169

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
            ++ E      +F+                               D    +  I  + + 
Sbjct: 170 AIVGEEHASRSDFTA----------------------------SEDDNVLVQGISGDPNA 201

Query: 245 FGFVGLSFYKNNADVLKLVPID---------GIVPSMGTIVSGLY-PISRPLLFYVKRQH 294
            GF+ L++Y+ N D LK V ID          I PS  T+ +G Y P++RP+  YV  + 
Sbjct: 202 LGFIPLAYYEENMDKLKAVAIDDGNPDNGEGCIHPSPETVNNGTYQPLARPIFIYVNAER 261

Query: 295 FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            N    +  ++ F +            + G +P++ E  +   +      +G
Sbjct: 262 AN-DPAVEAFIEFYL----QHAAKLAPEVGYVPLTAEAYELALERFRNRVTG 308


>gi|11498952|ref|NP_070185.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           (phoX) [Archaeoglobus fulgidus DSM 4304]
 gi|2649219|gb|AAB89890.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           (phoX) [Archaeoglobus fulgidus DSM 4304]
          Length = 327

 Score =  196 bits (496), Expect = 5e-48,   Method: Composition-based stats.
 Identities = 75/329 (22%), Positives = 149/329 (45%), Gaps = 48/329 (14%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
           G G      +++AGSST++P +  +AE F++ +PE     V+S G+  G + F       
Sbjct: 34  GQGKEISGEVKVAGSSTVYPITAAMAEEFNKLYPEV-VVSVQSTGTGGGFRNF---FIPG 89

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
             DI ++SR I Q+ELDE +K+GV  ++ +       ++V+  +  +  L+ +DL K   
Sbjct: 90  LTDINDASRPIKQSELDEARKNGVEPLEFLVGYDALTVIVNPENDWAECLSFDDLRKIW- 148

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                        + +WS++ P++P+  + +Y P+   GT +   + V+ E     +++ 
Sbjct: 149 ------GPDATESITRWSQVNPEWPDEEMHLYGPTSASGTFDFFTEHVIGESGAHRQDY- 201

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
                                          +    +  +  +KD  G++GL++Y  N D
Sbjct: 202 ---------------------------HGTEEDNTIIQAVARDKDAMGYLGLAYYLENKD 234

Query: 259 VLKLVPI-----DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
            +K   I     + + PS+ T  SG YP++RPL  YV ++       +RE+V F + +  
Sbjct: 235 KVKAAKIKSEQGECVEPSIETGQSGEYPLARPLFIYVNKESL-KKPAVREFVKFYLEN-- 291

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIAV 342
                 + + G +P+S ++++     ++ 
Sbjct: 292 -LDSGIVEEIGYVPVSKDQKEENLKKLSE 319


>gi|218439749|ref|YP_002378078.1| phosphate binding protein [Cyanothece sp. PCC 7424]
 gi|218172477|gb|ACK71210.1| phosphate binding protein [Cyanothece sp. PCC 7424]
          Length = 341

 Score =  196 bits (496), Expect = 6e-48,   Method: Composition-based stats.
 Identities = 69/351 (19%), Positives = 137/351 (39%), Gaps = 49/351 (13%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           +   ++    ++L+      +     I+I GSST++P ++ I E +++          ES
Sbjct: 11  KRVTILATSAILLQACSQVSSENTEPIKIDGSSTVYPITQKIVEKYNQGNASDPVEIQES 70

Query: 62  -GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G++ G  +FC G      DI  +SR I++ E+ +C    V  I+         ++V+ 
Sbjct: 71  VSGTTGGFNKFCAG----ETDINAASRPISEQEMQDCASKEVRYIELPIAFDAITVVVNQ 126

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++  +  ++VEDL K                +  W+++ PD+P+  + ++ P    GT +
Sbjct: 127 QNDWAEDISVEDLRKMWQPE-------AEGKITNWNQVNPDWPDRPLNLFAPGKDSGTFD 179

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + +         ++                                D    +  +  
Sbjct: 180 YFTEAITGTTDSSRTDYVA----------------------------SEDDETIVTGVSQ 211

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIV----PSMGTIVSGLY-PISRPLLFYVKRQHF 295
           + +  G+ G ++Y+ N D LK + ID       PS  T+ +  Y P++RPL  YV  +  
Sbjct: 212 DPNALGYFGYAYYERNQDKLKPLGIDNGQGAVLPSPETVENAQYQPLARPLFIYVNAKTA 271

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            +   L E+V F + +      + + + G IP+  E            K G
Sbjct: 272 QNKPALEEFVKFYLKNA----PTAVSEVGYIPLPEEGYHLANIHFNRFKVG 318


>gi|82702026|ref|YP_411592.1| phosphate binding protein [Nitrosospira multiformis ATCC 25196]
 gi|82410091|gb|ABB74200.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Nitrosospira multiformis ATCC 25196]
          Length = 332

 Score =  195 bits (495), Expect = 8e-48,   Method: Composition-based stats.
 Identities = 79/353 (22%), Positives = 141/353 (39%), Gaps = 51/353 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCG--TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           M     + +  VVL    G  +  +A   I+I GSST+FP ++ +AE+F           
Sbjct: 1   MLKLLRIEIVVVVLGALLGAVSPVYAEPVIKIDGSSTVFPITEAVAEDFQIAKKGAAKVT 60

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           V   G+  G K+FCRG     IDI N+SR I + E+D CK  GV  ++         ++ 
Sbjct: 61  VGISGTGGGFKKFCRG----EIDIANASRPILKKEMDACKAAGVQYVEMPVAYDALTVVA 116

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           + R+     +TV DL K                +  W +I P +P+  I +Y P    GT
Sbjct: 117 NPRNDWVKVITVADLKKIWEPD-------AQGKITSWKQINPAWPDEPIKLYGPGADSGT 169

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
            +   + ++ +      +F+                               D    +  +
Sbjct: 170 FDYFTEAIVGKAKSSRGDFTA----------------------------SEDDNVLVQGV 201

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPIDGIV----PSMGTIVSGLY-PISRPLLFYVKRQ 293
             +K+  G+ G ++Y  N   L+ + +DG      PS+ T+  G Y P+SRP+  Y+  +
Sbjct: 202 ASDKNALGYFGFAYYNENQKKLRALAVDGGKGGIIPSVETVEDGSYQPLSRPIFIYISIK 261

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                  +RE++ F + +        + +    P+  +   +  + +   K G
Sbjct: 262 ATEK-PEVREFIEFYMKNA----SPLVKEVKYFPLPAQAYTTNLEHLNKKKLG 309


>gi|39996201|ref|NP_952152.1| phosphate ABC transporter ATP-binding protein [Geobacter
           sulfurreducens PCA]
 gi|39982966|gb|AAR34425.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Geobacter sulfurreducens PCA]
          Length = 342

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 73/363 (20%), Positives = 147/363 (40%), Gaps = 61/363 (16%)

Query: 1   MRFFFV----------VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEY 50
           M+   +          +    + L +       A   ++I GSST++P ++ +AE F + 
Sbjct: 1   MKKLTLGGKIGRITPALAAAVMGLTITASPVLAADKLVKIDGSSTVYPITEAVAEEFQKA 60

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
                   V   G+  G K+FCRG     ID+  +SR I + E++ CK+ G+  I+    
Sbjct: 61  KRGAVKVTVGISGTGGGFKKFCRG----EIDLSGASRPILKKEMEACKQAGIQYIELPVA 116

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
                ++V+ ++    S+TV++L K         +      + KW+++ P +P   + ++
Sbjct: 117 YDALTVVVNPQNTWVKSMTVDELKKIW-------EPAAQGKITKWNQVNPAWPNQPLKLF 169

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
            P    GT +   + V+ +      +F+                               D
Sbjct: 170 GPGADSGTFDYFTEAVVGKAKSSRGDFTA----------------------------SED 201

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI------DGIVPSMGTIVSGLY-PIS 283
               +  +  ++   G+ G ++Y  N+  LK VPI        + PS+ T+ +G Y P+S
Sbjct: 202 DNVLVQGVSRDRGGLGYFGYAYYAENSKKLKAVPIVEKAGKPAVSPSIDTVKNGSYQPLS 261

Query: 284 RPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           RP+  YV  +  +    ++E+V F ++               +P+ ++     + + A  
Sbjct: 262 RPIFIYVNAKSVDK-PEVKEFVDFYLN----QAPKLSKAVKYVPLPDKAYALAKSNFAKK 316

Query: 344 KSG 346
           K+G
Sbjct: 317 KTG 319


>gi|298674020|ref|YP_003725770.1| phosphate-binding protein [Methanohalobium evestigatum Z-7303]
 gi|298287008|gb|ADI72974.1| phosphate binding protein [Methanohalobium evestigatum Z-7303]
          Length = 344

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 78/350 (22%), Positives = 152/350 (43%), Gaps = 51/350 (14%)

Query: 3   FFFVVLMCFVVLEVYCGTG------TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKT 56
              V ++ F V    C +            ++ + GSST++P S+ +AE F +  P   T
Sbjct: 32  LMLVGILIFSVALAGCASNNGNGENQQLSGQVIVDGSSTVYPVSQAMAEEFKKQHPGVTT 91

Query: 57  PFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGIL 116
             V S G+  G K+F +G      DI ++SR I  +E  +CK++G+  ++         +
Sbjct: 92  S-VTSSGTGGGFKKFVQG----ETDINDASRPIKPSESQKCKENGIEYVEFKVATDGISV 146

Query: 117 LVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKH 176
           +V+       S++ + L +              NP +KWS+++ ++P+  + +Y P+   
Sbjct: 147 VVNQNADWIDSVSKDTLAEIWGPE---------NPPQKWSDVKSEWPDKNVELYGPTSAS 197

Query: 177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
           GT +   + ++ E      ++                                +    + 
Sbjct: 198 GTFDFFTEHIVGEEDASRTDYQTT----------------------------ENDNFIIK 229

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFN 296
            +  +++  G++G ++Y+ N + +K + I+G+ P+  TI SG YP+SRPL FYV   H  
Sbjct: 230 GVRGSENAMGYLGYAYYQQNENSVKAIGINGVKPTEQTISSGEYPLSRPLFFYVNIDHLK 289

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
               LRE+V F +     +    + Q G +P +  ++K + D      +G
Sbjct: 290 ENEALREFVKFYIE---KSDSEIINQVGYVPATESQQKDLMDKFEKVMNG 336


>gi|298505213|gb|ADI83936.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Geobacter sulfurreducens KN400]
          Length = 342

 Score =  195 bits (494), Expect = 1e-47,   Method: Composition-based stats.
 Identities = 72/363 (19%), Positives = 146/363 (40%), Gaps = 61/363 (16%)

Query: 1   MRFFFV----------VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEY 50
           M+   +          +    + L +       A   ++I GSST++P ++ +AE F + 
Sbjct: 1   MKKLTLGGKIGRITPALAAAVMGLTITASPVLAADKLVKIDGSSTVYPITEAVAEEFQKA 60

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
                   V   G+  G K+FCRG     ID+  +SR I + E++ CK+ G+  I+    
Sbjct: 61  KRGAVKVTVGISGTGGGFKKFCRG----EIDLSGASRPILKKEMEACKQAGIQYIELPVA 116

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
                ++V+ ++    S+TV++L K         +      +  W+++ P +P   + ++
Sbjct: 117 YDALTVVVNPQNTWVKSMTVDELKKIW-------EPAAQGKITSWNQVNPAWPNQPLKLF 169

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
            P    GT +   + V+ +      +F+                               D
Sbjct: 170 GPGADSGTFDYFTEAVVGKAKSSRGDFTA----------------------------SED 201

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI------DGIVPSMGTIVSGLY-PIS 283
               +  +  ++   G+ G ++Y  N+  LK VPI        + PS+ T+ +G Y P+S
Sbjct: 202 DNVLVQGVSRDRGGLGYFGYAYYAENSKKLKAVPIVEKAGKPAVSPSIDTVKNGSYQPLS 261

Query: 284 RPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
           RP+  YV  +  +    ++E+V F ++               +P+ ++     + + A  
Sbjct: 262 RPIFIYVNAKSVDK-PEVKEFVDFYLN----QAPKLTKAVKYVPLPDKAYALAKSNFAKK 316

Query: 344 KSG 346
           K+G
Sbjct: 317 KTG 319


>gi|159030987|emb|CAO88689.1| sphX [Microcystis aeruginosa PCC 7806]
          Length = 344

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 69/350 (19%), Positives = 134/350 (38%), Gaps = 49/350 (14%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           +    +L   ++              I+I GSST+ P +  + E+F    P      V+ 
Sbjct: 13  KVVATILGTALLFPACANINPQDLKPIKIDGSSTVAPITDKVLEDFKANPPHKALADVKV 72

Query: 62  ----GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
                G+  G ++FC G      DI N+SR I+  EL +C  + +  I+         ++
Sbjct: 73  DANISGTGGGFRKFCAG----ETDINNASRPISVEELKKCDANKIRFIELPIAFDALTVV 128

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+ ++     ++  +L         + +    N +K+W++I P +P+  I ++ P    G
Sbjct: 129 VNPQNNWVDDISTTEL-------RTIWEPAAENKIKRWNQINPAWPDRPITLHGPGKDSG 181

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +   + +  +      +F                                D    +  
Sbjct: 182 TYDFFSEVINGK-DASRGDF----------------------------NFSEDDQALVNA 212

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  + +  G+ G ++Y+ N D LK + ++GI P+   +    Y P+SRPL  YV  Q   
Sbjct: 213 VSQDPNALGYFGHAYYEQNRDKLKALKVNGIEPTRSNVEDSKYQPLSRPLFIYVNAQKAQ 272

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
               L ++V + +        + L   G IP+ +E     R  +   + G
Sbjct: 273 ENPALEKFVKYYLD----RVPNLLDSIGYIPLPDEAYHLARVQLQKFEVG 318


>gi|166364580|ref|YP_001656853.1| phosphate transport system substrate-binding protein [Microcystis
           aeruginosa NIES-843]
 gi|166086953|dbj|BAG01661.1| phosphate transport system substrate-binding protein [Microcystis
           aeruginosa NIES-843]
          Length = 344

 Score =  193 bits (490), Expect = 3e-47,   Method: Composition-based stats.
 Identities = 72/350 (20%), Positives = 131/350 (37%), Gaps = 49/350 (14%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV-- 59
           +   +VL   ++L             I+I GSST+ P +  + E+F    P      V  
Sbjct: 13  KVVAIVLGTALILPACANINPQDLKPIKIDGSSTVAPITDKVLEDFKANTPNKALADVKI 72

Query: 60  --ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
                G+  G ++FC G      DI N+SR I+  EL EC  + V  I+         ++
Sbjct: 73  DANISGTGGGFRKFCAG----ETDINNASRPISVEELKECDANKVRFIELPIAFDALTVV 128

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+ ++     ++  +L           +    N +K+W++I P + +  I ++ P    G
Sbjct: 129 VNPQNNWLDDISTRELKTIW-------EPAAENKIKRWNQINPAWTDRPITLHGPGKDSG 181

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +     +  +      +F                                D    +  
Sbjct: 182 TYDFFSDVINGK-DASRGDF----------------------------NFSEDDQALVNA 212

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  + +  G+ G ++Y+ N D LK + ++GI P+   +    Y P+SRPL  YV  Q   
Sbjct: 213 VSQDPNALGYFGHAYYEQNRDKLKALKVNGIEPTRSNVEDSKYQPLSRPLFIYVNAQKAQ 272

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
               L ++V   +        + L   G IP+ +E     R  +   + G
Sbjct: 273 ENPALEKFVEHYLD----RVPNLLDNIGYIPLPDEAYHLARVQLQKFEVG 318


>gi|315186297|gb|EFU20058.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Spirochaeta thermophila DSM 6578]
          Length = 310

 Score =  193 bits (489), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 71/347 (20%), Positives = 142/347 (40%), Gaps = 50/347 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA-----RNRIRIAGSSTLFPYSKIIAENFSEYFPEFK 55
           MR    +L   V+   +   G           IRIAGSST++P +  +AE F+   P  +
Sbjct: 1   MRRVLSLLAGIVLASGFVWAGGQGESGALSGTIRIAGSSTVYPITVAMAEEFNRVQPGVQ 60

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
              V+S G+  G K F         +I ++SR I ++EL++ +  G   ++         
Sbjct: 61  IA-VQSTGTGGGFKNF---FIPGKTEINDASRPIKESELEQVRAQGDDALEFQVAIDAVT 116

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
           ++V+ +      +T+E L                +P +KWS++ P +P+    +Y P+  
Sbjct: 117 VVVNPQADWVDDVTIEQLRHIWRPD---------DPAQKWSDVDPSWPDEPFELYGPTSA 167

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GT +   +KV+ E  +   ++                                +    +
Sbjct: 168 SGTFDFFTEKVMGEEDLSRSDYQ----------------------------GTEEDNTIV 199

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHF 295
             +  +K   G+ G+++Y  N + +K + ++G+ PS+ T  +  YP+SRP+  YV++   
Sbjct: 200 QAVSGSKYALGYFGMAYYLENTNRVKALKVNGVAPSLETARTYEYPLSRPIFIYVRKSAL 259

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
                +  +V F +          + + G +P+++E  K     +  
Sbjct: 260 A-RPEVAAFVRFYIE---RTNSDLISEIGYVPVTDEVVKENLAKLEK 302


>gi|172036774|ref|YP_001803275.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
 gi|171698228|gb|ACB51209.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
          Length = 340

 Score =  192 bits (488), Expect = 4e-47,   Method: Composition-based stats.
 Identities = 70/346 (20%), Positives = 143/346 (41%), Gaps = 48/346 (13%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++L   V + +           I I GSST++P +K + E++ +         V+  G+ 
Sbjct: 15  LLLSLGVSVGIVSCASPELSKSITIDGSSTVYPITKAVVESYQQTVENPVEVMVDFSGTG 74

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G ++FC G      DI N+SR I ++E+  C ++ V  I+         ++V+ ++   
Sbjct: 75  GGFRKFCEG----KTDINNASRPILKDEMALCNRNNVRYIELPIAFDALTIVVNPQNTWV 130

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
            SLT E+L K                + +W+++RP+FP+  + +Y P    GT +   + 
Sbjct: 131 ESLTTEELRKIWQPE-------AEKTITRWNQVRPEFPDQPLTLYGPGTDSGTYDYFTEA 183

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           ++        ++                                +    +  ++ + +  
Sbjct: 184 IMGTEDSSRTDY----------------------------VRSENDEILVQGVKQDPNAL 215

Query: 246 GFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLG 300
           G+ GL++Y+ +   LK + ID     ++PS  ++    Y P++RPL  YV      +   
Sbjct: 216 GYFGLAYYEAHPTELKAIAIDSGKGAVLPSSESVKDSQYQPLARPLFIYVNLASAQNNPS 275

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           LRE++ F +        + + + G IP+  E     + +   G++G
Sbjct: 276 LREFIDFYL----AQAPTLVEKVGYIPLPIEAYDLDKVTFHKGEAG 317


>gi|307718240|ref|YP_003873772.1| phosphate ABC transporter phosphate-binding protein [Spirochaeta
           thermophila DSM 6192]
 gi|306531965|gb|ADN01499.1| phosphate ABC transporter, phosphate-binding protein [Spirochaeta
           thermophila DSM 6192]
          Length = 310

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 71/347 (20%), Positives = 141/347 (40%), Gaps = 50/347 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA-----RNRIRIAGSSTLFPYSKIIAENFSEYFPEFK 55
           MR    +L   V+   +   G           IRIAGSST++P +  +AE F+   P  +
Sbjct: 1   MRRVLSLLAGIVLASGFVWAGGQGESGDLSGTIRIAGSSTVYPITVAMAEEFNRIQPGVQ 60

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
              V+S G+  G   F         +I ++SR I ++EL++ +  G   ++         
Sbjct: 61  IA-VQSTGTGGGFTNF---FIPGKTEINDASRPIKESELEQVRAQGDDALEFQVAIDAVT 116

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
           ++V+        +T+E L                +P +KWS++ P +P+    +Y P+  
Sbjct: 117 VVVNPHADWVDDVTIEQLRHIWRPD---------DPAQKWSDVDPSWPDEPFELYGPTSA 167

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GT +   +KV+ E  +   ++                                +    +
Sbjct: 168 SGTFDFFTEKVMGEEDLSRSDYQ----------------------------GTEEDNTIV 199

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHF 295
             +  +K   G+ G+++Y  N + +K + ++G+ PS+ T  +  YP+SRP+  YV++   
Sbjct: 200 QAVSGSKYALGYFGMAYYLENTNRVKALKVNGVAPSLETARTYEYPLSRPIFIYVRKSAL 259

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
                +  +V F +        S + + G +P+++E  K     +  
Sbjct: 260 A-RPEVAAFVRFYIE---RTNSSLISEIGYVPVTDEVVKENLAKLEK 302


>gi|119485718|ref|ZP_01619993.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Lyngbya sp. PCC 8106]
 gi|119457043|gb|EAW38170.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Lyngbya sp. PCC 8106]
          Length = 313

 Score =  192 bits (488), Expect = 5e-47,   Method: Composition-based stats.
 Identities = 66/338 (19%), Positives = 135/338 (39%), Gaps = 46/338 (13%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           +  +   V        +     +++ GSST++P ++ +AE F +         V   G+ 
Sbjct: 19  LTAIAATVALSIPAVRSQGTPTVKVDGSSTVYPITEAVAEEFQKAKQGAMRVTVGISGTG 78

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G K+FC G      DI N+SR I  +E   CK  G++ I E+ + +D I +V       
Sbjct: 79  GGFKKFCSG----QTDISNASRPIKDSEAQACKSAGINYI-ELPVAYDAITVVVHPSNPL 133

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
            S++  +L K         +      + KW++I   +P+  + +Y P    GT +   ++
Sbjct: 134 TSISTAELKKMW-------EPAAQGKIMKWNQINSAWPDKALKLYGPGADSGTFDYFTEE 186

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           +  +      +++                               D    +  +  ++   
Sbjct: 187 INGKSQASRTDYTP----------------------------SEDDNVLVQGVSRDQGAL 218

Query: 246 GFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREY 304
           G+ G ++Y+NN   LK + I+G+ PS+ T+ +G Y P+SRP+  YV          ++ +
Sbjct: 219 GYFGYAYYENNKGKLKSLAINGVKPSLDTVNNGSYKPLSRPIFIYVSTNAL-KRPEVKAF 277

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           V + +            + G +P+ +  ++     +  
Sbjct: 278 VEYYL----QNSAELSKEVGYVPLPSNMQQQALSRLQS 311


>gi|307151021|ref|YP_003886405.1| phosphate-binding protein [Cyanothece sp. PCC 7822]
 gi|306981249|gb|ADN13130.1| phosphate binding protein [Cyanothece sp. PCC 7822]
          Length = 333

 Score =  191 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 82/351 (23%), Positives = 148/351 (42%), Gaps = 51/351 (14%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
           F    L+        C      ++++ I G++  FP S  +AE + +  PE +   V S 
Sbjct: 11  FLLTFLLFITYSLSACSGSEQKQSQVSIDGAAVGFPISLAVAEEYGKLNPEAQIS-VASS 69

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           G+  G  +FC G      DIV +SR I + E++ CKK+GV  I+         ++V+ ++
Sbjct: 70  GTGGGFSKFCAGDL----DIVGASRTIKEEEIERCKKNGVEFIELPIALDGIAVIVNRKN 125

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
             +  LT+++L K   +            +  W++I P+FP+  + +Y P+   GT +  
Sbjct: 126 DFAKCLTIKELAKMWNAK-------ADEKVLSWNQINPNFPDEPLKLYAPASDTGTFDYF 178

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            + +  +      ++S                               +    +  +  + 
Sbjct: 179 TQAITGKAKNSRTDYSPSH----------------------------NQNLLVQGVAGDT 210

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIV-------PSMGTIVSGLYPISRPLLFYVKRQHF 295
              G+VGLS+Y  N D L LV I+G         P    I +   P+SRPL  YV ++  
Sbjct: 211 SALGYVGLSYYLQNQDKLNLVAIEGPDGKCQKPVPVDNVIKNIYNPLSRPLFIYVNKKAL 270

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +    LRE++ F + +     DS     G +P+ +E    V + +A G++G
Sbjct: 271 DGKASLREFLDFYLRNSWKWVDS----VGYVPLPDEAYSKVINKLATGETG 317


>gi|300869540|ref|ZP_07114122.1| periplasmic phosphate-binding protein of ABC transporter
           [Oscillatoria sp. PCC 6506]
 gi|300332513|emb|CBN59320.1| periplasmic phosphate-binding protein of ABC transporter
           [Oscillatoria sp. PCC 6506]
          Length = 342

 Score =  191 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 74/347 (21%), Positives = 138/347 (39%), Gaps = 48/347 (13%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
            +      +L       +     I+I GSST++P +  IA++F +         VE  G+
Sbjct: 16  ILAFSAIALLNSCAQVQSQTSQPIKIDGSSTVYPITDAIAKDFQKTQGAKVAITVEFSGT 75

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K+FC G     IDI N+SR I   E++ C K G+   +         ++V+ ++  
Sbjct: 76  GGGFKKFCAG----EIDISNASRPIRPEEMEACNKAGIRYYELPIAFDALTVVVNPKNSW 131

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           +  +TV +L K         +      + KW++IR  +P   I +Y      GT +   +
Sbjct: 132 AKDITVAELKKLW-------EPAAQGKITKWNQIRTSWPNQPINLYGAGKDSGTFDYFTE 184

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
             + E      +++                               D    +  +  + + 
Sbjct: 185 ATVGEAKASRTDYTA----------------------------SEDDNVLVQGVTKDPNA 216

Query: 245 FGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVL 299
            G+ GLS+Y+ N   LK + ID     ++P+  T+    Y P++RPL  YV      +  
Sbjct: 217 LGYFGLSYYEANPTQLKALGIDNGQGSVMPTRETVEKAQYKPLTRPLFIYVSYSAAQTKS 276

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            +R++V F +        + +   G IP+  +  + + ++   GK G
Sbjct: 277 EVRDFVEFYME----KAPTLVNSVGYIPLPKDGYQLIYNNFYNGKVG 319


>gi|46200028|ref|YP_005695.1| phosphate-binding protein [Thermus thermophilus HB27]
 gi|46197655|gb|AAS82068.1| phosphate-binding protein [Thermus thermophilus HB27]
          Length = 322

 Score =  191 bits (483), Expect = 2e-46,   Method: Composition-based stats.
 Identities = 75/351 (21%), Positives = 142/351 (40%), Gaps = 58/351 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR    +L    +  +          +IR  GSST++P ++ +AE F+   P  +   V 
Sbjct: 1   MRGKAWMLTAVALTGLGLA-------QIRADGSSTVYPITQAVAEEFTARNPNIRV-VVA 52

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G K+FCRG      DI N+SR I   EL+ C+++G+  I+         ++V+ 
Sbjct: 53  FSGTGGGFKKFCRG----ETDIQNASRPIRPEELEVCQENGIQFIELPVAYDALTVIVNP 108

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++  +  L   +L                  +++WS+IR  +P   + +Y      GT +
Sbjct: 109 KNTWAACLKTSELKAIWEPGS---------KIQRWSQIRQGWPNQPLRLYGAGADSGTFD 159

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + ++ +      ++                                D   T+  +  
Sbjct: 160 YFTEAIVGKAKAIRTDYQPT----------------------------EDDNVTIKGVAG 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIV----PSMGTIVSGLY-PISRPLLFYVKRQHF 295
           +    GF+G ++Y+ N D +K V ID       PS  T++ G Y P+SRPL  YV  +  
Sbjct: 192 DTYAMGFLGYAYYEENKDKVKAVAIDHGKGCVLPSRETVLDGTYQPLSRPLFIYVNVKSL 251

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +    ++ +V F +S         +   G + + +E  +  ++ +   K+G
Sbjct: 252 D-RPEVQAFVDFYLSPAA---RRAIRSTGYVELPSEAYRIGQELVKRRKAG 298


>gi|218248788|ref|YP_002374159.1| phosphate-binding protein [Cyanothece sp. PCC 8801]
 gi|257061847|ref|YP_003139735.1| phosphate binding protein [Cyanothece sp. PCC 8802]
 gi|218169266|gb|ACK68003.1| phosphate binding protein [Cyanothece sp. PCC 8801]
 gi|256592013|gb|ACV02900.1| phosphate binding protein [Cyanothece sp. PCC 8802]
          Length = 340

 Score =  190 bits (481), Expect = 3e-46,   Method: Composition-based stats.
 Identities = 68/360 (18%), Positives = 146/360 (40%), Gaps = 57/360 (15%)

Query: 1   MRFFFV---------VLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYF 51
           M+   +         +L   + + +           I I GSST++P ++ + E++ +  
Sbjct: 1   MKQIVLNSRQFVPSWLLSLGIGIGIVSCGSPELPESITIDGSSTVYPITQAVVESYKQTA 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
               T  +   G+  G +EFC G      DI N+SR I + E+  C ++ V  I+     
Sbjct: 61  KNPVTITLSVSGTGGGFREFCEG----KTDISNASRPILREEMTLCNRNNVRYIELPIAF 116

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               ++V+ ++    ++T E+L +              + + +W++IR + P   + +Y 
Sbjct: 117 DALTVVVNPQNTWLDTITTEELKRIWQPE-------AGDTITRWNQIRQELPNQPLNLYG 169

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P    GT +   + ++ +      ++                                + 
Sbjct: 170 PGIDSGTYDYFTEAIVGKAHSSRLDY----------------------------FQSEND 201

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPL 286
              +A ++ + +  G+ GL++Y+ +A  LK + ID     + PS  ++ +  Y P++RPL
Sbjct: 202 EIIVAAVKQDPNALGYFGLAYYEAHAKELKALAIDNGKGAVAPSRESVETAQYQPLARPL 261

Query: 287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
             YV      +   LRE++ F +        + + + G IP+  E  +  + +   G++G
Sbjct: 262 FIYVNLASAQNNTSLREFIDFYL----AQAPTLVPKVGYIPLPQEAYQLDKITFHKGEAG 317


>gi|158320151|ref|YP_001512658.1| phosphate binding protein [Alkaliphilus oremlandii OhILAs]
 gi|158140350|gb|ABW18662.1| phosphate binding protein [Alkaliphilus oremlandii OhILAs]
          Length = 319

 Score =  189 bits (480), Expect = 5e-46,   Method: Composition-based stats.
 Identities = 85/360 (23%), Positives = 153/360 (42%), Gaps = 67/360 (18%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNR---------------IRIAGSSTLFPYSKIIAEN 46
           +F  + ++  + + +  G G+ + ++               IRI GSST+FP ++ IAE 
Sbjct: 7   KFTSLSIILVIAMLILAGCGSKSPDKSGQALKGNEGKLSGEIRIDGSSTVFPITEAIAEE 66

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           F     + + P V   G+  G K+F         D+ ++SR I   E  + K +GV   +
Sbjct: 67  FRAVNSDVRVP-VGVSGTGGGFKKFIA----KETDVNDASRPIKDQEAKDAKANGVEYTE 121

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
                    +LV+ ++    +LTV++L K  A             +K WS++RP++P  +
Sbjct: 122 LKVAFDGLSVLVNPQNTWVDNLTVDELKKIWAPDS---------NIKMWSDVRPEWPAEQ 172

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           I  Y P    GT +   +++  E      +F+                            
Sbjct: 173 IKFYAPGTDSGTFDYFTEEINGESGAIRPDFT---------------------------- 204

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-P 281
              D    +  I  +K+  GF G ++Y+ N D +K VPID     + P+  TI SG Y P
Sbjct: 205 GSEDDNILVQGIAGDKNALGFFGYAYYEENKDKVKTVPIDNGDGPVEPTYDTIKSGAYAP 264

Query: 282 ISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           +SRP+  YV       +  ++E+++F +          + + G I + +EE ++  +SI 
Sbjct: 265 LSRPIFIYVNNDSLARL-EVKEFITFYLETA----KDIVREVGYIALPDEEYEAELESIK 319


>gi|83593370|ref|YP_427122.1| phosphate binding protein [Rhodospirillum rubrum ATCC 11170]
 gi|83576284|gb|ABC22835.1| phosphate binding protein, putative [Rhodospirillum rubrum ATCC
           11170]
          Length = 338

 Score =  188 bits (477), Expect = 9e-46,   Method: Composition-based stats.
 Identities = 97/310 (31%), Positives = 152/310 (49%), Gaps = 7/310 (2%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
                 AR++ RI GSST+F  +  +AE  S      + P VE  G+  G   FC GIG 
Sbjct: 28  ARAAEGARSQARIVGSSTMFALTAAVAERLSRLGLG-QAPLVEVTGTGAGFHRFCAGIGL 86

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKAL 137
           +T D+V +SR +T  E   C+ +GV DI E+ +GH  ++L         +LT   ++ AL
Sbjct: 87  ETPDLVAASRTMTDQERARCRANGVDDIGEIYLGHGAVVLARSWQTPFPALTRRMVWLAL 146

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
           A  +     +  NP + WS+I P  P V I I+ P    GTR+ L   ++  GC+     
Sbjct: 147 ADEVPRKWALETNPNRLWSDIAPGLPAVPIRIFGPPPSSGTRDYLASALMDPGCLAFPLL 206

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
           ++          +   AC  +R+DG  IE   D    + R+  +    GF+G + +  N 
Sbjct: 207 AERPAA------ERETACRRLREDGAFIEAGEDDDRLVKRLVDDPTAVGFIGYAAFHRNG 260

Query: 258 DVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
            ++  +PI+GI P++ TI  G YP++  L+ YVK  H   + GL  YV    +++ +  D
Sbjct: 261 HLVSAIPIEGIAPTIETITEGSYPLTTQLILYVKTAHLGLISGLDRYVQAFTAEQAIGED 320

Query: 318 SQLFQYGLIP 327
             L   GL+P
Sbjct: 321 GYLRALGLVP 330


>gi|325982675|ref|YP_004295077.1| phosphate binding protein [Nitrosomonas sp. AL212]
 gi|325532194|gb|ADZ26915.1| phosphate binding protein [Nitrosomonas sp. AL212]
          Length = 332

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 77/344 (22%), Positives = 142/344 (41%), Gaps = 49/344 (14%)

Query: 8   LMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVG 67
           +    +  ++      A   ++I GSST+FP ++ +AE+F           V   G+  G
Sbjct: 11  IAAVFLSALFYTGFASATPIVKIDGSSTVFPITEAVAEDFQIAKRGTIRVTVGISGTGGG 70

Query: 68  LKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS 127
            K+FC     + IDIVN+SR IT+ E++ CKK G   I+         ++V+ ++  S +
Sbjct: 71  FKKFC----RNEIDIVNASRPITELEMEACKKEGAQFIEMPIAFDALTVVVNPKNTWSRT 126

Query: 128 LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL 187
           +TVE+L K                +  W++I P +P+ +I +Y P    GT E   + ++
Sbjct: 127 ITVEELQKIWEPS-------AQGKITNWNQINPAWPDKKIKLYGPGADSGTFEYFTEAIV 179

Query: 188 QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGF 247
            +      +F+                               D    +  +  +    GF
Sbjct: 180 GKAKSSRGDFTA----------------------------SEDDNVLVQGVASDLYALGF 211

Query: 248 VGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
            G ++Y  N+  +  V ID    G++PS  T+ +  Y P+SRP+  YV  +       ++
Sbjct: 212 FGFAYYIENSKKINAVAIDSGDGGVLPSAATVENNSYKPLSRPIFIYVNAKSTEK-PEVK 270

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           E+++F +          + +    P+S E      + +   K G
Sbjct: 271 EFINFYM----QNATELVTEVKYFPLSKEVYDLNLEHLNKKKVG 310


>gi|302388937|ref|YP_003824758.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Thermosediminibacter oceani DSM 16646]
 gi|302199565|gb|ADL07135.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Thermosediminibacter oceani DSM 16646]
          Length = 318

 Score =  188 bits (477), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 81/350 (23%), Positives = 142/350 (40%), Gaps = 59/350 (16%)

Query: 4   FFVVLMCFVVLEVYCGTG-------TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKT 56
            F + +  V++   CG               I I GSST++P ++ +AE F   +P+   
Sbjct: 16  LFTLSLAAVLVVTACGASNRNQGGQANLSGSIEIDGSSTVYPITEAVAEEFMNTYPDVNI 75

Query: 57  PFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGIL 116
               SG      K F  G      DI N+SR I+  E  + K+ GV  I+         +
Sbjct: 76  TVGVSGTGGG-FKRFTAG----ETDISNASRPISDEEAAKAKESGVEYIELPVAYDGITV 130

Query: 117 LVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKH 176
           +V+  +     LTVE+L K  +             + KWS+IRP +P+ +I +Y P    
Sbjct: 131 VVNKENDWVDHLTVEELKKIWSPGS---------KVTKWSDIRPGWPDEKINLYGPGTDS 181

Query: 177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
           GT E   + V  E      +++                               D    + 
Sbjct: 182 GTFEYFTEAVNGEAKKSRSDYTA----------------------------SEDDNVLVQ 213

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVK 291
            +  ++   G+ G ++Y  N+D +K VPIDG    + P+  +I +G Y P++RP+  YV 
Sbjct: 214 GVSGDRYALGYFGFAYYLENSDKVKAVPIDGGSGPVEPTAESIKNGTYKPLARPIFIYVN 273

Query: 292 RQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           ++       ++E+V F + +        + + G +P+   E +   + I 
Sbjct: 274 KKSLE-RPEVKEFVKFYMENAA----ELVEEVGFVPMPESEYQENLNKIE 318


>gi|218295963|ref|ZP_03496743.1| phosphate binding protein [Thermus aquaticus Y51MC23]
 gi|218243701|gb|EED10229.1| phosphate binding protein [Thermus aquaticus Y51MC23]
          Length = 323

 Score =  188 bits (476), Expect = 1e-45,   Method: Composition-based stats.
 Identities = 75/350 (21%), Positives = 148/350 (42%), Gaps = 58/350 (16%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           +     L+  V+  +          +IR  GSST++P ++ +AE F++  P  K   V  
Sbjct: 3   KKLVAGLLMAVLASLGMA-------QIRADGSSTVYPITQAVAEEFTQRNPGVKVA-VAF 54

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            G+  G K+FCRG      DI N+SR I + EL+EC+K+G+  I+         ++V+ R
Sbjct: 55  SGTGGGFKKFCRG----ETDIQNASRPIKKAELEECEKNGIKFIEIPIAYDALSIIVNPR 110

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           +  +  L   ++                  ++ WS++R ++P+ RI ++      GT + 
Sbjct: 111 NTWATCLKTSEVRAIWEPNS---------KVQFWSDVRKEWPKARIVLFGAGTDSGTFDY 161

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
             + ++ +     +++                                D   T+  +   
Sbjct: 162 FTEAIMGKSGAIRKDYQPT----------------------------EDDNVTIRGVAAG 193

Query: 242 KDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
               GF+G+++ + N D +K V ID     ++P+   +++G Y P+SRPL  YV  +   
Sbjct: 194 LYAMGFLGVAYVEENKDKVKPVAIDNGRGCVLPTRENVLNGSYQPLSRPLFIYVNVKSLE 253

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
               ++++V F +S +       +   G I +  E     ++ +   K+G
Sbjct: 254 -RKEVQDFVDFYLSPQA---RRAIRSTGYIELPAEAYTIGQELVKRRKTG 299


>gi|254421495|ref|ZP_05035213.1| Bacterial extracellular solute-binding protein, putative
           [Synechococcus sp. PCC 7335]
 gi|196188984|gb|EDX83948.1| Bacterial extracellular solute-binding protein, putative
           [Synechococcus sp. PCC 7335]
          Length = 343

 Score =  187 bits (474), Expect = 2e-45,   Method: Composition-based stats.
 Identities = 80/362 (22%), Positives = 141/362 (38%), Gaps = 63/362 (17%)

Query: 5   FVVLMCFVVLEVYCGTGTFA--------------RNRIRIAGSSTLFPYSKIIAENFSEY 50
           F +L     L    G                      I+I GSST+FP S+ +AE F   
Sbjct: 21  FSILALSASLAACGGGTAEDPAADVSAADADSGVSGEIQIDGSSTVFPISEAMAEEFQIA 80

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
            P+ +     SG      K+FC G      DI N+SR I + E+  C + G+  I+    
Sbjct: 81  NPDTRVTVGVSGSGGG-FKKFCAG----ETDISNASRPIKEEEVALCDEAGIEFIEVPIA 135

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
                L+ +  +  +  LTVE L    +             ++ W+++ P+FP+  + ++
Sbjct: 136 YDGITLVTNPENDWAQCLTVEQLNAMWSPD-------AEGSVENWNQVDPEFPDEPLELF 188

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
            P    GT +    +V  E      +++                               D
Sbjct: 189 GPGTDSGTFDYFTDEVSGEEGASRGDYTA----------------------------SED 220

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISR 284
               +  +E      G+ G ++Y+ N D LK V I     + + PS  TI  G Y P+SR
Sbjct: 221 DNVIVTGVESTSGGLGYFGYAYYEENQDQLKSVEIENEAGECVAPSRETIADGSYNPMSR 280

Query: 285 PLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           PL FYV+++ +++   ++ +V + +  E       + + G I + ++     +  +  GK
Sbjct: 281 PLYFYVQKEAYDTKPQVKAFVDYQLDAE---NGELVQEAGYITLPDDALAQAKSRVEEGK 337

Query: 345 SG 346
            G
Sbjct: 338 LG 339


>gi|154247879|ref|YP_001418837.1| phosphate binding protein [Xanthobacter autotrophicus Py2]
 gi|154161964|gb|ABS69180.1| phosphate binding protein [Xanthobacter autotrophicus Py2]
          Length = 333

 Score =  187 bits (473), Expect = 3e-45,   Method: Composition-based stats.
 Identities = 70/326 (21%), Positives = 130/326 (39%), Gaps = 49/326 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +++ GSST+FP ++ +AE F +   + K   V   G+  G K+FCRG     IDI ++SR
Sbjct: 28  VKVDGSSTVFPVTEAMAEEFQKANKDIKV-TVGISGTGGGFKKFCRG----EIDISDASR 82

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            IT  E   CK+ G+  I+         ++V   +  +  +TV DL K            
Sbjct: 83  PITSAEQKACKEAGIEYIELPVALDALTVIVHPSNTWASEMTVADLKKIWEPE------- 135

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
               +  W ++R  +P+  + +Y      GT +     ++ +      +F+         
Sbjct: 136 AQGKITNWKQVRDSYPDRPLVLYGAGVDSGTYDYFTAAIVGKEHSSRGDFTA-------- 187

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID- 266
                                 D    +  +  + +  GF GL++Y+ N   LK V I  
Sbjct: 188 --------------------SEDDNVLVQGVAGDPNALGFFGLAYYEENTGKLKAVKIKV 227

Query: 267 -----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
                 + PS+    +G Y P+SRP+  YV ++   +   + ++V F    +       +
Sbjct: 228 DDAAPAVEPSVENARTGKYQPLSRPIFIYVNKKAAETRPEVAKFVEFY--QDPKHAVELV 285

Query: 321 FQYGLIPISNEERKSVRDSIAVGKSG 346
            + G +P+     K  ++     + G
Sbjct: 286 KEVGYVPLPEAALKVFQERFKKREIG 311


>gi|126660068|ref|ZP_01731189.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Cyanothece sp. CCY0110]
 gi|126618665|gb|EAZ89413.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Cyanothece sp. CCY0110]
          Length = 312

 Score =  185 bits (470), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 70/339 (20%), Positives = 138/339 (40%), Gaps = 44/339 (12%)

Query: 3   FFFVVLMCFVVLEVYCGT---GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           + F       +  V        +  R  I+I GSST++P ++ +AE F           V
Sbjct: 8   WLFAGAFALGLFLVNLSNIPVNSQGRQVIKIDGSSTVYPITEAVAEEFQNKKRGAVQVTV 67

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
              G+  G K+FC        DI N+SR I  +E + C K GV+ + E+ + +D I +V 
Sbjct: 68  GISGTGGGFKKFCSDNEAVKTDISNASRPIKDSEKEMCAKAGVTFM-EIPVAYDAITVVV 126

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            +D     +T  +L K         +    N + KW+++  ++P+  + +Y P    GT 
Sbjct: 127 SQDNPLTDITTAELKKMW-------EPAATNKITKWNQVNSNWPDATLKLYGPGADSGTF 179

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +    +V+ +      +++                               D    +  + 
Sbjct: 180 DYFTDEVIGKSGESRTDYTP----------------------------SEDDNVLVQGVA 211

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K    + G ++Y+ N + LK + +DG+ PS  T+  G Y P++RP+  YV      + 
Sbjct: 212 NDKQALAYFGYTYYEENKNKLKALKVDGVAPSSKTVSDGTYTPLARPIFIYVNLDAVKNN 271

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
             ++E+V + +     +    + +   IP ++ +    +
Sbjct: 272 SAVKEFVEYYLD----SAPELVKEVRSIPRTDYQAHKQK 306


>gi|218440272|ref|YP_002378601.1| phosphate binding protein [Cyanothece sp. PCC 7424]
 gi|218173000|gb|ACK71733.1| phosphate binding protein [Cyanothece sp. PCC 7424]
          Length = 349

 Score =  185 bits (469), Expect = 8e-45,   Method: Composition-based stats.
 Identities = 73/346 (21%), Positives = 144/346 (41%), Gaps = 48/346 (13%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++ +   ++ V C +       I+I GSST++P ++ + E F     +     +E  G++
Sbjct: 16  LLSLGIALILVSCASVPEESQDIKIDGSSTVYPITEKVVEEFKTNRKQDTNISLEVSGTT 75

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G ++FC G      DI N+SR I   E+  C ++GVS I+         ++V+  +  +
Sbjct: 76  GGFRQFCEG----KTDINNASRPILAEEMALCSRNGVSYIELPVAFDALTVVVNPNNTWA 131

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
            +LT ++L K         +      + +W++IR +FP+  + ++    K GT     + 
Sbjct: 132 KTLTTQELKKMW-------EPAAEGKISRWNQIRAEFPDRPLNLFGAGSKSGTFGYFNEA 184

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           ++       +++                                D    +  +  + D  
Sbjct: 185 IVGAEDASRQDYVAT----------------------------EDDNIIVQGVSQDPDAL 216

Query: 246 GFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLG 300
           G+ GLS+Y+ N + LK V ID     I P+   +    Y P++RPL  YV  +       
Sbjct: 217 GYFGLSYYEANQNKLKAVEIDSGKGAIAPTREAVAKAQYQPLARPLFIYVNLKASQEKED 276

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           LR++++F +       +  +   G IP++ E       +   G++G
Sbjct: 277 LRQFITFYL----KQVEEIVQAVGYIPLTEESYHINEITFNKGEAG 318


>gi|58698506|ref|ZP_00373410.1| putative periplasmic phosphate binding protein [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|58534974|gb|EAL59069.1| putative periplasmic phosphate binding protein [Wolbachia
           endosymbiont of Drosophila ananassae]
          Length = 283

 Score =  185 bits (468), Expect = 9e-45,   Method: Composition-based stats.
 Identities = 91/281 (32%), Positives = 151/281 (53%), Gaps = 3/281 (1%)

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES GS  G K FC GIG+DT DI  SSR + + E + CK++ ++++ E+ IG+DGI++ +
Sbjct: 2   ESIGSGSGFKMFCSGIGEDTPDITTSSRPMKEVERELCKRNKINEVIEIIIGYDGIVIAN 61

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
                    T +DL++ L++Y   +DK+V N  K WS++    P+  I IY P    GT 
Sbjct: 62  SNQSHRFDFTKKDLFETLSAYSQENDKLVKNNKKFWSDVNQALPKTEIEIYGPHQNTGTY 121

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           E L   ++ +      +  ++      + ++   AC ++R DG  IEV  +    + +++
Sbjct: 122 ETLVNSIMLDQYSCMNS--RIFKENYKDQEERKQACGNIRDDGRYIEVGINENIIIQKLK 179

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            NK+  G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H ++V 
Sbjct: 180 SNKNALGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPLYLYIKKEHLDTVD 239

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           GLRE+V   +    +     L + GLIP+S+E+ K     +
Sbjct: 240 GLREFVKEIIDSIGI-EGGYLSRLGLIPLSSEDIKKASAKV 279


>gi|110640183|ref|YP_680393.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Cytophaga hutchinsonii ATCC 33406]
 gi|110282864|gb|ABG61050.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Cytophaga hutchinsonii ATCC 33406]
          Length = 340

 Score =  184 bits (467), Expect = 1e-44,   Method: Composition-based stats.
 Identities = 74/362 (20%), Positives = 147/362 (40%), Gaps = 61/362 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGT------GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+    ++     L    G       G   +  I++ GSST+FP S+ ++E F    P  
Sbjct: 1   MKKLIFIVFVAAFLSSCGGGAKTENAGASEKTSIKVDGSSTVFPISEAVSEEFEIENPTV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           +     + G+  G K+F      + ID+  +SR I  +E  +C  + +  ++        
Sbjct: 61  QI-TANASGTGAGFKKFI----RNEIDVTGASRPIKASEDKDCAANNIQYLEIPIAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++VS  +  + +LTV +L K         +      +  W ++R  +P  +I +Y    
Sbjct: 116 AIVVSKENTWADNLTVAELKKIW-------EPAAKGTITHWDQVRAGWPHEKINLYGAGT 168

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
           + GT +   + ++ E      +++                               D    
Sbjct: 169 ESGTFDYFTEAIVGEARSCRTDYTA----------------------------SEDDNGL 200

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV---------PSMGTIVSGLY-PISR 284
           ++ +  +K   G+ G +++  N D LKLV ID            P++ TIV+G Y P+SR
Sbjct: 201 VSGVAGDKYSLGYFGYAYFFENQDKLKLVAIDDADEANGKGAVLPTIETIVNGTYQPLSR 260

Query: 285 PLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           PLL Y+ +        ++++V++ + +      + + + G + +S E  K V+     G 
Sbjct: 261 PLLIYINKVSSE-RPEVKKFVNYYIDNAQ----TLVPETGYVALSPEAYKLVKARFETGT 315

Query: 345 SG 346
           +G
Sbjct: 316 TG 317


>gi|219850474|ref|YP_002464907.1| phosphate binding protein [Chloroflexus aggregans DSM 9485]
 gi|219544733|gb|ACL26471.1| phosphate binding protein [Chloroflexus aggregans DSM 9485]
          Length = 692

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 73/330 (22%), Positives = 133/330 (40%), Gaps = 47/330 (14%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
                 I I GSST++P +   AE FS+  P  +   V   G+  G K+FC G      D
Sbjct: 68  ATLSGDILIDGSSTVYPVTAAAAEEFSKKAPNVRVS-VGISGTGGGFKKFCNG----ETD 122

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR I + E   C ++G+  I+         ++V+ ++  +  LTV +L K      
Sbjct: 123 ISNASRPIREEEQAICAQNGIEFIELPVAYDGLSVVVNPQNDWATCLTVAELKKMWEPD- 181

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
                     +  W++IR  FP   + +       GT +   + ++ +      ++    
Sbjct: 182 ------AQGKITNWNQIRDGFPNRPLVLLGAGTDSGTFDYFTEAIMGKAKASRGDYQAT- 234

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                                       D   T+  +  + +  G++G ++   N   +K
Sbjct: 235 ---------------------------EDDNVTITGVSGDLNALGYLGYAYVVENPGKIK 267

Query: 262 LVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            + IDG    + PS  TI +G Y P+SRPL  YV+++       ++ +++F + +E   P
Sbjct: 268 PIAIDGGKGCVEPSFETIANGTYVPLSRPLFIYVRKEAAE-RPEVQAFINFYLGEEFT-P 325

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
             Q  Q G + +S E  +++         G
Sbjct: 326 LIQTPQVGYVALSQELYRAIAKRFNDRVLG 355



 Score =  183 bits (464), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 72/330 (21%), Positives = 133/330 (40%), Gaps = 47/330 (14%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
                 I I GSST++P +   AE F++  P  +   V   G+  G K+FC G      D
Sbjct: 386 AALSGDILIDGSSTVYPVTAAAAEEFAQKAPNVRVS-VGISGTGGGFKKFCNG----ETD 440

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR I + E   C ++G+  I+         ++V+ ++  +  LTV +L K      
Sbjct: 441 ISNASRPIREEEQAICAQNGIEFIELPVAYDGLSVVVNPQNDWATCLTVAELKKMWEPD- 499

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
                     +  W++IR  FP   + +       GT +   + ++ +      ++    
Sbjct: 500 ------AQGKITNWNQIRDGFPNRPLVLLGAGTDSGTFDYFTEAIMGKAKASRGDYQAT- 552

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                                       D   T+  +  + +  G++G ++   N   +K
Sbjct: 553 ---------------------------EDDNVTITGVSGDLNALGYLGYAYVVENPGKIK 585

Query: 262 LVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            + IDG    + PS  TI +G Y P+SRPL  YV+++       ++ +++F + +E   P
Sbjct: 586 PIAIDGGKGCVEPSFETIANGTYVPLSRPLFIYVRKEAAE-RPEVQAFINFYLGEEFT-P 643

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
             Q  Q G + +S E  +++         G
Sbjct: 644 LIQTPQVGYVALSQELYRAIAKRFNDRVLG 673


>gi|71908105|ref|YP_285692.1| phosphate binding protein [Dechloromonas aromatica RCB]
 gi|71847726|gb|AAZ47222.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Dechloromonas aromatica RCB]
          Length = 331

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 66/353 (18%), Positives = 145/353 (41%), Gaps = 52/353 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M    V ++  + + ++      A+  I+I GSST++P ++ +AE F +         V 
Sbjct: 1   MIKKSVSILSILGVAIFGSNIAHAQ-VIKIDGSSTVYPITEAVAEEFQKAKKNVVKVTVG 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G K+FC     D +DI ++SR IT++E++ CK  GV  I+         ++V+ 
Sbjct: 60  ISGTGGGFKKFC----RDELDISDASRPITKSEMELCKAAGVQYIEMPVAFDALTVVVNP 115

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++      T+E++        ++ +      + KW+++ P +P+  + ++      GT E
Sbjct: 116 KNTFLKQATIEEMK-------VLWEPAAQGKITKWNQVNPAWPDAPVKLFGAGADSGTFE 168

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + ++ +      +++                               D    +  +  
Sbjct: 169 YFTEAMVGKAKSSRGDYTA----------------------------SEDDNVLVQGVSR 200

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           + +  G+ G ++Y  N+  L+ +PI        + PS   + +G Y P+SRP+  YVK +
Sbjct: 201 DVNAIGYFGYAYYAENSSKLRALPIVNPKTGKAVEPSAANVENGTYAPLSRPIFIYVKAK 260

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
             +    ++E++ F + +          +   +P+         + +   K G
Sbjct: 261 SLDK-PEVKEFIEFYMKNGAK----LTKEVKYVPLPASAYTGNVEHMTKKKLG 308


>gi|114331003|ref|YP_747225.1| phosphate binding protein [Nitrosomonas eutropha C91]
 gi|114308017|gb|ABI59260.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Nitrosomonas eutropha C91]
          Length = 337

 Score =  184 bits (466), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 82/344 (23%), Positives = 143/344 (41%), Gaps = 49/344 (14%)

Query: 8   LMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVG 67
           L+   +L         AR+ I+I GSST+FP ++ ++E+F               G+  G
Sbjct: 15  LITAFILLSGISGYIQARSLIKIDGSSTVFPITEAVSEDFQTAKKGATMVTAGISGTGGG 74

Query: 68  LKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS 127
            K+FCRG     IDIVN+SR I  +E+++C+++GV  I+         + V+ R+    S
Sbjct: 75  FKKFCRG----EIDIVNASRPILSSEMEQCRQNGVQYIEMPIAFDALTVAVNPRNNWIKS 130

Query: 128 LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL 187
           +T+ +L K         +      +  W++I P +P+ RI ++      GT +   + V+
Sbjct: 131 ITIAELKKMW-------EPAAQEKILNWNQINPAWPDARIKLFGAGADSGTFDYFTEAVV 183

Query: 188 QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGF 247
            +      +F+                               D    +  +  + +  GF
Sbjct: 184 GKAKSSRGDFTA----------------------------SEDDNVLVQGVASDLNALGF 215

Query: 248 VGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLR 302
            G ++Y  N   LK V ID    G++PSM T+ +G Y P+SRPL  YV  +  N    ++
Sbjct: 216 FGFAYYIENQKKLKAVAIDHGAGGVLPSMLTVQNGSYQPLSRPLFIYVNAKSANK-PEIK 274

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           E+V F +          + +    P+  E        +     G
Sbjct: 275 EFVIFYM----QHAQQLIEEVRYFPLKKEFYDFNIKHLQNKTLG 314


>gi|172036078|ref|YP_001802579.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
 gi|171697532|gb|ACB50513.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
          Length = 312

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 74/339 (21%), Positives = 135/339 (39%), Gaps = 44/339 (12%)

Query: 3   FFFVVLMCFVVLEVYCGT---GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           + F       +L V        +  R  I+I GSST++P ++ +AE F           V
Sbjct: 8   WLFAGAFALGLLLVNLSNIPVNSQGRAVIKIDGSSTVYPITEAVAEEFQNKKRGAVQVTV 67

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
              G+  G K+FC        DI N+SR I  +E   C   GV  + E+ + +D I +V 
Sbjct: 68  GISGTGGGFKKFCSDNEAVKTDISNASRPIKDSEKKMCADAGVKYM-EIPVAYDAITVVV 126

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            +D     +T  +L K         +    N + KW+++   +P+V + +Y P    GT 
Sbjct: 127 SKDNPLTDITTAELKKMW-------EPAATNKITKWNQVNSSWPDVPLKLYGPGADSGTF 179

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +    +V+        +++                               D    +  + 
Sbjct: 180 DYFTDEVIGNSGDSRTDYTP----------------------------SEDDNVLVQGVA 211

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            +K    + G ++Y+ N + LK + IDG+ PS  T+  G Y P+SRP+  YV      S 
Sbjct: 212 NDKQALAYFGYTYYEENKNKLKALKIDGVAPSSQTVSDGTYTPLSRPIFIYVNLDAVKSN 271

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
             ++E+V + +     +    + +   IP ++ +    +
Sbjct: 272 SAVKEFVEYYLD----SAPKLVKEVRSIPRTDYQAHKQK 306


>gi|172055282|ref|YP_001806609.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
 gi|171701563|gb|ACB54543.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
          Length = 350

 Score =  184 bits (465), Expect = 2e-44,   Method: Composition-based stats.
 Identities = 70/353 (19%), Positives = 133/353 (37%), Gaps = 52/353 (14%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES- 61
           F  ++L   + L       T     IRI GSST++P ++ I ++      E     ++  
Sbjct: 14  FIQLLLTAVLFLPACSRPITEESEPIRIDGSSTVYPITEAILKSIQSQQSEKIAKGIKIK 73

Query: 62  ---GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
               G+  G  +FC G      DI  +SR I+  E++ C ++ V  I+         + V
Sbjct: 74  ADFSGTGGGFGKFCSG----ETDINGASRPISAVEMENCNRNQVRYIELPIAFDAVTVAV 129

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGT 178
           +  +    S+T+ +L +                +  W ++R  +P   +++Y P    GT
Sbjct: 130 NSGNDWVQSMTIAELKQIWEPS-------AQAQINNWQQVRASWPSRALSLYGPGKDSGT 182

Query: 179 REVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARI 238
            +   + ++ +      ++                                D    +  I
Sbjct: 183 FDYFTEAIVGQAGSSRTDY----------------------------VYSEDDEVLVNGI 214

Query: 239 EVNKDVFGFVGLSFYKNNADVLKLVPI----DGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
             + +  G+ G ++Y+ NA+ LK V I    D + P+  T+ +G Y P++RPL  YV  +
Sbjct: 215 AQDPNALGYFGYAYYEQNANKLKAVAIDSGSDPVAPTRETVENGSYRPLTRPLFIYVNAK 274

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                  L  +V F + +        + + G IP+  E     R      + G
Sbjct: 275 RAQENRALETFVEFYLDNA----KELVSEVGYIPLPEEGYHLARIQFQKFEVG 323


>gi|332705020|ref|ZP_08425105.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1,
           substrate-binding protein [Lyngbya majuscula 3L]
 gi|332356197|gb|EGJ35652.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1,
           substrate-binding protein [Lyngbya majuscula 3L]
          Length = 313

 Score =  184 bits (465), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 73/338 (21%), Positives = 137/338 (40%), Gaps = 45/338 (13%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
              L+   V  V     +  R  +RI GSST++P ++ +AE F +         V   G+
Sbjct: 13  LFALVASTVALVAPTVNSQGRPTVRIDGSSTVYPITEAVAEEFQDLKKNGVRVTVGISGT 72

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K+FC+G      DI ++SR I   E   C ++G+  +          ++V+  +  
Sbjct: 73  GGGFKKFCKG----ETDISDASRPIKDKEKALCAENGIEYMAIPVAYDAITVVVNKGNTA 128

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
              + VE+L K                + KWS++   +P++ + +Y P    GT +   K
Sbjct: 129 VTDIKVEELNKIWKPESE-------GTVTKWSQVNSAWPDLPLVLYGPGADSGTFDYFTK 181

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
           KV  +      +++                               D    +  +E ++  
Sbjct: 182 KVNGKSGASRTDYTP----------------------------SEDDNVLVQGVETDRRA 213

Query: 245 FGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLRE 303
             + GLS+Y  N D LK V I+G+ PS+ T+ +G Y P+SRP+  YV +        + E
Sbjct: 214 LAYFGLSYYLENQDKLKAVAINGVTPSLTTVRNGTYTPLSRPIFIYVNKNAVKRT-EVSE 272

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           +V++ +       +  + +   +P+S+ +       + 
Sbjct: 273 FVTYYL----QNAERLVTEVKSVPLSSADYAKSLAELE 306


>gi|186684858|ref|YP_001868054.1| phosphate binding protein [Nostoc punctiforme PCC 73102]
 gi|186467310|gb|ACC83111.1| phosphate binding protein [Nostoc punctiforme PCC 73102]
          Length = 333

 Score =  183 bits (463), Expect = 3e-44,   Method: Composition-based stats.
 Identities = 74/351 (21%), Positives = 143/351 (40%), Gaps = 51/351 (14%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
           F    LM        C +G   ++++ I G++  FP S  +AE + +  PE K   V S 
Sbjct: 11  FLLTFLMLITSSITACNSGQELKSQVSIDGAAVGFPVSLAVAEEYEKVKPEAKVS-VASS 69

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           G+  G  +FC G     IDI  +SR I   E+ +CK   +  ++         ++ + ++
Sbjct: 70  GTGGGFSKFCNG----DIDIAGASRTIRDEEIKKCKSKNIDFVELPIALDGIAVIANRQN 125

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
             +  LT+++L K   +            +  W+++ P FP  ++ +Y P+   GT + +
Sbjct: 126 NFAKCLTIKELGKIWGAKSD-------GKILNWNQVNPKFPNQKLKLYAPASDTGTFDYM 178

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            + V  +      +++                               +    +  +  + 
Sbjct: 179 TQAVTGKAKNGRTDYTPSH----------------------------NQNLLVQGVSGDV 210

Query: 243 DVFGFVGLSFYKNNADVLKLV-------PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHF 295
              G+VG+S+Y  N + L LV         +  VP    I +   P+SRPL  YV ++  
Sbjct: 211 SSLGYVGISYYIQNQEKLNLVAVESPTGKCEKPVPVDNVIKNIYTPLSRPLFIYVSKKSL 270

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           ++   ++E+V F + +     DS     G + + +E    V+   A G++G
Sbjct: 271 DTKPAVKEFVDFYLENSWKWVDS----VGYVALPDEAYVKVKQKFATGETG 317


>gi|254409461|ref|ZP_05023242.1| Bacterial extracellular solute-binding protein, putative
           [Microcoleus chthonoplastes PCC 7420]
 gi|196183458|gb|EDX78441.1| Bacterial extracellular solute-binding protein, putative
           [Microcoleus chthonoplastes PCC 7420]
          Length = 342

 Score =  183 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 74/349 (21%), Positives = 134/349 (38%), Gaps = 48/349 (13%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
              ++     +L       + +   I+I GSST++P +K +AE F+          V   
Sbjct: 14  KLALIATATALLGACSQVQSQSPQPIKIDGSSTVYPITKTVAETFNAMTKAPVNVTVGFS 73

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           G+  G K+FC G      DI ++SR I  +E+  CK+ GV+ I+         ++V+  +
Sbjct: 74  GTGGGFKKFCAG----ETDINDASRPIQTDEMAACKQAGVAYIELPVAFDAITVVVNPEN 129

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
                LTV +L K                + +W+++R  FP+  + +Y P    GT +  
Sbjct: 130 DWVDRLTVAELQKIWEPE-------AQRQITQWNQVRESFPQKPLNLYGPGTDSGTFDYF 182

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            + ++ E      +++                               D       +  + 
Sbjct: 183 TEAIVGEAGSSRSDYTA----------------------------SEDDEILAQGVNQDP 214

Query: 243 DVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNS 297
           +  G+ GL++Y+   D LK + +D     + PS  T+ +  Y P++RPL  YV       
Sbjct: 215 NALGYFGLAYYEAIPDKLKAIAVDSGKGAVFPSRQTVENAEYQPLTRPLFIYVNAAAAQK 274

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
              L E+V+F + +        +   G IP+  E            K G
Sbjct: 275 NPALAEFVAFYLENA----PEIVSSVGYIPLPEEGYHLANVHFFQHKVG 319


>gi|22299707|ref|NP_682954.1| periplasmic phosphate-binding protein of phosphate ABC transporter
           [Thermosynechococcus elongatus BP-1]
 gi|22295891|dbj|BAC09716.1| periplasmic phosphate-binding protein of phosphate ABC transporter
           [Thermosynechococcus elongatus BP-1]
          Length = 374

 Score =  183 bits (463), Expect = 4e-44,   Method: Composition-based stats.
 Identities = 70/347 (20%), Positives = 137/347 (39%), Gaps = 53/347 (15%)

Query: 7   VLMCFVVLEVYCGTGTFARNR--IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           VL               ++    IRI GSST++P ++  AE F +         V   G+
Sbjct: 51  VLAAVAAFSASLIPAALSQGTPTIRIDGSSTVYPLTEAAAEAFQKAEGGKIRVTVGISGT 110

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K+FCRG      DI N+SR I   E+  CK  G+  I+         ++V+ ++  
Sbjct: 111 GGGFKKFCRG----ETDISNASRPILAKEMAACKAAGIQYIELPVAYDALTVVVNPQNTW 166

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
           + SLTV +L +                +  WS++R  FP + + ++      GT +   +
Sbjct: 167 AKSLTVAELKRIWEPNS---------KINNWSQVRQGFPNIPLKLFGAGADSGTFDYFTE 217

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
            +  +  V  ++++                               D    +  +   +  
Sbjct: 218 AINGKSKVSRKDYTA----------------------------SEDDNVLVQGVSRERGA 249

Query: 245 FGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVL 299
            G+ G ++Y  N + LK V ID     + PS  T++ G Y P+SRP+  YV         
Sbjct: 250 LGYFGYAYYAENKNKLKAVSIDNGKGPVAPSEKTVIDGTYQPLSRPIFIYVN-AKAAQRP 308

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            +++++++ +++ +    +   +   +P+     K++  +    + G
Sbjct: 309 EVKKFITYYLNNGV----AMAKKVKYVPLPTSAYKTILANFNRNRIG 351


>gi|16331544|ref|NP_442272.1| SphX protein precursor [Synechocystis sp. PCC 6803]
 gi|2498946|sp|Q55200|SPHX_SYNY3 RecName: Full=Protein sphX; Flags: Precursor
 gi|1001198|dbj|BAA10342.1| SphX protein precursor [Synechocystis sp. PCC 6803]
          Length = 336

 Score =  182 bits (461), Expect = 6e-44,   Method: Composition-based stats.
 Identities = 78/346 (22%), Positives = 139/346 (40%), Gaps = 49/346 (14%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           +V M  ++L +   T +     I I GSST++P ++ I  +FS          VE  G+ 
Sbjct: 11  IVPMALLLLGISACTPSQTSQSIAINGSSTVYPITEAIVADFSGGKKGVDID-VEFSGTG 69

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G K FC G      DI ++SR I + E+  C  + V  ++         ++ + ++   
Sbjct: 70  GGFKLFCEG----KTDIADASRPINKQEMKLCNDNQVRYVELPIAFDAITVVSNPKNDWL 125

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
            SLTVE+L +         +      L +W+++RP+FP+  I +Y P    GT +   + 
Sbjct: 126 KSLTVEELKRIW-------EPAAEKTLTRWNQVRPEFPDQPINLYSPGEDSGTFDYFTEA 178

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           ++ +      +  K                              D    +  +  +    
Sbjct: 179 IVGQAGASRLDTLK----------------------------SEDDEILVQGVVQDLYSL 210

Query: 246 GFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLG 300
           G+ G ++Y+     LK + +D     ++PS  T+    Y P+SRPL  YV          
Sbjct: 211 GYFGFAYYEGRIADLKAIGVDNGRGPVLPSRETVEKSEYQPLSRPLFIYVNATKAQDNPA 270

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           LRE+V F +++      +   + G IP+  E     + S   G+ G
Sbjct: 271 LREFVDFYLANAS----ATATKVGYIPLPEEAYNLGKISFNKGEVG 312


>gi|159901417|ref|YP_001547664.1| phosphate binding protein [Herpetosiphon aurantiacus ATCC 23779]
 gi|159894456|gb|ABX07536.1| phosphate binding protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 357

 Score =  182 bits (461), Expect = 7e-44,   Method: Composition-based stats.
 Identities = 73/380 (19%), Positives = 127/380 (33%), Gaps = 79/380 (20%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTF-----------------------------ARNRIRIA 31
           M   F +L C V L     T                                 R  I I 
Sbjct: 1   MLQRFFLLCCLVTLAGCGATAAQPTATSLPATATPAPTTLAQATPAVTANPALRGTIVID 60

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GSST+FP ++ +A  F+   P  +       G+  G K+FC G       I ++SR I Q
Sbjct: 61  GSSTVFPITEAVAREFALTAPNVQVQL-GVSGTGGGFKKFCAG----ETVISDASRPIKQ 115

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
           +E  EC  + +  ++         L+ +  +     +TV +L                N 
Sbjct: 116 SEAAECAANQIDFVEIPVAFDGLSLVANPSNTWLECMTVAELNTLWQPD-------ATNI 168

Query: 152 LKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQL 211
           +  W  +RP +P   + +Y      GT +     ++        +               
Sbjct: 169 ITNWRMLRPIWPTSTLQLYGAGQDSGTFDYFTSAIVGTEGSSRSD--------------- 213

Query: 212 SVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV-- 269
                        +    D       I  + +  G+ G ++Y+   + LKL+ +D     
Sbjct: 214 -------------VISSEDDYLIAQDIAGDPNALGYFGYAYYREYQERLKLIAVDAGNGC 260

Query: 270 --PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLI 326
             PS  TI  G Y P+SRP+  YV+    +    +  +V F +SD        +     +
Sbjct: 261 VLPSEQTIADGSYQPLSRPIFIYVRADALDRA-EVAAFVDFYLSDLA----RVVADVKYV 315

Query: 327 PISNEERKSVRDSIAVGKSG 346
           P+     +  ++ +   K G
Sbjct: 316 PLPARAYQFAQERVQQRKLG 335


>gi|254467856|ref|ZP_05081262.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [beta proteobacterium KB13]
 gi|207086666|gb|EDZ63949.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [beta proteobacterium KB13]
          Length = 329

 Score =  182 bits (460), Expect = 9e-44,   Method: Composition-based stats.
 Identities = 76/352 (21%), Positives = 143/352 (40%), Gaps = 51/352 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M       +   V      T  FA + ++I GSST++P ++ +AE F +      T  V 
Sbjct: 1   MVSTLRKAVLATVASTVISTSVFAADIVKIDGSSTVYPITEAVAEEFQKETGIKVTVGVS 60

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
                 G K+FCRG       I ++SR I   E+ +C + G+S I+         ++++ 
Sbjct: 61  GT--GGGFKKFCRG----ETVISDASRPIKAKEIAKCNEAGISFIEIPVAFDALTVVINK 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +  +  +T E+L KA               +  W+++R  FP+  + +Y P    GT +
Sbjct: 115 DNDWAAEMTPEELKKAWGPD-------AQGKVMNWNQVREGFPDQPLKLYGPGADSGTFD 167

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + ++++      +F+                               D    +  +  
Sbjct: 168 YFTEAIIKKSKSIRGDFTA----------------------------SEDDNVLVQGVAG 199

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQH 294
           +K   G+ GL++Y  N D L  V +       + PS+ T++ G Y P+SRPL  Y+    
Sbjct: 200 DKGGMGYFGLAYYVENKDKLGAVKVKNKEGKFVEPSLETVMDGSYNPLSRPLFIYLNATK 259

Query: 295 FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                 ++++V F + +          + G +P SNEE  ++++     K+G
Sbjct: 260 AAFDPKVKKFVEFYLENAGK----LSKEVGYVPFSNEEYTAIKNHYKSLKTG 307


>gi|55980228|ref|YP_143525.1| phosphate ABC transporter periplasmid phosphate-biniding protein
           [Thermus thermophilus HB8]
 gi|55771641|dbj|BAD70082.1| phosphate ABC transporter, periplasmid phosphate-biniding protein
           [Thermus thermophilus HB8]
          Length = 322

 Score =  182 bits (460), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 77/351 (21%), Positives = 140/351 (39%), Gaps = 58/351 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR    +L    +  +          +IR  GSST++P ++ +AE F    P+ +   V 
Sbjct: 1   MRGKAWMLTAVALTGLGLA-------QIRADGSSTVYPITQAVAEEFVTRNPQVRIS-VA 52

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G+  G ++FCRG      D+ N+SR I ++EL+ C+K G+  I+         +LV+ 
Sbjct: 53  FSGTGAGFQKFCRG----ETDVQNASRPIRKSELEACQKAGIQFIEIPVAYDALSILVNR 108

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           ++  +  LT   L         V+          W ++ P +P  RI ++      GT +
Sbjct: 109 QNTWAQCLTTAQLKSIWEPNAKVN---------YWKDLNPAWPNRRIVLFGAGTDSGTFD 159

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + ++       +++                                D    +  +  
Sbjct: 160 YFTEAIMGRAGSIRKDY----------------------------FPSEDDNVIMRGVTG 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIV----PSMGTIVSGLY-PISRPLLFYVKRQHF 295
           N     FVG ++Y+ N D +K V ID       PS  T++ G Y P+SRPL  YV  +  
Sbjct: 192 NPYAMAFVGFAYYEENKDKVKAVAIDHGKGCVLPSRETVLDGTYQPLSRPLFIYVNVKSL 251

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +    ++ +V F +S         +   G + + +E  +  +  +A  K+G
Sbjct: 252 D-RPEVQAFVDFYLSPAA---RRAIRSTGYVELPDEAYRIGQGLVARKKTG 298


>gi|163849117|ref|YP_001637161.1| phosphate binding protein [Chloroflexus aurantiacus J-10-fl]
 gi|222527090|ref|YP_002571561.1| phosphate binding protein [Chloroflexus sp. Y-400-fl]
 gi|163670406|gb|ABY36772.1| phosphate binding protein [Chloroflexus aurantiacus J-10-fl]
 gi|222450969|gb|ACM55235.1| phosphate binding protein [Chloroflexus sp. Y-400-fl]
          Length = 362

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 74/330 (22%), Positives = 127/330 (38%), Gaps = 50/330 (15%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
                 I+I GSST+FP ++ +A  F +  P+         G+  G   FC G      D
Sbjct: 56  ARLAGEIKIDGSSTVFPITERVAVAFGDLAPDVTIRL-GVSGTGGGFTRFCAG----ETD 110

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR I Q E+D C   G++ I+         ++V  ++     LTV +L    A   
Sbjct: 111 ISNASRPIKQKEIDACAASGITFIELPVAFDGLSVVVHPQNTWVDCLTVAELNLMWAPE- 169

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
                   N + +W++IR ++P   + +Y      GT +     ++    V   +++   
Sbjct: 170 ------ATNRITRWNQIRAEWPAEPLHLYGAGVDSGTYDYFTSAIVGAEGVSRSDYTA-- 221

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                                       D       +  ++   GF G ++Y   AD L+
Sbjct: 222 --------------------------SEDDYLLAQDVAADRLGLGFFGYAYYAEYADQLR 255

Query: 262 LVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            V ID     + P++ TIV G Y P+SRP+  YV+    N    +  +V F V +  M  
Sbjct: 256 AVAIDNGQGCVAPTVKTIVDGSYQPLSRPIFIYVRADSLN-RPEIAAFVRFYVQNGAMFA 314

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +  L     +P+     +     +    +G
Sbjct: 315 EQAL----YVPLPETVYQLALQRVERRITG 340


>gi|257093589|ref|YP_003167230.1| phosphate-binding protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257046113|gb|ACV35301.1| phosphate binding protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 334

 Score =  181 bits (459), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 70/324 (21%), Positives = 131/324 (40%), Gaps = 49/324 (15%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           ++I GSST+FP ++ +AE F +         V   G+  G K+FCRG      D+ N+SR
Sbjct: 32  VKIDGSSTVFPITEAVAEEFQKAKRGAVNVTVGISGTGGGFKKFCRG----ETDVANASR 87

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            I + E+D+C K G+   +         ++V+ ++    S++V +L K            
Sbjct: 88  PILKKEMDDCAKAGIRYYEMPIAYDALTVMVNPQNAFIKSMSVAELKKIWEPG------- 140

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
               +  W ++ P +P+ +I +Y      GT +   + ++ +      +++         
Sbjct: 141 AQGKINSWKDVNPAWPDQKIKLYGAGSDSGTFDYFTEAIVGKAKSSRGDYTA-------- 192

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                                 D    +  I  +K   G+ G ++Y  N   LK V IDG
Sbjct: 193 --------------------SEDDNVLVQGISGDKGALGYFGFAYYIENQKKLKAVAIDG 232

Query: 268 ----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
               + P+   + +G Y P+SRP+  YV  +       ++E+V F +          + +
Sbjct: 233 GKGPVAPTPENVDNGSYQPLSRPIFIYVSEKSLEK-PEVKEFVEFYMKSAA----PLVKE 287

Query: 323 YGLIPISNEERKSVRDSIAVGKSG 346
              IP+  +      + +A  K G
Sbjct: 288 VKYIPLPAKAYTGNLEHLAKKKLG 311


>gi|51891902|ref|YP_074593.1| phosphate ABC transporter phosphate-binding protein
           [Symbiobacterium thermophilum IAM 14863]
 gi|51855591|dbj|BAD39749.1| phosphate ABC transporter phosphate-binding protein
           [Symbiobacterium thermophilum IAM 14863]
          Length = 319

 Score =  181 bits (458), Expect = 1e-43,   Method: Composition-based stats.
 Identities = 75/332 (22%), Positives = 129/332 (38%), Gaps = 51/332 (15%)

Query: 14  LEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCR 73
                  GT     + + GSST+ P S  +AE F +  P    P V   GSS G+ +F +
Sbjct: 35  SSSGGSAGTELSGTVTLDGSSTVGPISIAVAEEFRKVHPRVDVP-VGISGSSAGIGKFVK 93

Query: 74  GIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDL 133
                 +DI N+SR I + EL+E + +G+  I+         ++V+  +     +T E L
Sbjct: 94  ----REVDIANASRPIKEKELEEARNNGLDPIELPVAYDGLSVVVNKENDFLTCITTEQL 149

Query: 134 YKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVR 193
           +K                + +W+E+ P +P+  I +Y P    GT E   + V  +G   
Sbjct: 150 HKIWGPES---------TVTRWNEVDPSWPDAPIKLYGPGTASGTFEYFNEMVNGKGDAS 200

Query: 194 SRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFY 253
             +F+                               D    +  +  +K   G+ G ++Y
Sbjct: 201 RSDFTA----------------------------SEDDNVLVQGVAGDKYAMGYFGYAYY 232

Query: 254 KNNADVLKLVPID----GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSV 309
             N D +K + ID     + P+  TI +G YP SR +  Y  RQ       ++ +V+F +
Sbjct: 233 AENKDTMKALAIDAGDGCVEPNDDTIAAGSYPFSRLIYIYPSRQALE-RPEVKAFVTFYM 291

Query: 310 SDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
            +          Q G  P+  E  +     + 
Sbjct: 292 ENAG----ELAAQVGYTPLPEEMYQDNLAKLK 319


>gi|82701620|ref|YP_411186.1| phosphate binding protein [Nitrosospira multiformis ATCC 25196]
 gi|82409685|gb|ABB73794.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Nitrosospira multiformis ATCC 25196]
          Length = 339

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 79/349 (22%), Positives = 143/349 (40%), Gaps = 49/349 (14%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
              V+   F    +    G  A   ++I GSST+FP ++ +AE+F           V   
Sbjct: 12  RAAVLGAVFGATNIGMIAGANAGGLVKIDGSSTVFPITEAVAEDFQNAKKGAVRVTVGIS 71

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           G+  G K+FCRG      DIVN+SR I Q E++ECKK G+  ++         ++++ ++
Sbjct: 72  GTGGGFKKFCRG----ETDIVNASRPILQKEMEECKKSGIQYVEMPVAFDALTVVINPKN 127

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
             + +LTV +L K                + KW++  P +P+ ++ +Y      GT +  
Sbjct: 128 DWANTLTVAELKKIWEPE-------AQGKITKWNQANPAWPDEKLKLYGAGADSGTFDYF 180

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            + ++ +      +F+                               D    +  +  +K
Sbjct: 181 TEAIVGKTKSSRGDFTA----------------------------SEDDNVLVQGVASDK 212

Query: 243 DVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNS 297
           +  GF G ++Y  N   LK V ID     ++PS  T+  G Y P+SRP+  YV  +    
Sbjct: 213 NALGFFGFAYYVENQKKLKAVAIDSGKGPVLPSEKTVEDGSYQPLSRPIFIYVNIKSAEK 272

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
              +RE V F + +      + + +    P+  +   +  + +   K G
Sbjct: 273 -PEVRELVEFYMKNA----PTLVKEVKFFPLPPQAYSTNLEHLNKKKVG 316


>gi|229174946|ref|ZP_04302466.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus MM3]
 gi|228608614|gb|EEK65916.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus MM3]
          Length = 305

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 71/351 (20%), Positives = 141/351 (40%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF+ +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWISTSIKVFILSTCFLYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E KK+ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRAMKQVEENEMKKNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWVDNMTVDELRLLWSEDESE---------KRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ   +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQNSRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SRPL  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGKYKPLSRPLFAYVNDA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|91775148|ref|YP_544904.1| phosphate binding protein [Methylobacillus flagellatus KT]
 gi|91709135|gb|ABE49063.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methylobacillus flagellatus KT]
          Length = 340

 Score =  181 bits (458), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 69/336 (20%), Positives = 131/336 (38%), Gaps = 52/336 (15%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
                   + IRI GSST++P ++ +AE F +   +     V   G+  G K+FCRG   
Sbjct: 29  ADAAPAKNDIIRIDGSSTVYPITEAVAEEFQKA--KRIKVTVGISGTGGGFKKFCRG--- 83

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKAL 137
              DI  +SR I   E++ CK  G+  I+         ++V+ ++      TVE+L K  
Sbjct: 84  -ETDISEASRPILAKEMEACKAAGIEFIELPVAYDALTVVVNPKNTFVKHFTVEELKKLW 142

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
                         +K W ++ P +P+  + ++      GT +   + ++ +      +F
Sbjct: 143 EPE-------AQGKIKTWKQVNPSWPDTPVKLFGAGSDSGTFDYFTEAIVGKAKSSRGDF 195

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
           +                               D    +  +  +    G+ G ++Y+ N+
Sbjct: 196 TA----------------------------SEDDNVLVQGVASDIAATGYFGFAYYEENS 227

Query: 258 DVLKLVPIDGIV------PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVS 310
             +K VPI          PS  T+++G Y P+SRPL  Y+      S   ++ ++ F ++
Sbjct: 228 KRVKAVPIVAKPGAPAVLPSRETVMNGTYQPLSRPLFIYISANAAKSNPNVKAFIDFYLA 287

Query: 311 DEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +        + +   I +   E  +V +     K G
Sbjct: 288 NA----KELVEEVKYIALPEHEYAAVMEHWKAMKVG 319


>gi|253997057|ref|YP_003049121.1| phosphate-binding protein [Methylotenera mobilis JLW8]
 gi|253983736|gb|ACT48594.1| phosphate binding protein [Methylotenera mobilis JLW8]
          Length = 333

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 71/351 (20%), Positives = 137/351 (39%), Gaps = 52/351 (14%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
            +  +      L         A   I+I GSST++P ++ +AE F +         V   
Sbjct: 7   KYSTIASLVTSLFALPNFAVAADKIIKIDGSSTVYPITEAVAEEFQKSTKTK--VTVGIS 64

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           G+  G K+FCRG      D+ N+SR I Q E+D CK+ GV  I+         ++++  +
Sbjct: 65  GTGGGFKKFCRG----ETDVQNASRPILQKEIDACKEAGVQFIELPVAYDALTVVINPAN 120

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
             +  +T  +L K         +      +K W+++ P +P   + ++ P    GT +  
Sbjct: 121 DFAKKMTTAELKKLW-------EPAAQGKVKTWNQVNPAWPNTPVKLFGPGADSGTFDYF 173

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            + ++ +      +F+                               D    +  +  +K
Sbjct: 174 TEAIVGKAKSSRGDFTA----------------------------SEDDNVLVKGVVGDK 205

Query: 243 DVFGFVGLSFYKNNADVLKLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
               + G ++Y+ N D L  V I       G++PS  TI  G Y P++RP+  YV     
Sbjct: 206 GGLAYFGYAYYEENQDKLTAVSIIEKAGKPGVLPSKATIEDGTYQPLARPIFIYVNATAA 265

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                ++ +V++ + +        + +   + +  +E+K+V       K G
Sbjct: 266 AFKPEVKAFVNYYLEN----SKPLIEEVKYVALPAKEQKAVITHWKALKPG 312


>gi|83816189|ref|YP_446397.1| phosphate ABC transporter, phosphate binding protein [Salinibacter
           ruber DSM 13855]
 gi|294508334|ref|YP_003572392.1| ABC-type phosphate transport system, periplasmic component
           [Salinibacter ruber M8]
 gi|83757583|gb|ABC45696.1| phosphate ABC transporter, phosphate binding protein [Salinibacter
           ruber DSM 13855]
 gi|294344662|emb|CBH25440.1| ABC-type phosphate transport system, periplasmic component
           [Salinibacter ruber M8]
          Length = 355

 Score =  180 bits (457), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 72/337 (21%), Positives = 129/337 (38%), Gaps = 58/337 (17%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
            G  + + + I GSST+FP ++ +AE F E     +   V   G+  G  +F RG     
Sbjct: 32  CGGSSVDSVSIDGSSTVFPLTEAVAEEFMEDSQGARV-NVGVSGTGGGFSKFLRG----E 86

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
             I ++SR I  NE+++ + +G+  I+         ++V   +  +  LT  +L +    
Sbjct: 87  TAINDASRPIAPNEIEKAEANGIEFIEIPVAYDGLAVVVHPENDWASCLTAGELREIWKP 146

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
                       + +W +IR  +P+  I +Y P    GT +   + ++ E      +F+ 
Sbjct: 147 DS---------SIDRWGQIRDSYPDRPIKLYGPGTASGTYDYFTEAIVGEAEASRSDFTA 197

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
                                         D    +  I   +   G+ GL++Y+NNAD 
Sbjct: 198 ----------------------------SEDDNVLVQGITGTETALGYFGLAYYENNADK 229

Query: 260 LKLVPIDGIV---------PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
           LK + ID            P   T+ +G Y P+SRPL  YV          + ++V+F +
Sbjct: 230 LKALSIDPDERDGGAPCVTPGAETVKNGRYRPLSRPLFIYVN--PAKITPTVEKFVTFYL 287

Query: 310 SDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                  D      G + + ++  +          SG
Sbjct: 288 ----QNADELASDVGYVAMPDDAYELALQRFQDRTSG 320


>gi|206977987|ref|ZP_03238873.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus H3081.97]
 gi|217961763|ref|YP_002340333.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH187]
 gi|222097717|ref|YP_002531774.1| phosphate ABC transporter , phosphate-binding protein [Bacillus
           cereus Q1]
 gi|206743787|gb|EDZ55208.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus H3081.97]
 gi|217063680|gb|ACJ77930.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH187]
 gi|221241775|gb|ACM14485.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Q1]
          Length = 305

 Score =  180 bits (456), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 71/351 (20%), Positives = 140/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWISASIKVFILSTCFFYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E KK+ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKKNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWVDNMTVDELRLLWSEDESE---------KRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ+  +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQKSRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+  GFVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIGFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +            + G + +  E+       +   K
Sbjct: 258 SIRNKMNVASYIEFMI----QHVGKLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|262197757|ref|YP_003268966.1| phosphate binding protein [Haliangium ochraceum DSM 14365]
 gi|262081104|gb|ACY17073.1| phosphate binding protein [Haliangium ochraceum DSM 14365]
          Length = 345

 Score =  180 bits (456), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 81/371 (21%), Positives = 141/371 (38%), Gaps = 71/371 (19%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTF---------------ARNRIRIAGSSTLFPYSKIIAE 45
           M+    VL    +    C   +                    I + GSST+ P S+ +AE
Sbjct: 1   MKTLTFVLFSAALALPACKGKSEDSAKPAGEEGGGAAAESGVIVVDGSSTVLPVSQAVAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F +         V   G+  G ++FC     + I +  +SR + ++E   CK+ G+  I
Sbjct: 61  AFEKQSE--AHVTVGKSGTGGGFQKFC----RNEIVVTGASRPVKESERAACKEAGIEFI 114

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEV 165
           +         ++V   +     LTVE+L    A             +  WS+IR  FPE 
Sbjct: 115 ELPVAYDGIAVVVHKDNSWVDHLTVEELKTMWAPE-------AEEKVMNWSDIREGFPEE 167

Query: 166 RIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI 225
            + ++ P    GT +   K ++        +F                            
Sbjct: 168 NLRLFGPGLDSGTYDYFTKAIVGTEHASRSDFQP-------------------------- 201

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG---------IVPSMGTIV 276
             + D    +  +  +    GF G ++YK N DVLK+VPID          + P+M ++ 
Sbjct: 202 --NEDDNVLVRGVSTDAQALGFFGFAYYKENTDVLKIVPIDDGTADNGDGPVAPTMESVA 259

Query: 277 SGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKS 335
            G Y P+SRP+  YV ++       + E+VSF ++      D+ + + G IP+     + 
Sbjct: 260 DGSYQPLSRPIFIYVNKEALEKRPEVAEFVSFYLN-----QDALVEKVGYIPLPAAASEL 314

Query: 336 VRDSIAVGKSG 346
           V+  +    +G
Sbjct: 315 VKKRLEERTTG 325


>gi|305665601|ref|YP_003861888.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Maribacter sp. HTCC2170]
 gi|88710357|gb|EAR02589.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Maribacter sp. HTCC2170]
          Length = 319

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 74/358 (20%), Positives = 133/358 (37%), Gaps = 61/358 (17%)

Query: 1   MRFFFVVLMCFVVLEVY-----------CGTGTFARNRIRIAGSSTLFPYSKIIAENFSE 49
           M+   V+    + +                  T     I++ GSST+FP ++ +AE F  
Sbjct: 1   MKRILVIASLALAIVACGDKKEKKGGDASQETTSLSGTIKVDGSSTVFPITEAVAEEFRG 60

Query: 50  YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVT 109
             P+ K     SG          +       ++ N+SR I   E   CK++ +  ++   
Sbjct: 61  VQPKVKVTVGVSG-----TGGGFKKFSRGETNLSNASRPIKDKEKAACKENNIKYLELEV 115

Query: 110 IGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI 169
                 ++V   +      TVE+L K         +      + KW++IRP++P   I +
Sbjct: 116 AYDGLAVIVHPENNWVDHFTVEELKKIW-------EPAAQGKVMKWNQIRPEWPNEEIHL 168

Query: 170 YVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDG 229
           + P    GT +   + V+ +      +F+                               
Sbjct: 169 FGPGVASGTYDYFTEAVVGKSGSSRGDFTA----------------------------SE 200

Query: 230 DYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV----PSMGTIVSGLY-PISR 284
           D    +  I  +K   GF GL++Y  N D L+L+ +        PS+ T+ +G Y P+SR
Sbjct: 201 DDHVLVQGIAGDKYALGFFGLAYYAENKDRLQLIGVHNGESIVKPSLETVKNGTYKPLSR 260

Query: 285 PLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           PL  YV     +    + E+V F + +            G IP+ +E  K  +++   
Sbjct: 261 PLFIYVNSTSVS-APEVIEFVDFYIDNAG----ELSKDVGYIPLPDENYKVQKENFQT 313


>gi|42523158|ref|NP_968538.1| periplasmic phosphate-binding protein of ABC transporter
           [Bdellovibrio bacteriovorus HD100]
 gi|39575363|emb|CAE79531.1| Periplasmic phosphate-binding protein of ABC transporter
           [Bdellovibrio bacteriovorus HD100]
          Length = 333

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 70/354 (19%), Positives = 139/354 (39%), Gaps = 55/354 (15%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
                +  + + +           I+I GSST+FP ++ +AE F           V   G
Sbjct: 1   MLTNFVVSLSVVMGAALAHAQAPVIKIDGSSTVFPITEAMAEEFQTSQRGKVRVTVGISG 60

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           +  G K+FCRG      D+ N+SR I  +E++ C+K G+  ++         ++V+ ++ 
Sbjct: 61  TGGGFKKFCRG----ETDVQNASRPIQASEIEACRKAGIKFLELPVAYDATAVVVNPKNT 116

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              S+TV DL K                +  W+++ P +P+ ++ +Y      GT +   
Sbjct: 117 WLKSITVADLKKMWEPG-------AQGKINTWADVNPAWPKEKLKLYGAGSDSGTFDYFT 169

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           + V+ +      +++                               D    +  +  +  
Sbjct: 170 EAVVGKSKSSRGDYTA----------------------------SEDDNTLVTGVSNDLY 201

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIV----------PSMGTIVSGLY-PISRPLLFYVKR 292
             G+V L++Y+ N   LK+V I G            P   T+ +G Y P+SRP+  YV  
Sbjct: 202 ALGYVPLAYYEENKGKLKVVAIVGGDKAPKKNEAVLPGRETVENGSYFPLSRPIFIYVSE 261

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +       ++E+++F +          + Q   +P+  +    V++++   K G
Sbjct: 262 KSMAK-PEVKEFINFYIG----KSFEIVPQVKYVPLPAKAYDMVKENVKKNKLG 310


>gi|228987520|ref|ZP_04147639.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
 gi|228772252|gb|EEM20699.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar tochigiensis BGSC 4Y1]
          Length = 305

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 70/351 (19%), Positives = 140/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWISASIKVFILSTCFFYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E KK+ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKKNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWVDNITVDELRLLWSED---------GSEKRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ+  +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQKSRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFVYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|67921474|ref|ZP_00514992.1| extracellular solute-binding protein, family 1 [Crocosphaera
           watsonii WH 8501]
 gi|67856586|gb|EAM51827.1| extracellular solute-binding protein, family 1 [Crocosphaera
           watsonii WH 8501]
          Length = 345

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 75/349 (21%), Positives = 139/349 (39%), Gaps = 52/349 (14%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFS--EYFPEFKTPFV 59
           R + + +    +L         A   I+I GSST+FP ++I+ E +         K   +
Sbjct: 12  RTWGMAVASSTLLAACGSVPESAVKPIKIDGSSTVFPITEIVLETYKSEAANQSIKELKI 71

Query: 60  ES--GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
           E    G+  G ++FC G      DI  +SR I+Q E+  CK + +S I+         ++
Sbjct: 72  EGEFSGTGGGFQKFCAG----ETDISAASRPISQEEMATCKNNEISYIELPIAFDAITVV 127

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +  S +LTVE L           +    N + +W+++   +P+  + +Y P    G
Sbjct: 128 VNPNNNWSETLTVEQLKTLW-------EPAAENQVGQWNQVDSSYPDRPLTLYGPDQLSG 180

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +   K ++ E     +++ K                              D    + R
Sbjct: 181 TYDYFTKAIVGETGASRQDYVKSM----------------------------DDEVLVTR 212

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKR 292
              + +   + G  +Y+ + D LK V ID    G++PS  T+ +  Y P+SRPL  YV  
Sbjct: 213 FSQDPNAIAYFGYGYYQQHQDKLKAVAIDNGNGGVLPSPDTVENEEYAPLSRPLFLYVNA 272

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           +       L  +V + ++         + + G IP+  +     +  + 
Sbjct: 273 KRAQENPALEIFVEYYLN----KAPELVAEAGYIPLPEDVYHIAKVHLQ 317


>gi|229031920|ref|ZP_04187907.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1271]
 gi|228729384|gb|EEL80374.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1271]
          Length = 294

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 69/340 (20%), Positives = 138/340 (40%), Gaps = 48/340 (14%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           ++  CF+ +             +R+ GSST+FP  + +AE +++  P  K   +   G+ 
Sbjct: 1   MLSTCFLYVGTSTAFAANEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTG 59

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G   F +G     +DI N+SR + Q E +E KK+ +             ++V+ ++   
Sbjct: 60  GGFNRFSKG----EVDINNASRAMKQVEENEMKKNSIQFTPFEVAYDGLTIVVNRQNTWV 115

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
            ++TV++L    +              K+WS+I   +P  ++  Y P    GT +  +  
Sbjct: 116 DNMTVDELRLLWSED---------GSEKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNV 166

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           +LQ   +  +                             + +  D    +  +  +K+  
Sbjct: 167 ILQNSRIVKK-----------------------------VSLSEDDQVIMQGVMNDKNAI 197

Query: 246 GFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREY 304
            FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SRPL  YV      + + +  Y
Sbjct: 198 AFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGKYKPLSRPLFAYVNDASIRNKMNVANY 257

Query: 305 VSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + F +        +   + G + +  E+       +   K
Sbjct: 258 IEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 293


>gi|163942031|ref|YP_001646915.1| phosphate binding protein [Bacillus weihenstephanensis KBAB4]
 gi|163864228|gb|ABY45287.1| phosphate binding protein [Bacillus weihenstephanensis KBAB4]
          Length = 302

 Score =  180 bits (455), Expect = 3e-43,   Method: Composition-based stats.
 Identities = 71/343 (20%), Positives = 134/343 (39%), Gaps = 48/343 (13%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
               +  CF+   +     T     +R+ GSST+FP  + +AE +++  P  K   +   
Sbjct: 6   KVLTLSTCFLCFNMSTAFATNEMGEVRVDGSSTVFPIIEAVAEEYTKAHPNVKIS-ISIS 64

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           G+  G   F +G     +DI N+SR +   E +  +K+ +             ++V+ ++
Sbjct: 65  GTGGGFNRFSKG----EVDINNASRLMKPVEENAMQKNSIQFTPFEVAYDGLTIVVNRQN 120

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
               ++T+++L    +             LK+WS+I   +   ++  Y P    GT +  
Sbjct: 121 TWVNNMTIDELRLLWSEN---------GRLKRWSQIHSSWSREQVKFYAPGVDSGTYDYF 171

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
           +  VLQ   +                                + +  D    +  +  +K
Sbjct: 172 QNVVLQNNRLVKT-----------------------------VSLSEDDQVIMQGVMNDK 202

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGL 301
           +   FVG ++Y  N D +K + +DG+ P+  TI SG Y P+SRPL  YV      + + +
Sbjct: 203 NAIAFVGYAYYMANRDKVKAIQVDGVFPTKETIQSGTYKPLSRPLFTYVNHASIRNKINV 262

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             YV F +        S   + G + +  E+       +   K
Sbjct: 263 ANYVEFMI----KHVGSLAEEVGYVKLPKEKYNEQLRMLTEIK 301


>gi|163845864|ref|YP_001633908.1| phosphate binding protein [Chloroflexus aurantiacus J-10-fl]
 gi|222523576|ref|YP_002568046.1| phosphate binding protein [Chloroflexus sp. Y-400-fl]
 gi|163667153|gb|ABY33519.1| phosphate binding protein [Chloroflexus aurantiacus J-10-fl]
 gi|222447455|gb|ACM51721.1| phosphate binding protein [Chloroflexus sp. Y-400-fl]
          Length = 682

 Score =  180 bits (455), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 73/337 (21%), Positives = 128/337 (37%), Gaps = 47/337 (13%)

Query: 15  EVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRG 74
                        I I GSST++P +   AE FS   P  +   V   G+  G K+FC G
Sbjct: 48  TAPASELASLSGDIIIDGSSTVYPPTAAAAEEFSRLAPNVRVS-VGISGTGGGFKKFCNG 106

Query: 75  IGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLY 134
                 DI N+SR I + E   C ++G+  I+         ++V+ ++     LTV +L 
Sbjct: 107 ----ETDISNASRPIREEEQAICAQNGIEFIELPVAYDGLSVVVNPQNDWVTCLTVAELK 162

Query: 135 KALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
           K         +      +  W+++R  FP   + +       GT +   + ++ E     
Sbjct: 163 KIW-------EPAAQGVITNWNQVREGFPNRPLVLLGAGTDSGTFDYFTEAIVGEAKASR 215

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
            ++                                D   T+  +  + +  G++G ++  
Sbjct: 216 GDYQAT----------------------------EDDNVTITGVSGDLNAMGYLGYAYVV 247

Query: 255 NNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSV 309
            N   +K + ID     + PS  TI    Y P+SRPL  YV ++       ++ +V+F +
Sbjct: 248 ENQGKIKPIAIDNGNGCVEPSFETIADASYQPLSRPLFIYVNKEAAE-RPEVQAFVNFYL 306

Query: 310 SDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           S E   P  Q  Q G + +S+E   ++         G
Sbjct: 307 SPEFT-PIIQTPQVGYVKLSDELYAAIAKRFNDRVLG 342



 Score =  175 bits (444), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 71/330 (21%), Positives = 129/330 (39%), Gaps = 47/330 (14%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
                 I I GSST++P +   AE FS      +   V   G+  G K+FC G      D
Sbjct: 376 ATLSGDIIIDGSSTVYPPTAAAAEEFSRLASNVRVS-VGISGTGGGFKKFCNG----ETD 430

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR I + E   C ++G+  I+         ++V+ ++  +  LTV +L K      
Sbjct: 431 ISNASRPIREEEQAICAQNGIEFIELPVAYDGLSVVVNPQNDWATCLTVAELKKIW---- 486

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
              +      +  W+++R  FP+  + +       GT +   + ++ E      ++    
Sbjct: 487 ---EPAAQGVITNWNQVREGFPDRPLVLLGAGTDSGTFDYFTEAIVGEAKASRGDYQAT- 542

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                                       D   T+  +  + +  G++G ++   N   +K
Sbjct: 543 ---------------------------EDDNVTITGVSGDLNAMGYLGYAYVVENQGKIK 575

Query: 262 LVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            + +D     + PS  TI    Y P+SRPL  YV ++       ++ +V+F +S E   P
Sbjct: 576 PIAVDNGNGCVEPSFETIADATYQPLSRPLFIYVNKEAAE-RPEVQAFVNFYLSPEFT-P 633

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
             Q  Q G + +S+E   ++         G
Sbjct: 634 IIQTPQVGYVKLSDELYAAIAKRFNDRVVG 663


>gi|71909174|ref|YP_286761.1| phosphate binding protein [Dechloromonas aromatica RCB]
 gi|71848795|gb|AAZ48291.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Dechloromonas aromatica RCB]
          Length = 333

 Score =  179 bits (454), Expect = 4e-43,   Method: Composition-based stats.
 Identities = 71/352 (20%), Positives = 132/352 (37%), Gaps = 51/352 (14%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           +   +V    V      G        I+I GSST++P ++ +AE F +         V  
Sbjct: 3   KHSKLVSALAVAGVALFGAQAAQAQVIKIDGSSTVYPITEAVAEEFQKAKKNVVKVTVGI 62

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            G+  G K+FC     D  DI ++SR IT++E+D CK  GV  I+         ++V+ +
Sbjct: 63  SGTGGGFKKFC----RDETDISDASRPITKSEMDICKAAGVEYIEMPVAFDALTVVVNPK 118

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           +      TV +L           +      + KW++I P +P+  I ++      GT E 
Sbjct: 119 NTFLKQATVAELKTMW-------EPAAQGKITKWNQINPAWPDAPIKLFGAGADSGTFEY 171

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
             +  + +      +++                               D    +  +  +
Sbjct: 172 FTEATVGKAKSSRGDYTA----------------------------SEDDNVLVQGVSRD 203

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGI------VPSMGTIVSGLY-PISRPLLFYVKRQH 294
            +  G+ G ++Y  N   LK +PI          PS  +++   Y P+SRP+  YVK + 
Sbjct: 204 VNAIGYFGYAYYAENKARLKALPIVNPKTNVAVEPSEESVIKATYQPLSRPIFIYVKAKS 263

Query: 295 FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                 ++E+V F + +          +   +P+         + +   K G
Sbjct: 264 LEK-PEIKEFVEFYMKNGAK----LTKEVKYVPLPASAYTGNIEHMNKKKLG 310


>gi|325982887|ref|YP_004295289.1| phosphate binding protein [Nitrosomonas sp. AL212]
 gi|325532406|gb|ADZ27127.1| phosphate binding protein [Nitrosomonas sp. AL212]
          Length = 338

 Score =  179 bits (454), Expect = 5e-43,   Method: Composition-based stats.
 Identities = 73/350 (20%), Positives = 145/350 (41%), Gaps = 51/350 (14%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
           +   ++  + L     +   A++ I+  GSST++P +K +A+ F           V   G
Sbjct: 5   YIFKILNIMFLLCVGISIANAQSIIQTDGSSTVYPITKAVADKFQIVKKNTVNVTVSISG 64

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           S  G K+FCRG     IDIVN+SR I +NE+ +CK   +  ++         + V+  + 
Sbjct: 65  SGGGFKKFCRG----EIDIVNASRPILKNEMQDCKNSRIQYVEIPVAFDALTVAVNPENH 120

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              ++T+ +L K         +      + +W +I P +P+  I +Y      GT +   
Sbjct: 121 WGTAMTLAELKKIW-------EPAAQGTMTRWKQINPTWPDETIKLYGADPDSGTYDYFT 173

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           K ++ +      ++++                              D  E +  +  +K+
Sbjct: 174 KAIVGKAKSSRSDYTQ----------------------------SPDDNELVNGVASDKN 205

Query: 244 VFGFVGLSFYKNNADVLKLVPIDG------IVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
             GF G S+Y  N + +  V ID       I P++ T+ +G Y P+SRP+  YV  +   
Sbjct: 206 GLGFFGFSYYIENQNKVTAVAIDNGKGQGAIPPAVETVENGSYQPLSRPVFIYVNVKAIE 265

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
               ++E+V F + + ++     + +    P+      ++ +     ++G
Sbjct: 266 K-PEVKEFVEFYLKNALL----LVKEAKFFPLPPRAYTTMLEHFNKKRTG 310


>gi|220929517|ref|YP_002506426.1| phosphate binding protein [Clostridium cellulolyticum H10]
 gi|219999845|gb|ACL76446.1| phosphate binding protein [Clostridium cellulolyticum H10]
          Length = 313

 Score =  179 bits (453), Expect = 6e-43,   Method: Composition-based stats.
 Identities = 78/354 (22%), Positives = 144/354 (40%), Gaps = 63/354 (17%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNR---------IRIAGSSTLFPYSKIIAENFSEYFP 52
           R   +VL   + + +         N+         I I GSST++P S  +AE F    P
Sbjct: 9   RIVSLVLGVALTVSLTACGDNTKSNQDVSTKLTGKIVIDGSSTVYPVSSAVAEEFQNEQP 68

Query: 53  EFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGH 112
           + +   V   G+  G+K+F  G     IDI ++SRKI   E +  K  G+  ++      
Sbjct: 69  DVEVS-VAMSGTGGGMKKFAAG----EIDICDASRKIKPEEAEAAKAKGIDFVELEVAYD 123

Query: 113 DGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVP 172
              ++V+  +  + S+TV++L K                +K W E+ P +P+  + +Y P
Sbjct: 124 GISVVVNKDNTWAESITVDELNKIWGKDS---------KVKTWKEVNPAWPDEPLKLYGP 174

Query: 173 SGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYT 232
               GT E   + + ++      +++                               D  
Sbjct: 175 GTDSGTFEFFTEVINKKAKESRTDYTP----------------------------SEDDN 206

Query: 233 ETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLL 287
             +  I  +KD  G+ G ++Y+ N D L+++ ID     I P++ TI +  Y P+SRPL 
Sbjct: 207 VLVQGIAGDKDAMGYFGFAYYEENQDSLRVLKIDSGKGPIEPNLETIKNNTYSPLSRPLY 266

Query: 288 FYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
            YV +   N    ++E++ F + +          + G +P+  E   + +  + 
Sbjct: 267 IYVNKNKINQSP-VKEFIEFYLDNAG----DLAKEVGYVPL--ESYDAEKAKLK 313


>gi|119512464|ref|ZP_01631545.1| periplasmic phosphate-binding protein of ABC transporter [Nodularia
           spumigena CCY9414]
 gi|119462868|gb|EAW43824.1| periplasmic phosphate-binding protein of ABC transporter [Nodularia
           spumigena CCY9414]
          Length = 353

 Score =  179 bits (452), Expect = 7e-43,   Method: Composition-based stats.
 Identities = 72/373 (19%), Positives = 141/373 (37%), Gaps = 70/373 (18%)

Query: 1   MR---FFFVVLMCFVVLEVYCGTGTFARN------------------RIRIAGSSTLFPY 39
           M+       + +  +V+   C T +   +                  +IRI GSST++P 
Sbjct: 1   MKATANKLALALGVLVVSTSCATSSNTSSKTPQSANVAQVSDSTKVSQIRIDGSSTVYPI 60

Query: 40  SKIIAENFSE-YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECK 98
           +  IAE F +          V   G+  G ++FC G      DI N+SR I Q E+  C 
Sbjct: 61  TVAIAEAFQQTKQQNKAQITVNFSGTGGGFEKFCAG----ETDISNASRPILQPEMVACD 116

Query: 99  KHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI 158
           K+GV   +         + V  ++  +  +T+ +L K         +      + +W+++
Sbjct: 117 KNGVRYFELPVAYDALTVAVHPQNDWAKDITIAELKKIW-------EPAAEGKITRWNQV 169

Query: 159 RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSV 218
           R  +P   + +Y    + GT +   + ++ +     ++++                    
Sbjct: 170 RASWPNRPLNLYGAGEQSGTFDYFTEAIVGKARASRKDYTA------------------- 210

Query: 219 RQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGT 274
                      D    +A I  + +  G+ G ++Y+ N D LK + +D     ++PS  T
Sbjct: 211 ---------SEDDETLVAGINNDPNALGYFGYAYYEQNQDKLKALAVDSGQGAVLPSRET 261

Query: 275 IVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER 333
           +    Y P+SRPL  Y   +       +++++ F + +            G  P+ +E  
Sbjct: 262 VEKSQYQPLSRPLFIYANFELAQKKPAVKDFLEFYLKNAPQ----TAISVGYAPLPDEAY 317

Query: 334 KSVRDSIAVGKSG 346
                +   GK G
Sbjct: 318 NIDYVNFNKGKVG 330


>gi|49481283|ref|YP_038331.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|49332839|gb|AAT63485.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar konkukian str. 97-27]
          Length = 305

 Score =  179 bits (452), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 69/351 (19%), Positives = 140/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWISASIKVFILSTCFFYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E K++ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKRNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWVDNMTVDELRLLWSED---------GNEKRWSQIHSSWPRKQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ+  +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQKSRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|47567834|ref|ZP_00238542.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Bacillus cereus G9241]
 gi|47555511|gb|EAL13854.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Bacillus cereus G9241]
          Length = 305

 Score =  179 bits (452), Expect = 8e-43,   Method: Composition-based stats.
 Identities = 70/351 (19%), Positives = 140/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWISASIKVFILSTCFFYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E KK+ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKKNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWVDNITVDELRLLWSEDESE---------KRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ+  +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQKSRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFVYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|152976705|ref|YP_001376222.1| phosphate binding protein [Bacillus cereus subsp. cytotoxis NVH
           391-98]
 gi|152025457|gb|ABS23227.1| phosphate binding protein [Bacillus cytotoxicus NVH 391-98]
          Length = 305

 Score =  178 bits (451), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 69/351 (19%), Positives = 143/351 (40%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F+V +C + L +           +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKGIHRLSKVFIVSICSIFLYMSPAFAANKIGEVRVDGSSTVFPIMEAVAEEYTKKEPHV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G + F  G     +D+ N+SR + + E    +++ +            
Sbjct: 61  KVS-ISISGTGGGFQRFGAG----EVDMNNASRSMKRVEEKMMRENSIQFTPLEIAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TVE+L +  +             +K+WS I P++P+  +  Y P  
Sbjct: 116 TMIVNRQNKWVDNMTVEELRRLWSED---------GSIKRWSHIHPEWPKENVQFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  VLQ+  +                                + +  D    
Sbjct: 167 DSGTYDYFQNVVLQKNRLVKT-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +++   FVG ++Y  N D +K + ++G+ P+  TI  G+Y P+SRPL  YV   
Sbjct: 198 MQGVMNDRNAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQFGMYKPLSRPLFAYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
             ++   + +YV+F +            + G + +  E+       +   +
Sbjct: 258 SLHNKESVADYVAFMM----KHVGELAEEVGYVRLPEEKYNDQLRMLTEIE 304


>gi|269122666|ref|YP_003310843.1| phosphate binding protein [Sebaldella termitidis ATCC 33386]
 gi|268616544|gb|ACZ10912.1| phosphate binding protein [Sebaldella termitidis ATCC 33386]
          Length = 297

 Score =  178 bits (451), Expect = 9e-43,   Method: Composition-based stats.
 Identities = 75/342 (21%), Positives = 142/342 (41%), Gaps = 52/342 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNR----IRIAGSSTLFPYSKIIAENFSEYFPEFKT 56
           M+  F +++  + L V CG G    +     + I GSST+ P ++ +AE F         
Sbjct: 1   MKKIFALMLISLGLLVSCGGGEGESSGLGGEVIIDGSSTVAPITEAVAEEFRNVESGVNV 60

Query: 57  PFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGIL 116
             V   G+  G K+F  G     +DI N+SR++   E    +K+ +   +         +
Sbjct: 61  S-VGISGTGGGFKKFTVG----ELDISNASREMKPEEKALAEKNNIEFTEIQVGKDGITM 115

Query: 117 LVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKH 176
           +V+  +  +  LT ++L K  +             +K W ++RP++P+  I +Y P    
Sbjct: 116 VVNKENTWAQDLTTDELKKIWSEGS---------TIKTWKDVRPEWPDTPIKLYAPDEDS 166

Query: 177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
           GT +   + +L +                            +R+D        D    + 
Sbjct: 167 GTYDYFIEAILGKNK--------------------------IRKDYTP---SSDDNVLVQ 197

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
            +E +K   GF G ++Y+ NAD L  + I+GI P+  T+ +G Y P+SRP+  +V  + +
Sbjct: 198 GVEGDKGSLGFFGFAYYEENADKLTALKINGIEPTPETVQNGTYKPLSRPIFIFVNNKSY 257

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
                ++ +V F +            + G IP+ +   +  +
Sbjct: 258 AEKPQVKAFVQFYLD----KVSDLAREVGYIPLDDYSAEKAK 295


>gi|172035803|ref|YP_001802304.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
 gi|171697257|gb|ACB50238.1| phosphate binding protein [Cyanothece sp. ATCC 51142]
          Length = 345

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 72/354 (20%), Positives = 136/354 (38%), Gaps = 52/354 (14%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEY--FPEFKTPFV 59
           R + V  +   +L             I+I GSST+FP ++ + E++      P  K   +
Sbjct: 12  RSWGVPFISLSLLSACGSVPESVIEPIKIDGSSTVFPITERVLESYKSEAVNPSIKELKI 71

Query: 60  ES--GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
           E    G++ G ++FC G      DI  +SR I+  E+  C  + +  I+         ++
Sbjct: 72  EGEFSGTTQGFEKFCTG----KTDINAASRPISTEEMTACSGNEIRYIELPIAFDAITVV 127

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +  + +LTVE L K         +    N + +W+++   +P   + +Y P    G
Sbjct: 128 VNPNNDWTQTLTVEQLRKMW-------EPTAENQVSQWNQVDQTYPNRPLTLYGPGELSG 180

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +   K ++ E     +++ K                              D    +  
Sbjct: 181 TYDYFTKAIVGETGASRQDYVK----------------------------SEDDEVLVTG 212

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKR 292
           +  + +   + G  +Y+ N D LK V +D    G++PS+ T+    Y P+SRPL  YV  
Sbjct: 213 VAQDPNALSYFGFGYYQQNQDKLKAVAVDNGKGGVIPSIETVKDEAYQPLSRPLFIYVNA 272

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +       L  +V + +          +   G IP+  +     +  +     G
Sbjct: 273 KRAQENPALEVFVEYYLD----KAPELVADAGYIPLPPDAYHLAKIHLQRFDVG 322


>gi|30264344|ref|NP_846721.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Ames]
 gi|47529791|ref|YP_021140.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|49187171|ref|YP_030423.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           anthracis str. Sterne]
 gi|65321649|ref|ZP_00394608.1| COG0226: ABC-type phosphate transport system, periplasmic component
           [Bacillus anthracis str. A2012]
 gi|118479445|ref|YP_896596.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           thuringiensis str. Al Hakam]
 gi|165872056|ref|ZP_02216696.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0488]
 gi|167634632|ref|ZP_02392952.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0442]
 gi|167638572|ref|ZP_02396848.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0193]
 gi|170687382|ref|ZP_02878599.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0465]
 gi|170707428|ref|ZP_02897882.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0389]
 gi|177655048|ref|ZP_02936714.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0174]
 gi|190565843|ref|ZP_03018762.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis Tsiankovskii-I]
 gi|196035050|ref|ZP_03102457.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus W]
 gi|196046398|ref|ZP_03113624.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 03BB108]
 gi|225866254|ref|YP_002751632.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 03BB102]
 gi|227817048|ref|YP_002817057.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. CDC 684]
 gi|229186513|ref|ZP_04313675.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BGSC 6E1]
 gi|229604682|ref|YP_002868562.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0248]
 gi|254684031|ref|ZP_05147891.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. CNEVA-9066]
 gi|254721865|ref|ZP_05183654.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A1055]
 gi|254736380|ref|ZP_05194086.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Western North America USA6153]
 gi|254741417|ref|ZP_05199104.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Kruger B]
 gi|254753946|ref|ZP_05205981.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Vollum]
 gi|254757818|ref|ZP_05209845.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Australia 94]
 gi|30258989|gb|AAP28207.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Ames]
 gi|47504939|gb|AAT33615.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. 'Ames Ancestor']
 gi|49181098|gb|AAT56474.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. Sterne]
 gi|118418670|gb|ABK87089.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Bacillus thuringiensis str. Al Hakam]
 gi|164712187|gb|EDR17724.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0488]
 gi|167513420|gb|EDR88790.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0193]
 gi|167530084|gb|EDR92819.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0442]
 gi|170127672|gb|EDS96545.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0389]
 gi|170668577|gb|EDT19323.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0465]
 gi|172080309|gb|EDT65398.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0174]
 gi|190562762|gb|EDV16728.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis Tsiankovskii-I]
 gi|195992589|gb|EDX56550.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus W]
 gi|196022868|gb|EDX61549.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 03BB108]
 gi|225786224|gb|ACO26441.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 03BB102]
 gi|227005283|gb|ACP15026.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. CDC 684]
 gi|228596944|gb|EEK54602.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BGSC 6E1]
 gi|229269090|gb|ACQ50727.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           anthracis str. A0248]
          Length = 305

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/351 (19%), Positives = 140/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWISASIKVFILSTCFFYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E K++ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKRNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWVDNMTVDELRLLWSEDESE---------KRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ+  +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQKSRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|301055766|ref|YP_003793977.1| phosphate ABC transporter phosphate-binding protein [Bacillus
           anthracis CI]
 gi|300377935|gb|ADK06839.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus biovar anthracis str. CI]
          Length = 305

 Score =  177 bits (449), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/351 (19%), Positives = 140/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWIGASIKVFILSTCFFYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E K++ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKRNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWVDNMTVDELRLLWSEDESE---------KRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ+  +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQKSRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|196041587|ref|ZP_03108879.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus NVH0597-99]
 gi|196027575|gb|EDX66190.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus NVH0597-99]
          Length = 305

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/351 (19%), Positives = 139/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWISASIKVFILSTCFFYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E  E K++ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEETEMKRNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWVDNMTVDELRLLWSEDESE---------KRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ+  +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQKSRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|327439645|dbj|BAK16010.1| ABC-type phosphate transport system, periplasmic component
           [Solibacillus silvestris StLB046]
          Length = 323

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 69/327 (21%), Positives = 125/327 (38%), Gaps = 48/327 (14%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
                    +   GSST+ P ++ + E ++    + +   V   G+  G ++F  G    
Sbjct: 44  TGSAQLTGNVVGDGSSTVAPITEALVEEYAGVQKDVRVA-VGVSGTGGGFEKFING---- 98

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
             D  N+SR I   E++E K  GV   +         ++V   +  +  LTV+ L K   
Sbjct: 99  ETDFSNASRPIKDTEMEELKNAGVEYTEFELAYDGLSVVVHPENTWAKDLTVDQLKKIW- 157

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                   +     KKWS+I P +P+  I  Y P    GT +  ++ +L    +      
Sbjct: 158 --------IEDGSTKKWSDIDPSWPDEEIVFYSPGSDSGTYDYFDEVILDGEDIVKTA-- 207

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
                                       +  D    +  +  +K+  G+ G ++Y  N D
Sbjct: 208 ---------------------------TLSEDDNVLVQGVTADKNAIGYFGYAYYLENKD 240

Query: 259 VLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
            L++V +DG+ P+  TI SG Y P+SRPL  YVK           +++ F++ +      
Sbjct: 241 KLQVVTVDGVEPTNETIESGEYSPLSRPLFVYVKNSALKDNEATYDFMKFTLENAG---- 296

Query: 318 SQLFQYGLIPISNEERKSVRDSIAVGK 344
                 G + + +E+ +     +   K
Sbjct: 297 EMAEVVGYVSLPDEKYEEALKELEGLK 323


>gi|218245884|ref|YP_002371255.1| phosphate-binding protein [Cyanothece sp. PCC 8801]
 gi|257058932|ref|YP_003136820.1| phosphate binding protein [Cyanothece sp. PCC 8802]
 gi|218166362|gb|ACK65099.1| phosphate binding protein [Cyanothece sp. PCC 8801]
 gi|256589098|gb|ACU99984.1| phosphate binding protein [Cyanothece sp. PCC 8802]
          Length = 318

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 77/346 (22%), Positives = 144/346 (41%), Gaps = 49/346 (14%)

Query: 5   FVVLMCFVVLEVYCGTG---TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
              L+  V   V        +  R  I I GSST++P ++ +AE F +         V  
Sbjct: 10  IASLLAVVTSTVALSVSQVQSQNRATISIDGSSTVYPVTEAVAEEFQKMKKGAVRVTVGV 69

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            G+  G K+FC G       I N+SR I ++E D CK  G++ I+         ++V+ +
Sbjct: 70  SGTGGGFKKFCNG----ETHISNASRPIKKSEQDACKAKGINYIELPVAYDALTVVVNPQ 125

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           +     LT  +L K   +            +  W++IR  +P+ +  +Y P    GT + 
Sbjct: 126 NKAVSDLTTAELKKMWQASS-------QGNVSSWNQIRASWPKDKFKLYGPGADSGTFDY 178

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
            ++++L +                            +R+D        D    +  +  +
Sbjct: 179 FKEEILGDAG--------------------------IRKDFTP---SEDDNVLVQGVSRD 209

Query: 242 KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLG 300
           K+  G+ G ++Y  N   LK V I+G++PS  T+ +G Y P+SRP+  YV  +   +   
Sbjct: 210 KNALGYFGFAYYDENKSRLKAVKINGVMPSAQTVNNGKYKPLSRPIYIYVSSK-VAAKPE 268

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           ++E+V++ +++          +   IP+   +    +   A G+ G
Sbjct: 269 IKEFVNYYLTNAAKFS----KEVAYIPLPAADYTKAKQRFANGQMG 310


>gi|138896034|ref|YP_001126487.1| phosphate-binding protein [Geobacillus thermodenitrificans NG80-2]
 gi|134267547|gb|ABO67742.1| Phosphate-binding protein [Geobacillus thermodenitrificans NG80-2]
          Length = 320

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 76/367 (20%), Positives = 138/367 (37%), Gaps = 70/367 (19%)

Query: 1   MRFFFVVLMC-----FVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKI 42
           M  +  +++       +V    CG G  A                + + GSST++P ++ 
Sbjct: 1   MNKWKRLMLSGVLSGMMVFVAACGGGNKAGGNDAEGESASELSGEVIMDGSSTVYPIAEA 60

Query: 43  IAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV 102
            AE +    P  K   V   G+  G ++F +G      D  N+SR I + E      + +
Sbjct: 61  AAEEYMTEQPNVKVS-VGMSGTGGGFEKFSKG----ESDFSNASRPIKEEEKQAAAANDI 115

Query: 103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDF 162
              +         ++V+  +     LTV++L K                 KKWS+IR  +
Sbjct: 116 EFQEFQLAYDGLSVVVNKENDWVDYLTVDELKKMWTED---------GKEKKWSDIRSGW 166

Query: 163 PEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDG 222
           P+  I  + P    GT +  ++ +L+   +                              
Sbjct: 167 PDEEIQFFSPGHDSGTYDYFDEVILEGKEMVKTA-------------------------- 200

Query: 223 IAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSG 278
              ++  D    +  +E ++   G+ G ++Y  N D LK+VPID     I P+  TI +G
Sbjct: 201 ---QLSEDDNILVRGVEGDRYAIGYFGYAYYLENKDKLKIVPIDAGNGPIEPTNETIETG 257

Query: 279 LY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
            Y P+SRPL  YV  +       + +Y+ F +            + G + +  E+ K   
Sbjct: 258 KYTPLSRPLFTYVNVKSLKEKPQVYDYMEFLLETAG----DLAEEVGYVRLPEEKYKEQL 313

Query: 338 DSIAVGK 344
           +++   K
Sbjct: 314 ETLQGLK 320


>gi|56751671|ref|YP_172372.1| phosphate transport system substrate-binding protein [Synechococcus
           elongatus PCC 6301]
 gi|81301253|ref|YP_401461.1| phosphate binding protein [Synechococcus elongatus PCC 7942]
 gi|56686630|dbj|BAD79852.1| phosphate transport system substrate-binding protein [Synechococcus
           elongatus PCC 6301]
 gi|81170134|gb|ABB58474.1| Phosphate binding protein [Synechococcus elongatus PCC 7942]
          Length = 337

 Score =  177 bits (448), Expect = 2e-42,   Method: Composition-based stats.
 Identities = 76/361 (21%), Positives = 142/361 (39%), Gaps = 61/361 (16%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNR----------IRIAGSSTLFPYSKIIAENFSEYF 51
           +F  + L    VL     +    ++           +++ GSST+FP  + +AE F +  
Sbjct: 5   KFRLLGLATLAVLATTACSSGEQQSSAGGGSALSGDVKVDGSSTVFPIGEAMAEEFQKSN 64

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
            + +     SG      K+FC G      DI N+SR I  +E++ C+K+G+  ++     
Sbjct: 65  GDVRVTVGVSGTGGG-FKKFCAG----ETDISNASRPIKSSEMELCQKNGIEYVELPVAY 119

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               ++V++ +  +  LT   L  A        D+     +  W++I P FP+  + +Y 
Sbjct: 120 DALSVVVNNENNFATCLTPAQLKTAW-------DEAAEGKISNWNQIDPSFPDTPLVLYG 172

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P    GT +  ++ V+ E      +F+                               D 
Sbjct: 173 PGTDSGTYDYFKEAVIGEDG-TRGDFTA----------------------------SEDD 203

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLV-----PIDGIVPSMGTIVSGLY-PISRP 285
              +  +E +    GF GL++ + NA  LK +       D + PS+ T   G Y P+SRP
Sbjct: 204 NIIVQGVERSPGAMGFFGLAYLEENAGKLKALNIQNSKGDCVAPSVETTRDGSYEPLSRP 263

Query: 286 LLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           L  Y+ +        ++ +  + V+    A    + + G I + +     V D +    +
Sbjct: 264 LFVYIAKSALEK-PQVQAFAEYLVNP---ANGKLVAEAGYIQLPDALLPKVVDRLKNQTT 319

Query: 346 G 346
           G
Sbjct: 320 G 320


>gi|229157885|ref|ZP_04285960.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 4342]
 gi|228625842|gb|EEK82594.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 4342]
          Length = 305

 Score =  177 bits (447), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 69/351 (19%), Positives = 140/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWISASIKVFILSTCFFYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E +K+ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMRKNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWIDNITVDELRLLWSEDESE---------KRWSQIHSSWPREQVKFYAPGI 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ+  +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQKSRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|282899650|ref|ZP_06307614.1| Phosphate binding protein [Cylindrospermopsis raciborskii CS-505]
 gi|281195529|gb|EFA70462.1| Phosphate binding protein [Cylindrospermopsis raciborskii CS-505]
          Length = 348

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 78/362 (21%), Positives = 140/362 (38%), Gaps = 60/362 (16%)

Query: 2   RFFFVVLMCFVVLEVYC----GTGTFA--------RNRIRIAGSSTLFPYSKIIAENFSE 49
           R    V M  +           +   A          +++I GSST++P ++ I + F++
Sbjct: 7   RLLITVGMLTLATSCTADVNKNSSVEATKDVNSQIARKVKIDGSSTVYPITQAIVKEFTK 66

Query: 50  YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVT 109
                 +  V   G+  G K+FC        DI N+SR I+  E+ EC K+GV  I+   
Sbjct: 67  DGKNSSSVEVSVSGTGGGFKKFCSN----ETDINNASRPISAKEMAECNKNGVRYIEIPV 122

Query: 110 IGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI 169
                 ++V+ R+     +TV++L K   S            + KW+++R  +P+  + +
Sbjct: 123 AFDALTVVVNPRNNWVQDMTVDELRKIWESQS-------QGKITKWNQVRASWPDRPLKL 175

Query: 170 YVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDG 229
           Y P    GT +   + ++ +      +++                               
Sbjct: 176 YGPGKDSGTYDYFVEAIIGKEKASRNDYTA----------------------------SE 207

Query: 230 DYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV----PSMGTIVSGLY-PISR 284
           D    +  +  + +  G+ G ++Y+ N D LKLV +D       PS  T+    Y P+SR
Sbjct: 208 DDDVLVEGVNKDVNALGYFGYAYYEKNQDKLKLVAVDNKKGPILPSPETVGKSKYQPLSR 267

Query: 285 PLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           PL  YV          L E+V F +        + +   G +P+  E        +  GK
Sbjct: 268 PLFIYVNLWSGEKRAELYEFVDFYL----KKAPAIVNSVGSVPLPKEAYNIGYVHLHNGK 323

Query: 345 SG 346
           +G
Sbjct: 324 AG 325


>gi|75906270|ref|YP_320566.1| phosphate binding protein [Anabaena variabilis ATCC 29413]
 gi|75699995|gb|ABA19671.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Anabaena variabilis ATCC 29413]
          Length = 333

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 67/351 (19%), Positives = 142/351 (40%), Gaps = 51/351 (14%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
           F    L+        C +G   ++++ I G++  FP S  +AE + +   + K   V S 
Sbjct: 11  FCLTSLILSTSTITGCNSGQELKSQVSIDGAAVGFPISLAVAEEYQKVKADAKVS-VASS 69

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           G+  G  +FC G     IDIV +SR I   E+ +CK   +  ++         ++ + ++
Sbjct: 70  GTGGGFSKFCNG----DIDIVGASRTIRNEEIAKCKSKNIEFVELPIGLDGVAVIANPKN 125

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
             +  LT++++    ++            +  W+++ P FP++ + +Y P+   GT + L
Sbjct: 126 KFAQCLTIKEMNTIWSAKSD-------GKILTWNQVNPKFPKLPLKLYAPASDTGTFDYL 178

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            + V  +      +++                               +    +  +  ++
Sbjct: 179 TQAVTGKAKNGRTDYTPSH----------------------------NQNLLVQGVSGDE 210

Query: 243 DVFGFVGLSFYKNNADVLK-----LVPIDGIVPSM-GTIVSGLY-PISRPLLFYVKRQHF 295
              G+VG+S+Y  N + L       +  +   P     ++   Y P+SRPL  YV +   
Sbjct: 211 SALGYVGISYYIQNQEKLNLVAIENLKGECKKPVPLDNVLKNTYTPLSRPLFIYVSKISL 270

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           ++   ++E+V F + +     D      G + + +E    V+   A G++G
Sbjct: 271 DNKPVVKEFVDFYLENSWKWVDG----AGYVALPDEAYVKVKQKFAAGETG 317


>gi|324328178|gb|ADY23438.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar finitimus YBT-020]
          Length = 305

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 71/351 (20%), Positives = 138/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWISASIKVFILSTCFFYVGTSTAFAANEMGEVRVDGSSTVFPIIEAVAEEYTKVHPSV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E K++ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKRNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+  +    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRENTWVDNMTVDELRLLWSED---------GNEKRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ   +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQNNRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + +DG++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVDGVLPTKDTIQSGKYKPLSRSLFAYVNDA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYVEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|218248054|ref|YP_002373425.1| phosphate-binding protein [Cyanothece sp. PCC 8801]
 gi|257060622|ref|YP_003138510.1| phosphate binding protein [Cyanothece sp. PCC 8802]
 gi|218168532|gb|ACK67269.1| phosphate binding protein [Cyanothece sp. PCC 8801]
 gi|256590788|gb|ACV01675.1| phosphate binding protein [Cyanothece sp. PCC 8802]
          Length = 347

 Score =  176 bits (446), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 73/354 (20%), Positives = 141/354 (39%), Gaps = 52/354 (14%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEY--FPEFKTPFV 59
           +   V +   ++L       +     I++ GSST++P ++ + + + +   + + K   +
Sbjct: 13  KRVGVAIASLLMLPACSQVSSNDIKPIKVDGSSTVYPITQAVLKAYQQQPAWKQVKDLSI 72

Query: 60  ES--GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
           E    G+  G K+FC G      DI  +SR I   E+  C ++ V  I+         ++
Sbjct: 73  EDNFSGTGGGFKKFCDG----ETDINAASRPIMIEEMAACNQNQVRYIEIPIAFDALTVV 128

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+ ++  + +LTV  L  A  +            + +W+++ P +P   + +Y P  K G
Sbjct: 129 VNPKNNWTNTLTVTQLQTAWEAK-------AEGKITQWNQVDPTYPNNPLNLYGPDKKSG 181

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +   + VL       +++                                D    +  
Sbjct: 182 TYDYFREAVLGPNQDTRQDY----------------------------VFSADDEALVNG 213

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKR 292
           +  + +   + G ++Y+ N D LK V ID    G++PS  T+ +  Y P++RPL  YV  
Sbjct: 214 VSQDPNALAYFGYAYYEQNQDKLKAVGIDNGQGGVLPSRETVEANQYKPLTRPLFIYVNA 273

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +       L ++V F +     A    + Q G IP+S E     +      + G
Sbjct: 274 KRAQENPALEDFVKFYLE----AVPELVTQVGYIPLSEEGYHLAKIQFQRFEVG 323


>gi|56478170|ref|YP_159759.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Aromatoleum aromaticum EbN1]
 gi|56314213|emb|CAI08858.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           [Aromatoleum aromaticum EbN1]
          Length = 330

 Score =  176 bits (446), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 68/348 (19%), Positives = 139/348 (39%), Gaps = 50/348 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F  +     L ++      A++ +++ GSST+FP ++ +AE+  +         V   G+
Sbjct: 4   FKQVALATALVLFGSHAVHAQSIVKVDGSSTVFPITEAVAEDIQKARKGSVKVTVGISGT 63

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K+FCRG     ID+  +SR I + E++ C   G+   +         ++V+ ++  
Sbjct: 64  GGGFKKFCRG----EIDVSGASRPILKKEMEACASAGIRYYELPVAFDALTVIVNPKNTF 119

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
              LTVE L K                +  W +I   FP+V + ++      GT +   +
Sbjct: 120 VKQLTVEQLKKMWEPD-------AQGKVTSWKQIDSSFPDVPLKLFGAGSDSGTFDYFTE 172

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
            V+ +      +F+                               D    +  +  +++ 
Sbjct: 173 AVVGKAKASRGDFTA----------------------------SEDDNVLVQGVSRDQNA 204

Query: 245 FGFVGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
            G+ G ++Y  N   LK VPI       + P   +++SG Y P+SRP+  YV  +     
Sbjct: 205 IGYFGYAYYAENQGKLKAVPIVNKEGKAVSPGPDSVISGAYNPLSRPIFIYVSEKSLEK- 263

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
             +R++V++ + +          +   +P+  +  ++  +++   K G
Sbjct: 264 PEVRDFVAYYMKNAS----DLATEVKYVPLPPKAYETAMENVNKKKVG 307


>gi|42783398|ref|NP_980645.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 10987]
 gi|42739326|gb|AAS43253.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 10987]
          Length = 305

 Score =  176 bits (446), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 70/351 (19%), Positives = 140/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++ +CF  +             +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWISASIKVFILSICFFYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E KK+ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKKNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNAWVDNMTVDELRLLWSEDASE---------KRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ   +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQNNRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|254421481|ref|ZP_05035199.1| phosphate binding protein [Synechococcus sp. PCC 7335]
 gi|196188970|gb|EDX83934.1| phosphate binding protein [Synechococcus sp. PCC 7335]
          Length = 304

 Score =  176 bits (446), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 71/323 (21%), Positives = 132/323 (40%), Gaps = 48/323 (14%)

Query: 29  RIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRK 88
            I GSST++P +  +AE F +  P+     V   G+  G ++FC G      DI ++SR 
Sbjct: 2   NIDGSSTVYPITLEMAERFKQAKPDSPAISVNFSGTGGGFEKFCAG----ETDISDASRP 57

Query: 89  ITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVV 148
           I+  E+  CK +GV  I+         ++V+  +  +  +T+ +L     +         
Sbjct: 58  ISPEEMAACKANGVEYIELPVAFDALTVVVNAENTWAEEITLAELQTLWQAE-------A 110

Query: 149 FNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNV 208
              + +WS+IR D+P+  I +Y P  + GT +   + V+ E      +++          
Sbjct: 111 EGEITRWSQIRADWPDEPITLYGPGEESGTFDYFTEVVVGEEGASRTDYTA--------- 161

Query: 209 QQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID-- 266
                                D  E +  +    +   + G ++Y++    LK + +D  
Sbjct: 162 -------------------SEDDDELVQGVRSEVNALSYFGFAYYRDAEKSLKALAVDSG 202

Query: 267 --GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
              + P+  T+ SG Y P+SRPL  YV+         L  +V + +++      + +   
Sbjct: 203 DGPVEPTGETLRSGEYQPLSRPLFIYVRADGLEENSALSSFVEYYLANA----RTVVDDV 258

Query: 324 GLIPISNEERKSVRDSIAVGKSG 346
           G  P+ NE      D +   K G
Sbjct: 259 GYEPLPNEAYAIALDHLTERKVG 281


>gi|119485723|ref|ZP_01619998.1| Phosphate binding protein [Lyngbya sp. PCC 8106]
 gi|119457048|gb|EAW38175.1| Phosphate binding protein [Lyngbya sp. PCC 8106]
          Length = 343

 Score =  176 bits (446), Expect = 4e-42,   Method: Composition-based stats.
 Identities = 67/347 (19%), Positives = 134/347 (38%), Gaps = 49/347 (14%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
             +   V+L             I+I GSST++P ++ I E F+    +         G+ 
Sbjct: 17  FAIGTTVLLSGCGSNQAQQNEPIKIDGSSTVYPITEKIVEQFNSESTKNVDVTANFSGTG 76

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G ++FC G      DI N+SR I+++E++ CK++ ++ I+         ++V  ++  +
Sbjct: 77  GGFQKFCAG----ETDINNASRPISRSEMEVCKQNNIAYIELPVAFDALSVVVHPQNTWA 132

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
             ++VE+L K                +  W+++RP +P   + +Y P    GT +   + 
Sbjct: 133 SDISVEELKKIWEPG-------AQGRITTWNQVRPSWPNRPLVLYGPGTDSGTYDYFTEA 185

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           ++ +      +F+                               D       +  N +  
Sbjct: 186 IVGQPGASRSDFTA----------------------------SEDDEILAQGVSRNPNAL 217

Query: 246 GFVGLSFYKNNADVLKLVPIDG-----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVL 299
           G+ G ++Y  N D LK + ID      ++PS        Y P++RPL  YV         
Sbjct: 218 GYFGYAYYNKNQDKLKPLAIDNGTGSAVMPSEENARQNQYRPLARPLFIYVNAVSAKDNP 277

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            + +++ F + +     +  +   G IP   ++   +  +    K G
Sbjct: 278 LMTDFIDFYLRNA----EGVVSSVGYIPFEEDDYALLFRNFHKTKVG 320


>gi|52141227|ref|YP_085602.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus E33L]
 gi|51974696|gb|AAU16246.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus E33L]
          Length = 305

 Score =  176 bits (445), Expect = 5e-42,   Method: Composition-based stats.
 Identities = 71/351 (20%), Positives = 139/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+FP  + IAE +++  P  
Sbjct: 1   MKWISASIKVFILSTCFFYVGTSTAFAVNEMGEVRVDGSSTVFPIIEAIAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E KK+ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKKNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWVDNMTVDELRLLWSEDESE---------KRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ+  +                                + +  D    
Sbjct: 167 DSGTYDYFQNVILQKSRIVKT-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFSYVNDA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|218905408|ref|YP_002453242.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH820]
 gi|218537349|gb|ACK89747.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH820]
          Length = 305

 Score =  175 bits (444), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 68/351 (19%), Positives = 139/351 (39%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++  CF  +             +R+ GSST+ P  + +AE +++  P  
Sbjct: 1   MKWISASIKVFILSTCFFYVGTSTAFAVNEMGEVRVDGSSTVXPIIEAVAEEYTKVHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E K++ +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKRNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+ ++    ++TV++L    +              K+WS+I   +P  ++  Y P  
Sbjct: 116 TIVVNRQNTWVDNMTVDELRLLWSEDESE---------KRWSQIHSSWPREQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +LQ+  +  +                             + +  D    
Sbjct: 167 DSGTYDYFQNVILQKSRIVKK-----------------------------VSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D ++ + ++G++P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMNDKNAIAFVGYAYYMANRDKVRAIKVNGVLPTKDTIQSGEYKPLSRSLFAYVNHA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              + + +  Y+ F +        +   + G + +  E+       +   K
Sbjct: 258 SIRNKMNVANYIEFMI----QHVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 304


>gi|148657710|ref|YP_001277915.1| phosphate binding protein [Roseiflexus sp. RS-1]
 gi|148569820|gb|ABQ91965.1| phosphate binding protein [Roseiflexus sp. RS-1]
          Length = 376

 Score =  175 bits (444), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 67/327 (20%), Positives = 132/327 (40%), Gaps = 50/327 (15%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              I I GSST++P +++  + F+E  P  +       G+  G K+FC GI     DI +
Sbjct: 73  SGDIVIDGSSTVYPITELAMQQFAEIAPNVRIQL-GVSGTGGGFKKFCAGI----TDISD 127

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I  +E + C+ +G+  ++         ++V+  +     +TV++L +  A      
Sbjct: 128 ASRPIKPDESEICRANGIEFVEIPVAFDGISVIVNPENRWVQCMTVDELKQMWAPDSE-- 185

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                  +  W +IR ++P+    +Y P    GT +     ++ +      ++       
Sbjct: 186 -----GKVVTWKQIRAEWPDQPFKLYAPGIDSGTHDYFTAAIVGKEDASRNDY------- 233

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                                    D    + R+   K+   +VG ++Y+   D + +V 
Sbjct: 234 ---------------------IGSEDDYILMQRVIEEKNGIAYVGFAYYQEYTDKVGVVA 272

Query: 265 ID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           ID     + PS+ TI +G Y P++RPL  YV+    +    +  +V+F + +        
Sbjct: 273 IDAGNGCVSPSIETITNGTYTPLARPLFIYVRNDRLD-RPEVEAFVTFYLENAA----DL 327

Query: 320 LFQYGLIPISNEERKSVRDSIAVGKSG 346
           +     IP+     + V   +A   +G
Sbjct: 328 VQAARYIPLPPRVYELVGQRVAKRTTG 354


>gi|229071774|ref|ZP_04204989.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus F65185]
 gi|228711369|gb|EEL63329.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus F65185]
          Length = 305

 Score =  175 bits (444), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 75/348 (21%), Positives = 141/348 (40%), Gaps = 51/348 (14%)

Query: 1   MR---FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR     FV+ + F+  E+        +  +R+ GSST+FP  + +AE +++  P+ K  
Sbjct: 4   MRTPIKIFVLSIWFLCFEMSTAFALNDKGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS 63

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 64  -ISISGTGGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIV 118

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 119 VNRHNTWVDDMSVDELRLLWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 170 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 200

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 201 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIR 260

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 261 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|134093760|ref|YP_001098835.1| phosphate transporter [Herminiimonas arsenicoxydans]
 gi|133737663|emb|CAL60708.1| Phosphate-binding periplasmic protein precursor (PBP)
           [Herminiimonas arsenicoxydans]
          Length = 333

 Score =  175 bits (444), Expect = 6e-42,   Method: Composition-based stats.
 Identities = 74/354 (20%), Positives = 151/354 (42%), Gaps = 52/354 (14%)

Query: 1   MRFFFVVLM-CFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           M+  F  L     +    C     A+  I+I GSST+FP ++ +A++F +          
Sbjct: 1   MKLSFQTLSPLLFLTTALCIAPAQAQTFIKIDGSSTVFPITEAVADDFQDMKSGTVKVTT 60

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
              G+  G K+FC+G      DI N+SR I + E+DEC K+GV  ++         ++V+
Sbjct: 61  GIAGTGGGFKKFCKG----ETDISNASRPILKKEMDECAKNGVKYVELPIAFDALTVVVN 116

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            ++     +TVE+L K         +      + +W+++ P +P+  I ++      GT 
Sbjct: 117 PKNKFLNKITVEELKKMW-------EPAAQGTITRWNQVNPTWPDAPIKLFGAGADSGTF 169

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   + ++ +      +++                               D    +  + 
Sbjct: 170 DYFTEAIMSKSKSSRTDYTS----------------------------SEDDNVVVQGVA 201

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKR 292
            + +  G+ G ++Y +N+  LK+VPI        + PS+ +++ G Y P++RPL  YV  
Sbjct: 202 RDVNAIGYFGYAYYVDNSKRLKVVPIVHKAGKPAVAPSLKSVMDGTYQPLARPLFIYVSI 261

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +       ++E+V F + +          +   IP+++++ K    + +  K+G
Sbjct: 262 KAIERS-EVKEFVEFYLKNAQK----LAKEVKYIPLTDKDYKHAFTNFSNKKTG 310


>gi|166363669|ref|YP_001655942.1| ABC-transporter periplasmic phosphate-binding protein [Microcystis
           aeruginosa NIES-843]
 gi|166086042|dbj|BAG00750.1| ABC-transporter periplasmic phosphate-binding protein [Microcystis
           aeruginosa NIES-843]
          Length = 332

 Score =  175 bits (443), Expect = 7e-42,   Method: Composition-based stats.
 Identities = 70/354 (19%), Positives = 141/354 (39%), Gaps = 54/354 (15%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNR---IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           FF + L+    L   CG    +  +   + I G +  F  S  +AE +    P+ +   V
Sbjct: 7   FFLISLLMASNLIAGCGRPADSAEKQPPVSIDGGAVGFALSLAVAEEYQRIHPDARVS-V 65

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
            + G+  G  +FC G     +DI  +SR I + E+++C+++GV  ++         ++V+
Sbjct: 66  ATSGTGGGFSKFCAG----NLDIAGASRVIRKEEIEKCRENGVEFLELPMAIDGLAVIVN 121

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
            ++  +  LT+++L +   +            +  W +I P FP+ R+ ++ P    GT 
Sbjct: 122 KKNQFAKCLTIKELDRMWNTK-------AEGRITSWKQINPKFPDERLLLFAPPSDTGTF 174

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   + +  +      +F+                             + +    +  + 
Sbjct: 175 DYFTQAITGKRRNSRTDFTP----------------------------NRNQNALVQGVI 206

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIV-----PSM-GTIVSGLY-PISRPLLFYVKR 292
            N     ++G+SFY  N D L LV I+        P     ++  +Y P+SRPL  YV +
Sbjct: 207 GNPSALAYLGISFYMQNQDRLNLVAIENNEGKCVKPVPIDNVLRNVYNPLSRPLFIYVNK 266

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            +  +   L ++V F + +     D      G + + +E           G++G
Sbjct: 267 NNLKTNPSLEKFVRFYLENSWKWVDG----VGYVALPDEAYVKTLRKFERGETG 316


>gi|229047989|ref|ZP_04193565.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH676]
 gi|228723446|gb|EEL74815.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH676]
          Length = 302

 Score =  175 bits (443), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 74/348 (21%), Positives = 139/348 (39%), Gaps = 51/348 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR    V +  +    +  +  FA      +R+ GSST+FP  + +AE +++  P+ K  
Sbjct: 1   MRTPIKVFVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS 60

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 61  -ISISGTGGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIV 115

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 116 VNRHNTWVDDMSVDELRLLWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSG 166

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 167 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 197

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 198 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIR 257

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 258 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 301


>gi|30022352|ref|NP_833983.1| phosphate-binding protein [Bacillus cereus ATCC 14579]
 gi|229129550|ref|ZP_04258521.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-Cer4]
 gi|229146857|ref|ZP_04275222.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST24]
 gi|296504768|ref|YP_003666468.1| phosphate-binding protein [Bacillus thuringiensis BMB171]
 gi|29897909|gb|AAP11184.1| Phosphate-binding protein [Bacillus cereus ATCC 14579]
 gi|228636685|gb|EEK93150.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST24]
 gi|228654155|gb|EEL10022.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-Cer4]
 gi|296325820|gb|ADH08748.1| phosphate-binding protein [Bacillus thuringiensis BMB171]
          Length = 305

 Score =  175 bits (443), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 74/348 (21%), Positives = 139/348 (39%), Gaps = 51/348 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR    V +  +    +  +  FA      +R+ GSST+FP  + +AE +++  P+ K  
Sbjct: 4   MRTPIKVFVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS 63

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 64  -ISISGTGGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIV 118

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 119 VNRHNTWVDDMSVDELRLLWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 170 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 200

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 201 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYEPLSRPLLTYVNNASIR 260

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 261 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|37519583|ref|NP_922960.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
 gi|35210574|dbj|BAC87955.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
          Length = 335

 Score =  175 bits (443), Expect = 9e-42,   Method: Composition-based stats.
 Identities = 79/324 (24%), Positives = 128/324 (39%), Gaps = 48/324 (14%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I+I GSST+FP ++  AE F +         VE  G+  G K+FCRG      DI ++SR
Sbjct: 32  IQIDGSSTVFPITEAAAEAFQKSKQGAVKVTVEVSGTGGGFKKFCRG----ETDISDASR 87

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            I + E+D CKK G+  I+         ++V   +  +  LTV +L         +    
Sbjct: 88  PILKKEMDACKKMGIQYIELPVAFDALTVMVHPSNTWAGDLTVAELKTIWEPAAQI---- 143

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
               +  W+++R  FP V + +Y P    GT +   + V+ +      +F+         
Sbjct: 144 ---KITNWNQVRSSFPNVPLKLYGPGTDSGTFDYFTEAVVGKAKASRGDFTA-------- 192

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                                 D    +  I  +K+  G+ G ++Y  N + LK V IDG
Sbjct: 193 --------------------SEDDNVLVQGIANDKNALGYFGYAYYAENKNKLKAVGIDG 232

Query: 268 IV----PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
                 PS  T+  G Y P+SRP+  YV          LR++V F + +      +   Q
Sbjct: 233 GKGPVLPSEKTVEDGSYSPLSRPIFIYVNAAAAVEKPELRQFVEFYLKNA----PTLAKQ 288

Query: 323 YGLIPISNEERKSVRDSIAVGKSG 346
              +P+               + G
Sbjct: 289 VKYVPLPTTAYNVSLGHFQQNRIG 312


>gi|149178900|ref|ZP_01857478.1| Phosphate binding protein [Planctomyces maris DSM 8797]
 gi|148842239|gb|EDL56624.1| Phosphate binding protein [Planctomyces maris DSM 8797]
          Length = 333

 Score =  175 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 70/328 (21%), Positives = 136/328 (41%), Gaps = 52/328 (15%)

Query: 18  CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
                     ++I GSST++P S+ +AE F    P+ +   V   G+  G+K+F  G   
Sbjct: 47  SSEAGNLAGDVKIDGSSTVYPVSEAVAEEFRAVQPKVRV-TVGFSGTGGGMKKFIAG--- 102

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKAL 137
             +DI ++SR + + E + CK+ G+  I+         ++V+ ++     LTV  L +  
Sbjct: 103 -EVDICDASRAMKEKEANACKEQGIEFIELSVSFDGLAVIVNPKNTWCDCLTVGQLKELW 161

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
                V         K+W ++ P +P   I +Y P    GT +   + ++ E      ++
Sbjct: 162 RPESGV---------KQWKDLDPKWPAEDIKLYGPGTDSGTFDYFTEAIVGESKASRADY 212

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
           +                               D    +  +  +K+  G+ G ++Y+ N 
Sbjct: 213 TA----------------------------SEDDNVLVTGVSEDKNSLGYFGFAYYEENK 244

Query: 258 DVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           + LKL+ +DG      PS+ T+    Y P+SRPL  YV++        +  +V F + + 
Sbjct: 245 EKLKLLGVDGGKGCKKPSLETVRDNSYAPLSRPLFIYVRKSSLE-RPEVVAFVKFYLENA 303

Query: 313 MMAPDSQLFQYGLIPISNEERKSVRDSI 340
                +     G +P+S+E +++   + 
Sbjct: 304 A----ALSKDVGYVPVSDEVQEANMKAF 327


>gi|229111745|ref|ZP_04241293.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock1-15]
 gi|229152472|ref|ZP_04280664.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus m1550]
 gi|228631080|gb|EEK87717.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus m1550]
 gi|228671739|gb|EEL27035.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock1-15]
          Length = 305

 Score =  175 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/348 (21%), Positives = 139/348 (39%), Gaps = 51/348 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR    V +  +    +  +  FA      +R+ GSST+FP  + +AE +++  P+ K  
Sbjct: 4   MRTPIKVFVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS 63

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 64  -ISISGTGGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIV 118

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 119 VNRHNTWVDDMSVDELRLLWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 170 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 200

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 201 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIR 260

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 261 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|229198399|ref|ZP_04325105.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus m1293]
 gi|228585099|gb|EEK43211.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus m1293]
          Length = 278

 Score =  175 bits (442), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 67/320 (20%), Positives = 134/320 (41%), Gaps = 48/320 (15%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+
Sbjct: 5   GEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNA 59

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR + Q E +E KK+ +             ++V+ ++    ++TV++L    +       
Sbjct: 60  SRVMKQVEENEMKKNSIQFTPFEVAYDGLTIVVNRQNTWVDNMTVDELRLLWSEDESE-- 117

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +  +          
Sbjct: 118 -------KRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRIVKK---------- 160

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                              + +  D    +  +  +K+  GFVG ++Y  N D ++ + +
Sbjct: 161 -------------------VSLSEDDQVIMQGVMNDKNAIGFVGYAYYMANRDKVRAIKV 201

Query: 266 DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           +G++P+  TI SG Y P+SR L  YV      + + +  Y+ F +        + + + G
Sbjct: 202 NGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNKMNVANYIEFMI----QHVGNLVEEVG 257

Query: 325 LIPISNEERKSVRDSIAVGK 344
            + +  E+       +   K
Sbjct: 258 YVKLPKEKYNEQLRMLTEIK 277


>gi|229180549|ref|ZP_04307891.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 172560W]
 gi|228602973|gb|EEK60452.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 172560W]
          Length = 305

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 75/348 (21%), Positives = 140/348 (40%), Gaps = 51/348 (14%)

Query: 1   MR---FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR     FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K  
Sbjct: 4   MRTPIKIFVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS 63

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 64  -ISISGTGGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIV 118

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 119 VNRHNTWVDDMSVDELRLLWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 170 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 200

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 201 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIR 260

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 261 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|206971230|ref|ZP_03232181.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1134]
 gi|206734002|gb|EDZ51173.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1134]
          Length = 305

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/348 (21%), Positives = 139/348 (39%), Gaps = 51/348 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR    V +  +    +  +  FA      +R+ GSST+FP  + +AE +++  P+ K  
Sbjct: 4   MRTPIKVFVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS 63

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 64  -ISISGTGGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIV 118

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 119 VNRHNTWVDDMSVDELRLLWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 170 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 200

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 201 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIR 260

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 261 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|228960537|ref|ZP_04122186.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pakistani str. T13001]
 gi|228799137|gb|EEM46105.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pakistani str. T13001]
          Length = 305

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/348 (21%), Positives = 139/348 (39%), Gaps = 51/348 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR    V +  +    +  +  FA      +R+ GSST+FP  + +AE +++  P+ K  
Sbjct: 4   MRTPIKVFVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS 63

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 64  -ISISGTGGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQFTSFEVANDGLTIV 118

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 119 VNRHNTWVDDMSVDELRLLWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 170 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 200

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 201 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIR 260

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 261 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|37519584|ref|NP_922961.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
 gi|35210575|dbj|BAC87956.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
          Length = 338

 Score =  174 bits (441), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 74/334 (22%), Positives = 139/334 (41%), Gaps = 48/334 (14%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFK-TPFVESGGSSVGLKEFCRGIGD 77
              +  + +++I GSST++P ++  A+ F E    ++ T  V   G+  G K+FC G   
Sbjct: 24  QNASDEQVKVKIDGSSTVYPITRAAAKAFEEQNKPYQGTIAVAFSGTGGGFKKFCAG--- 80

Query: 78  DTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKAL 137
            T DI ++SR I Q E+D C+ + V+ ++         ++V  ++  +  +TV +L K  
Sbjct: 81  -TTDISDASRPILQKEIDACRNNNVAFMELPVAFDALTVVVHPKNTWASEITVAELKKIW 139

Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF 197
                  ++     + +WS++R  FP+  + +Y P    GT +   + +L      +R+ 
Sbjct: 140 -------ERASQGKVTRWSQVRAGFPDRPLKLYGPGRDSGTYDYFAEAILGSANTDTRSD 192

Query: 198 SKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNA 257
                                           D    +  +  + D  G+ G ++Y+ N 
Sbjct: 193 Y---------------------------VDSEDDDVLVKGVSEDPDALGYFGYAYYEANK 225

Query: 258 DVLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           D LK + +DG    + P+   +  G Y P+SRPL  YV          +RE+V + + + 
Sbjct: 226 DKLKALAVDGGKGPVPPTDKNVEKGTYAPLSRPLFIYVNIVSTQKKPEVREFVKYYLDNG 285

Query: 313 MMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
               +      G +P+  E      +    GK G
Sbjct: 286 ----EKLAASVGYVPLPEEGYHIASNHFFRGKRG 315


>gi|315426896|dbj|BAJ48516.1| phosphate ABC transporter substrate-binding protein [Candidatus
           Caldiarchaeum subterraneum]
          Length = 347

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 69/332 (20%), Positives = 128/332 (38%), Gaps = 53/332 (15%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
                  I + GSST++P ++  AE F           V   G+  G K F  G      
Sbjct: 45  SVQLAGDIEVDGSSTVYPLTEAAAEQFMNIHKGVTIS-VGISGTGGGFKRFVIG----ET 99

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           DI ++SR I + E +   K+GV  I+        +++V   +     +T+ +L       
Sbjct: 100 DINDASRPILRAEAETAAKNGVEWIEVPVAIDALVVVVHPSNNWVDCITISELRAIWRPD 159

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
                      +K WS+IRP++P   I +Y P    GT +   ++V+ +      ++   
Sbjct: 160 S---------TVKLWSDIRPEWPNQPIKLYGPGPDSGTFDYFTERVVGKSKASRTDYVA- 209

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                                        D    +A +E ++   G+ G S++  N D +
Sbjct: 210 ---------------------------SEDDNVLVAGVESDRLSLGYFGFSYFAENKDRI 242

Query: 261 KLVPI-------DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
           K++ +       + + PS  T  +  YP++RPL  YV ++ +++   LRE+V + V +  
Sbjct: 243 KVLKVKDDLAGGECVEPSDETARTFTYPLARPLFIYVNKKSWDTKPHLREFVIYYVENGA 302

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIAVGKS 345
           M       +    P  +   K     +  G +
Sbjct: 303 M----LAHKVAYTPFLDHYYKKAAALLRAGIT 330


>gi|315648815|ref|ZP_07901910.1| phosphate binding protein [Paenibacillus vortex V453]
 gi|315275783|gb|EFU39135.1| phosphate binding protein [Paenibacillus vortex V453]
          Length = 332

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 82/322 (25%), Positives = 135/322 (41%), Gaps = 50/322 (15%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             I I GSSTL P ++ IAE F    P+ + P + +GG+  G K F        I + N+
Sbjct: 56  GTIEIDGSSTLHPLTEAIAEEFGAANPDVRIP-IGTGGTGAGFKRFNS----SEIAVANA 110

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR I   E +E K +G+   + +       ++V+  +     LTV++L K          
Sbjct: 111 SRPIKDTEAEEAKANGIEYHEVLVAYDGLSVVVNPSNEFVDKLTVDELKKIYEPNS---- 166

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                 +K W+++R  +P   I IY P   HGT +   + +  E      +         
Sbjct: 167 -----TVKTWADVREGWPAEEIKIYSPGTDHGTFDYFTEAINGEAQSSRNDKQ------- 214

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                              I    D    +  +  +K+  G+ G SFY+ N D LKLVPI
Sbjct: 215 -------------------ITFSADTNAVVQGVAGDKNSIGYFGFSFYEENQDKLKLVPI 255

Query: 266 DG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           D     + PS+ TI    Y P+SRPLL YV  +       +  +++F + +      S  
Sbjct: 256 DNGTATVAPSIETIKDNSYAPLSRPLLLYVNDKELE-RPEVNAFMNFYLENAA----SLA 310

Query: 321 FQYGLIPISNEERKSVRDSIAV 342
            + G +P+ +++ +   D +A 
Sbjct: 311 GEVGFVPLQDDQYQEEIDKLAK 332


>gi|326204676|ref|ZP_08194532.1| phosphate binding protein [Clostridium papyrosolvens DSM 2782]
 gi|325985243|gb|EGD46083.1| phosphate binding protein [Clostridium papyrosolvens DSM 2782]
          Length = 313

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 79/356 (22%), Positives = 142/356 (39%), Gaps = 64/356 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------RIRIAGSSTLFPYSKIIAENFSEY 50
           M+    + +   +       G+  +N          +I I GSST++P +  +AE F   
Sbjct: 7   MKRVVSLALGVALAVSVTACGSSTKNDNASNSNLSGKIVIDGSSTVYPVTSAVAEEFKNE 66

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
               +   V   G+  G+K+F  G     IDI ++SRKI   E++  K  G+  ++    
Sbjct: 67  QSGVEVS-VAMSGTGGGMKKFTAG----EIDICDASRKIKPEEVEAAKAKGIDYVELEIA 121

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
                ++V+  +  + ++TV++L K                +K W E+ P +P+  I +Y
Sbjct: 122 YDGISVVVNKDNTWAETITVDELNKIWGKDS---------KVKTWKEVNPAWPDEPIKLY 172

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
            P    GT E   +K+ ++      +++                               D
Sbjct: 173 GPGTDSGTFEFFTEKINKKAKESRTDYTP----------------------------SED 204

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRP 285
               +  I  +KD  G+ G ++Y+ N D LK++ ID     I P+  TI    Y P+SRP
Sbjct: 205 DNVLVQGISGDKDAMGYFGFAYYEENQDSLKVLKIDSGKGPIEPTAKTIKDKTYSPLSRP 264

Query: 286 LLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           L  YV +   N    ++E+V F +            + G IP+  E   + +  + 
Sbjct: 265 LYIYVNKNKLNQSP-VKEFVKFYIDKAEQ----LTKEVGYIPL--ESYDAEKAKLK 313


>gi|170078880|ref|YP_001735518.1| phosphate transport system substrate-binding protein [Synechococcus
           sp. PCC 7002]
 gi|169886549|gb|ACB00263.1| phosphate transport system substrate-binding protein [Synechococcus
           sp. PCC 7002]
          Length = 354

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 67/341 (19%), Positives = 134/341 (39%), Gaps = 55/341 (16%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
               + +     + I GSST+FP ++ +AE F    P+ +     SG       +FC G 
Sbjct: 42  APADSASGLSGDVLIDGSSTVFPITEAMAEEFQIANPDTRVTVGVSGTGGG-FSKFCAG- 99

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
                DI N+SR I+  E++ C++ G+  I+         ++++  +  +  LT E+L  
Sbjct: 100 ---ETDISNASRPISTEEIEACEQAGIEYIEIPVAYDAISVVINPENDWATCLTTEELAS 156

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +             +  WS++R  FP+  + +Y P    GT +     +  E      
Sbjct: 157 IWSPDS---------QINNWSQVREGFPDAPLTLYGPGTDSGTFDYFTDAINGEEGASRG 207

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
           +++                               D    +  +  + +  G+ GL++Y+ 
Sbjct: 208 DYTA----------------------------SEDDNVVVQGVVNDPNAMGYFGLAYYEE 239

Query: 256 NADVLKLVPID---------GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYV 305
           NAD L    ID          + PS  T+    Y P++RP+  YV     +    ++ ++
Sbjct: 240 NADNLNAAAIDDGDPSNGDGCVAPSTATVDDSTYQPLARPIFIYVSAASLDEKPQVQAFM 299

Query: 306 SFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            F  ++E     S + + G + +++E     ++ +A   +G
Sbjct: 300 DFYTAEE---NSSLVSEVGYVALNSEIYAKAQERLAARTTG 337


>gi|37519581|ref|NP_922958.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
 gi|35210572|dbj|BAC87953.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
          Length = 337

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 73/356 (20%), Positives = 141/356 (39%), Gaps = 52/356 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA----RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKT 56
           M+   + +   +V      T           ++I GSST++P ++   + F     +F+ 
Sbjct: 1   MKNKPLAVAASIVALAAGATLAQGLPAQAPSVKIDGSSTVYPITRAAVKAFEAEHKQFQG 60

Query: 57  PF-VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
              V   G+  G ++FC G      DI ++SR I Q E+DEC++  V+ ++         
Sbjct: 61  KIAVNFSGTGGGFRKFCSG----ETDISDASRPILQREMDECRRANVAFMELPVAFDALT 116

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
           ++V  ++  +  +TV +L K         ++     + +WS++RP FP+  + +Y P   
Sbjct: 117 VVVHPKNTWASEITVAELKKIW-------ERASQGKITRWSQVRPGFPDRPLRLYGPGRD 169

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GT +   + +L      +R+  +                              D    +
Sbjct: 170 SGTYDYFAEAILGSADTDTRSDYE---------------------------ASEDDDVLV 202

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYV 290
             +  + +  G+ G ++Y+ N + LK + +D     + P+   +  G Y P+SRPL  YV
Sbjct: 203 EGVAADPNALGYFGYAYYEANLNRLKTLAVDSGKGPVAPTDKNVEKGTYAPLSRPLFIYV 262

Query: 291 KRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                     +RE+V F + +            G +P+  E      +    GK G
Sbjct: 263 NIVSAQKKAEVREFVDFYLENGAK----LASLVGYVPLPAEGYHIANNHFHRGKRG 314


>gi|229192481|ref|ZP_04319444.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 10876]
 gi|228591058|gb|EEK48914.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus ATCC 10876]
          Length = 305

 Score =  174 bits (440), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 75/348 (21%), Positives = 140/348 (40%), Gaps = 51/348 (14%)

Query: 1   MR---FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR     FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K  
Sbjct: 4   MRTPIKIFVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS 63

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 64  -ISISGTGGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIV 118

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 119 VNRHNTWIDDMSVDELRLLWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 170 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 200

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 201 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIR 260

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 261 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|323500038|ref|ZP_08104992.1| phosphate binding protein [Vibrio sinaloensis DSM 21326]
 gi|323314894|gb|EGA67951.1| phosphate binding protein [Vibrio sinaloensis DSM 21326]
          Length = 333

 Score =  174 bits (439), Expect = 2e-41,   Method: Composition-based stats.
 Identities = 70/345 (20%), Positives = 134/345 (38%), Gaps = 48/345 (13%)

Query: 8   LMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVG 67
           + C  +      +   A++ I+I GSST++P +  +A+ +           V   G+  G
Sbjct: 10  ITCCAIALSATTSDVHAKDLIKIEGSSTVYPITYQLAKRYMLSEGTGTQVAVGISGTGGG 69

Query: 68  LKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS 127
            ++FCRG      DI N+SR I Q E   C+ +G+  I+         ++V+  +    S
Sbjct: 70  FRKFCRG----RTDISNASRPIKQKERQLCQANGIEFIELPVAMDAITVVVNSENTWLES 125

Query: 128 LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL 187
           L++  L +                L  WS+    FP   + ++ P    GT +   + V 
Sbjct: 126 LSLRQLNQIWQRE-------AEASLTSWSQFDAKFPNNPLQLHGPGPDSGTYDYFTE-VT 177

Query: 188 QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGF 247
             G    +++                              + D +  +A +  + +   F
Sbjct: 178 LAGEPSRQDYIA----------------------------NEDDSAMVAEVAADPNAMAF 209

Query: 248 VGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGL 301
           +G ++Y  N D LK + I       ++P++  ++ G Y  +SRPL  YV +        +
Sbjct: 210 LGFAYYLQNQDKLKAIAISEFGGPPMLPNVENVMEGGYSALSRPLFIYVNKASLEKRGSV 269

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           + ++      E +     L   G IP+S +     R  + + K+G
Sbjct: 270 KRFLEMYFQPENIDQTVALS--GYIPLSAQMYDVARQVLQLKKTG 312


>gi|86751347|ref|YP_487843.1| putative phosphate-binding periplasmic protein [Rhodopseudomonas
           palustris HaA2]
 gi|86574375|gb|ABD08932.1| putative phosphate-binding periplasmic protein [Rhodopseudomonas
           palustris HaA2]
          Length = 339

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 93/323 (28%), Positives = 161/323 (49%), Gaps = 14/323 (4%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
               AR+++ IA S +   ++K ++  F      FKTP V+ GG   GL  FCRG+G D 
Sbjct: 25  GPAEARDQLWIAASPSDQSFAKAVSVQFGRA-GRFKTPIVKDGGPPAGLMSFCRGVGPDN 83

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
            DI  SSR+I  +E++ C K+GV DI +V  G+D ++ V+++   + +L+   +Y A+A 
Sbjct: 84  FDIAFSSRRIASSEVELCNKNGVKDITQVQFGYDALVFVTNKASQTPALSRTAVYLAIAR 143

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            +     +  N             +    +Y+PS  HG R+V ++ ++   C  +  ++ 
Sbjct: 144 DVPDKGTLASNT-----------SKPANTLYIPSANHGARDVFDEMLMVSSCTSTGAYAI 192

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           ++       +    A     +    +      + TLAR++ +    G V  SFY NN D 
Sbjct: 193 IQKTN--PDKSKVAAQCRAARQAANVVNMDSDSGTLARLQSDPKGVGVVTWSFYTNNDDK 250

Query: 260 LKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           LK+V +DG+VPS  T+ SG +PI+ PL  YVK+     + G++E+++   S+    PD  
Sbjct: 251 LKVVALDGVVPSKATVASGTFPIAYPLYLYVKKAQIGQIPGIKEWIAEFTSENAFGPDGY 310

Query: 320 LFQYGLIPISNEERKSVRDSIAV 342
           L   GL+ + + +R+  R     
Sbjct: 311 LGDSGLVSMPDAQRRQSRADAQA 333


>gi|229141008|ref|ZP_04269551.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST26]
 gi|228642441|gb|EEK98729.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST26]
          Length = 278

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 67/320 (20%), Positives = 132/320 (41%), Gaps = 48/320 (15%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+
Sbjct: 5   GEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNA 59

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR + Q E +E KK+ +             ++V+ ++    ++TV++L    +       
Sbjct: 60  SRVMKQVEENEMKKNSIQFTPFEVAYDGLTIVVNRQNTWVDNMTVDELRLLWSEDESE-- 117

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +  +          
Sbjct: 118 -------KRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRIVKK---------- 160

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                              + +  D    +  +  +K+  GFVG ++Y  N D ++ + +
Sbjct: 161 -------------------VSLSEDDQVIMQGVMNDKNAIGFVGYAYYMANRDKVRAIKV 201

Query: 266 DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           +G++P+  TI SG Y P+SR L  YV      + + +  Y+ F +            + G
Sbjct: 202 NGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNKMNVASYIEFMI----QHVGKLAEEVG 257

Query: 325 LIPISNEERKSVRDSIAVGK 344
            + +  E+       +   K
Sbjct: 258 YVKLPKEKYNEQLRMLTEIK 277


>gi|218899438|ref|YP_002447849.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus G9842]
 gi|218542847|gb|ACK95241.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus G9842]
          Length = 305

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 75/348 (21%), Positives = 140/348 (40%), Gaps = 51/348 (14%)

Query: 1   MR---FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR     FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K  
Sbjct: 4   MRTPIKIFVLSIWFLCFEMSTAFALNNTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS 63

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 64  -ISISGTGGGFNRFGKG----EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIV 118

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 119 VNWHNTWVDDMSVDELRLLWSED---------GSEKRWSQIHSTWPREQVNFYAPGVDSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 170 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 200

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 201 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIR 260

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 261 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|158333396|ref|YP_001514568.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Acaryochloris marina MBIC11017]
 gi|158303637|gb|ABW25254.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Acaryochloris marina MBIC11017]
          Length = 330

 Score =  173 bits (438), Expect = 3e-41,   Method: Composition-based stats.
 Identities = 76/348 (21%), Positives = 134/348 (38%), Gaps = 55/348 (15%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNR-IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
            V L   V    +  T   A+ + I+I GSST+FP S+ +AE F +         V   G
Sbjct: 12  VVSLAVAVSTTAFSATSADAQTKKIKIDGSSTVFPISEAVAEEFQKLTNNKVNVTVGVSG 71

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
           +  G K+FC G      DI ++SR I + E   C+     +  E+ +  D + +V ++  
Sbjct: 72  TGGGFKKFCAG----ETDISDASRPIKEKEQKLCE---GVEYIEIPVAFDALTVVVNKGN 124

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              S+TV +L K  +             +  W E+   +P  +I+ Y P    GT +   
Sbjct: 125 PIKSMTVAELKKMWSENP-------EGSVTTWKEVNSSWPADKISFYAPGSDSGTFDYFN 177

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
             + ++   +                               I    D    +  +    +
Sbjct: 178 GTIAKKNHRKD------------------------------ITASEDDNILVQGVSREPN 207

Query: 244 VFGFVGLSFYKNNADVLKLVPIDGIV----PSMGTIVSGLY-PISRPLLFYVKRQHFNSV 298
             G+ G ++Y+ N D L  V ID       PS   + +G Y P+SRP+  YV ++     
Sbjct: 208 GIGYFGFAYYEQNKDRLNAVAIDNGNGPVLPSREAVENGTYTPLSRPIFIYVNKKAA-KR 266

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
             +R++V++ +            + G IP+     +    +   GK+G
Sbjct: 267 PEVRQFVNYYLRKAA----EFSAEVGYIPLPAPAYQQAAKNFREGKTG 310


>gi|228910105|ref|ZP_04073925.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis IBL 200]
 gi|228849622|gb|EEM94456.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis IBL 200]
          Length = 305

 Score =  173 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 75/348 (21%), Positives = 140/348 (40%), Gaps = 51/348 (14%)

Query: 1   MR---FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR     FV+ + F+  E+           +R+ GSST+FP  + +AE +++  P+ K  
Sbjct: 4   MRTPIKIFVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS 63

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 64  -ISISGTGGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIV 118

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 119 VNWHNTWVDDMSVDELRLLWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 170 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 200

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 201 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIR 260

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 261 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|229075976|ref|ZP_04208952.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock4-18]
 gi|229117768|ref|ZP_04247137.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock1-3]
 gi|228665745|gb|EEL21218.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock1-3]
 gi|228707291|gb|EEL59488.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock4-18]
          Length = 305

 Score =  173 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 69/351 (19%), Positives = 134/351 (38%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++   F+   +           +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWMSASIKVFILSTWFLCFGISTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKEHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E K + +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKNNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+  +    ++TV++L    +              K+WS++   +P  ++  Y P  
Sbjct: 116 TIVVNRHNTWVDNMTVDELRLLWSED---------GREKRWSQVHSTWPRAQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +L                               R+    + +  D    
Sbjct: 167 DSGTYDYFQNVIL-----------------------------QNRRIVKKVSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMHDKNAIAFVGYAYYMANRDRVKAIKVNGVFPTKETIQSGDYKPLSRSLFTYVNDA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
                + +  YV F +        +   + G + +  E+       +   K
Sbjct: 258 SIRQKINVANYVEFMI----KHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|171058337|ref|YP_001790686.1| phosphate-binding protein [Leptothrix cholodnii SP-6]
 gi|170775782|gb|ACB33921.1| phosphate binding protein [Leptothrix cholodnii SP-6]
          Length = 334

 Score =  173 bits (437), Expect = 4e-41,   Method: Composition-based stats.
 Identities = 67/334 (20%), Positives = 135/334 (40%), Gaps = 51/334 (15%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
             +     ++I GSST+FP ++ +AE+F +         V   G+  G K+FC     D 
Sbjct: 22  AASAQAQVVKIDGSSTVFPITEGVAEDFQKSKKGAVKVTVGISGTGGGFKKFC----RDE 77

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
           IDI  +SR I + E+ +CK  GV   +         ++++ ++     +TV +L      
Sbjct: 78  IDISGASRPILKKEMADCKAAGVEYFELPVAFDALTVVMNPKNAFLKQITVAELKAIW-- 135

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
                +      + KW+++ P +P+  I ++      GT +   + +  +      +F+ 
Sbjct: 136 -----EPAAQGKIMKWNQVNPAWPDAPIKLFGAGADSGTFDYFTEAINGKSKASRGDFTA 190

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
                                         D    +  +  + +  G+ G ++Y  N   
Sbjct: 191 ----------------------------SEDDNVLVQGVSQDVNAIGYFGFAYYAENMAR 222

Query: 260 LKLVPI------DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDE 312
           LK VPI        ++PSM T+++G Y P++RP+  YV  +       ++E++ F + + 
Sbjct: 223 LKAVPIVEKAGKPAVLPSMETVLAGTYQPLARPIFIYVNAKSMAK-PEVKEFIDFYMKEG 281

Query: 313 MMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                    +   +P+  +   +  + +A GK G
Sbjct: 282 PK----IAKEVKYVPLPAKAYTTNLEHLAKGKKG 311


>gi|300711670|ref|YP_003737484.1| phosphate ABC transporter phosphate-binding protein
           [Halalkalicoccus jeotgali B3]
 gi|299125353|gb|ADJ15692.1| phosphate ABC transporter phosphate-binding protein
           [Halalkalicoccus jeotgali B3]
          Length = 368

 Score =  173 bits (437), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 69/325 (21%), Positives = 133/325 (40%), Gaps = 50/325 (15%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
           ++ IAGSST++P S+ +AE F    P+     V+S G+  G +           DI  +S
Sbjct: 62  QVIIAGSSTVYPISQAMAEEFQRENPDVNIS-VDSTGTGGGFE---NAFIPGDSDINGAS 117

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R+I++ E    +++ ++ I+           V++       +T E+L +           
Sbjct: 118 REISEEEQQAAEENDITPIEMQVGSDALTFAVNNNADWVDCVTFEELAQIWG-------- 169

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
              N  ++WS++R D+P+    +Y P+   GT +   + V+ EG     ++         
Sbjct: 170 --PNGAQQWSDVRDDWPDQPFELYGPATTSGTFDFFTETVIGEGGSHRSDYEST------ 221

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                                       +  IE +++  G+ G ++Y  N D +K + ID
Sbjct: 222 ----------------------EQDNIIVQGIEGSENAMGYFGYAYYDENQDRIKGLSID 259

Query: 267 G-----IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           G     + PS+ T  +G YP++RPL  YV          + E+V F +++   +    + 
Sbjct: 260 GGNGSCVEPSLETAQAGDYPLARPLFIYVSESSLQENQAVEEFVRFYINN---SSSDLVS 316

Query: 322 QYGLIPISNEERKSVRDSIAVGKSG 346
           + G +P +    +    +I     G
Sbjct: 317 EIGYVPANESMVEENLSTIDEVVGG 341


>gi|55378286|ref|YP_136136.1| phosphate ABC transporter phosphate-binding protein [Haloarcula
           marismortui ATCC 43049]
 gi|55231011|gb|AAV46430.1| phosphate ABC transporter phosphate-binding protein [Haloarcula
           marismortui ATCC 43049]
          Length = 337

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 70/321 (21%), Positives = 127/321 (39%), Gaps = 53/321 (16%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKE-FCRGIGDDTIDIVNS 85
           ++ I GSST+FP S  +AE F           V+S GS  G +  FC G      DI  +
Sbjct: 58  QVIIKGSSTVFPISDAMAEEFMAEHGNVNV-TVDSTGSGGGFENWFCPG----DSDINGA 112

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR IT  E+++C  + V  ++    G    + V++       LT ++L +  +    V  
Sbjct: 113 SRPITDAEIEQCSGNNVEPVEFEIAGDALTVAVNNDADWVDCLTFDELRQIWSDESDV-- 170

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                    WS++R ++P++ I  Y P+   GT +   + V+ E    +  +        
Sbjct: 171 -------TNWSDVRDEWPDMEIERYGPASTSGTFDYFNENVVGEDTEHTTEYQPT----- 218

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                                   +    +  I  N+   G+ G ++Y +N++ +K V +
Sbjct: 219 -----------------------EEDETIVQGIRDNEGGIGYFGFAYYNSNSEAVKAVEV 255

Query: 266 ------DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
                 +   PS+     G YP++RPL  Y           + E++ F +     A    
Sbjct: 256 KAEEDGECTAPSLANAKDGSYPLARPLFIYASESSLQ-NEAVYEFIRFYLE---QAETDI 311

Query: 320 LFQYGLIPISNEERKSVRDSI 340
           + + G +P S E+R    + +
Sbjct: 312 VQEIGYVPSSAEQRDENLEKL 332


>gi|283780576|ref|YP_003371331.1| phosphate binding protein [Pirellula staleyi DSM 6068]
 gi|283439029|gb|ADB17471.1| phosphate binding protein [Pirellula staleyi DSM 6068]
          Length = 352

 Score =  172 bits (436), Expect = 5e-41,   Method: Composition-based stats.
 Identities = 76/340 (22%), Positives = 137/340 (40%), Gaps = 53/340 (15%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
              G  T     + I GSST+FP ++ +AE F+          V   G+  G K+F RG 
Sbjct: 35  TGSGEATKLTGAVAIDGSSTVFPVTEAVAEEFNSQVSSDVQVTVGISGTGGGFKKFIRG- 93

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               ID+ ++SR I   E+  CK++G+  I+         + V+  +    ++T+++L K
Sbjct: 94  ---EIDVADASRPILAEEIAACKENGIEFIEIPVCFDALTVAVNPANDWVENITIDELKK 150

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
                           + KW++IRP++P+ ++ +Y      GT +   + V  +      
Sbjct: 151 IWEPS-------AEGKITKWNQIRPEWPDEKLVLYGAGTDSGTFDYFTEAVNGKAKSCRS 203

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
           +F                                D    +  I   K   GF+  ++Y+ 
Sbjct: 204 DFIP----------------------------SEDDNTLVQGIVGEKYSMGFIPFAYYEP 235

Query: 256 NADVLKLVPIDG--------IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVS 306
           N D +K + ID         I PS+ T+V G Y P+SRPL  YV ++       ++++V 
Sbjct: 236 NKDKMKALKIDWKSDDELGAIEPSLETVVGGTYNPLSRPLFIYVSKKAAE-RPEVKKFVE 294

Query: 307 FSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           F + +          +   +P+ +      +D  A  K+G
Sbjct: 295 FYLDNVA----ELSQEVKYMPLPDAAYTMAKDRFAALKTG 330


>gi|126660946|ref|ZP_01732035.1| SphX protein precursor [Cyanothece sp. CCY0110]
 gi|126617764|gb|EAZ88544.1| SphX protein precursor [Cyanothece sp. CCY0110]
          Length = 345

 Score =  172 bits (436), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 73/354 (20%), Positives = 137/354 (38%), Gaps = 52/354 (14%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEY--FPEFKTPFV 59
           R + V L+   +L         A   I+I GSST+FP ++ + E++         K   +
Sbjct: 12  RTWGVGLISLSLLSACGSVPESAIKPIKIDGSSTVFPITERVLESYESEAVNQPIKELNI 71

Query: 60  ES--GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
           E    G+  G ++FC G      DI  +SR I+  E+  C  + +  I+         + 
Sbjct: 72  EGEFSGTGGGFQKFCAG----ETDINAASRPISSEEMKVCSNNEIRYIELPIAFDAITIA 127

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +  + +LTVE L           +    N + +W+++ P +P   + +Y P    G
Sbjct: 128 VNPGNNWTDTLTVEQLKTMW-------EPTAENQVTQWNQVDPTYPNRPLTLYGPDELSG 180

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +   K ++ E     +++                                D    +  
Sbjct: 181 TYDYFTKAIVGETGASRQDYVA----------------------------SEDDEVLVTG 212

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKR 292
           +  + +  G+ G  +Y+ N D LK V +D    G++PS+ T+ +  Y P+SRPL  YV  
Sbjct: 213 LAQDPNGIGYFGYGYYQQNQDKLKAVAVDNGNGGVIPSLQTVENEEYQPLSRPLFIYVNA 272

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +       L  +V + +          + + G IP+  +     +  +     G
Sbjct: 273 KRAQENPALEVFVEYYLD----KAPELVAEAGYIPLPEDAYHLAKIHLQRFDVG 322


>gi|118594575|ref|ZP_01551922.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Methylophilales bacterium HTCC2181]
 gi|118440353|gb|EAV46980.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Methylophilales bacterium HTCC2181]
          Length = 334

 Score =  172 bits (436), Expect = 6e-41,   Method: Composition-based stats.
 Identities = 62/356 (17%), Positives = 131/356 (36%), Gaps = 55/356 (15%)

Query: 1   MRFF---FVVLMCFVVLEVYCGTGTFAR-NRIRIAGSSTLFPYSKIIAENFSEYFPEFKT 56
           M+      + +   V           A  + I+I GSST++P ++ +AE F         
Sbjct: 1   MKELNLGKLSVAAVVAGTFAFSNSATAAVDIIKIDGSSTVYPITEAVAEEFQIATG---- 56

Query: 57  PFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGIL 116
             ++      G     +        I  +SR I   E  +C + G+  I+         +
Sbjct: 57  --IKVTVGVSGTGGGFKKFCRGDTVISGASRPIKAKERKKCAEAGIEFIEVPVAYDALTV 114

Query: 117 LVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKH 176
           +++  +  +  +T E++ K         +      +  WS++R  +P+  + +Y P    
Sbjct: 115 VINKSNDWAKEMTPEEVKKMW-------EPAAQGKIMSWSQVRAGWPDTPLKLYGPGADS 167

Query: 177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
           GT +   + ++++      +F+                               D    + 
Sbjct: 168 GTFDYFTESIIKKSKAIRGDFTA----------------------------SEDDNVLVQ 199

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV-----PSMGTIVSGLY-PISRPLLFYV 290
            +  +K   G+ GL+++  N + L  V I         PS+ T ++G Y P++RPL  Y+
Sbjct: 200 GVAGDKGGIGYFGLAYFAENKNKLDAVAIKNAAGKFVLPSLETTMNGSYNPLARPLFIYL 259

Query: 291 KRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                     +++++ + +            + G IP S +E K++ D     K+G
Sbjct: 260 NATKAAFDPNVKKFIDYYLKYAGQ----MAQEVGYIPFSKDEYKAIEDHYKGLKTG 311


>gi|229104901|ref|ZP_04235560.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-28]
 gi|228678531|gb|EEL32749.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-28]
          Length = 305

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 69/351 (19%), Positives = 134/351 (38%), Gaps = 54/351 (15%)

Query: 1   MR------FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           M+        F++   F+   +           +R+ GSST+FP  + +AE +++  P  
Sbjct: 1   MKWMSASIKVFILSTWFLCFGMSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKEHPNV 60

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDG 114
           K   +   G+  G   F +G     +DI N+SR + Q E +E K + +            
Sbjct: 61  KIS-ISVSGTGGGFNRFSKG----EVDINNASRVMKQVEENEMKNNSIQFTPFEVAYDGL 115

Query: 115 ILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSG 174
            ++V+  +    ++TV++L    +              K+WS++   +P  ++  Y P  
Sbjct: 116 TIVVNRHNTWVDNMTVDELRLLWSED---------GREKRWSQVHSTWPRAQVKFYAPGV 166

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GT +  +  +L                               R+    + +  D    
Sbjct: 167 DSGTYDYFQNVIL-----------------------------QNRRIVKKVSLSEDDQVI 197

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
           +  +  +K+   FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SR L  YV   
Sbjct: 198 MQGVMHDKNAIAFVGYAYYMANRDRVKAIKVNGVFPTKETIQSGDYKPLSRSLFTYVNDA 257

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
                + +  YV F +        +   + G + +  E+       +   K
Sbjct: 258 SIRQKINVANYVEFMI----KHVGNLAEEVGYVKLQKEKYNEQLRMLTEIK 304


>gi|213019025|ref|ZP_03334832.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
 gi|212995134|gb|EEB55775.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Wolbachia endosymbiont of Culex quinquefasciatus JHB]
          Length = 272

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 87/270 (32%), Positives = 146/270 (54%), Gaps = 3/270 (1%)

Query: 71  FCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTV 130
           FC GIG+ T DI  SSR + + E + CK++ V+++ E+ IG+DGI++ +         T 
Sbjct: 2   FCSGIGEGTPDITTSSRPMKEVERELCKRNKVNEVIEIIIGYDGIVIANSNQSHRFDFTK 61

Query: 131 EDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEG 190
            DL++ L+SY   +D++V N  K WS++    P+  I IY P    GT E L   ++ + 
Sbjct: 62  NDLFETLSSYSEDNDRLVKNNKKFWSDVNQALPKTEIKIYGPHQNTGTHETLINFIMLDQ 121

Query: 191 CVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGL 250
                +  ++      + ++   AC+++R DG  IEV  +    + +++ NK+  G    
Sbjct: 122 YSCMNS--RIFKENYQDQEKRKKACSNIRDDGRYIEVGINENIIIQKLKSNKNALGIFSF 179

Query: 251 SFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVS 310
           SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H ++V GLRE++   V 
Sbjct: 180 SFLAKNQDEIQGSTIAGIEPTYKNISSGEYMLARPLYLYIKKEHLDTVDGLREFIREVV- 238

Query: 311 DEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           D +      L + GLIP+S+E  K V + +
Sbjct: 239 DSISTEGGYLSRLGLIPLSSENIKKVLEKV 268


>gi|30248546|ref|NP_840616.1| phosphate-binding protein [Nitrosomonas europaea ATCC 19718]
 gi|30138432|emb|CAD84442.1| Phosphate-binding protein [Nitrosomonas europaea ATCC 19718]
          Length = 337

 Score =  172 bits (435), Expect = 7e-41,   Method: Composition-based stats.
 Identities = 82/347 (23%), Positives = 143/347 (41%), Gaps = 49/347 (14%)

Query: 5   FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGS 64
           F+V +    L    GT   AR  ++I+GSST+FP ++ ++E+F               G+
Sbjct: 12  FLVAILGFALLSGIGTMVQARPLVKISGSSTVFPITEAVSEDFQAAKKGAIMVTAGIAGT 71

Query: 65  SVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV 124
             G K+FC     D +DIVN+SR I  +E+++C+++GV  I+         ++V+  +  
Sbjct: 72  GGGFKKFC----RDEVDIVNASRPILSSEMEQCRQNGVQYIEMPIAFDALTVVVNPGNDW 127

Query: 125 SVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEK 184
             S+TV +L K         +      +  W+++ P +P  RI ++      GT +   +
Sbjct: 128 IKSMTVAELKKIW-------EPAAQEKILNWNQVNPAWPNARIKLFGAGADSGTFDYFTE 180

Query: 185 KVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDV 244
            V+ +      +F+                               D    +  +  + + 
Sbjct: 181 AVVGKAKSSRGDFTA----------------------------SEDDNVLVQGVASDLNA 212

Query: 245 FGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVL 299
            GF G ++Y  N   LK V ID    GI+PSM T+ +G Y P+SRPL  YV  +      
Sbjct: 213 LGFFGFAYYIENHKKLKAVAIDNGSGGILPSMLTVQNGSYQPLSRPLFIYVNARSAGK-P 271

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            +RE+V F +          + +    P+  E        +     G
Sbjct: 272 EVREFVIFYM----QHAQQLVEEVRYFPLKKEFYDFNLKHLQNKTLG 314


>gi|220906108|ref|YP_002481419.1| phosphate-binding protein [Cyanothece sp. PCC 7425]
 gi|219862719|gb|ACL43058.1| phosphate binding protein [Cyanothece sp. PCC 7425]
          Length = 333

 Score =  172 bits (435), Expect = 8e-41,   Method: Composition-based stats.
 Identities = 70/331 (21%), Positives = 135/331 (40%), Gaps = 49/331 (14%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES-GGSSVGLKEFCRGIGDDTI 80
              RN +RI GSST++P S  I + F +              G+S G ++FC G      
Sbjct: 23  AQQRNIVRIDGSSTVYPISDAILKQFRQTEAGKPVEVAAKFSGTSGGFRKFCAG----ET 78

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           DI  +SR I   E++ C+K+ +  I+         + V+ ++  + S+TV +L K     
Sbjct: 79  DINGASRPINAKEMEACRKNVIPYIELPIAFDALTVAVNPQNTWATSMTVAELRKMW--- 135

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
               +      + +W+++R  +P   + ++      GT +   + ++ +  V   +F+  
Sbjct: 136 ----EPAAQGKITRWNQVRSTWPNRPLKLFGAGKDSGTFDYFTEAIMGKADVSRSDFTA- 190

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                                        D    +  +  + +  GF G ++++ N+  L
Sbjct: 191 ---------------------------SEDDAVLVRGVSQDTNALGFFGFAYFEANSGKL 223

Query: 261 KLVPIDGIV----PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMA 315
           K V ID       PS  T++   Y P++RPL  YV  +   +  GLR +V + + +    
Sbjct: 224 KAVAIDSGKGPVLPSQQTVLRNQYQPLARPLFIYVNARAAQTKPGLRAFVEYYLKNA--- 280

Query: 316 PDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
            +  + + G IP+  +  +  +     GK G
Sbjct: 281 -ERVVGKVGYIPLPADGYRLAQLHFTRGKVG 310


>gi|257093591|ref|YP_003167232.1| phosphate-binding protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257046115|gb|ACV35303.1| phosphate binding protein [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 342

 Score =  172 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 77/346 (22%), Positives = 134/346 (38%), Gaps = 49/346 (14%)

Query: 6   VVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSS 65
           V  +       +      A   ++I GSST++P ++ +A+ F           V   G+S
Sbjct: 14  VTSLVLSAALAFSPLAIGAEAVVKIDGSSTVYPIAEAMAQEFQRARLHEVHVNVGVSGTS 73

Query: 66  VGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVS 125
            G  +FCRG      DI ++SR I + E++ C K GV   +         ++V+ ++   
Sbjct: 74  GGFAKFCRG----ETDIASASRPILKKEMEACAKAGVRYYEMPLAYDALTVVVNPQNSFV 129

Query: 126 VSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKK 185
            SL+V +L K                +  W ++ P +P  +I +Y P    GT E   + 
Sbjct: 130 SSLSVAELRKLWEPR-------AQGKITTWRDLNPAWPPQKIKLYAPGADSGTFEYFTEV 182

Query: 186 VLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVF 245
           V+        + +                               D+   +  I  +KD  
Sbjct: 183 VVGTAKASRADATTA----------------------------EDHAVLVQGIAADKDAL 214

Query: 246 GFVGLSFYKNNADVLKLVPI----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLG 300
           G+V L +Y  N   LK V I    D ++P++  I SG Y P+SRP+  YV  +       
Sbjct: 215 GYVALDYYVENQQKLKAVAIGDGKDAVLPTIANIRSGGYQPLSRPIFLYVSEKSIEK-PA 273

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +R++V FS+ +        + +   +P+         + I   K G
Sbjct: 274 VRQFVDFSMKNAA----RVVEEVNYLPLPARAYNENLERITAKKVG 315


>gi|224367300|ref|YP_002601463.1| PstS1 [Desulfobacterium autotrophicum HRM2]
 gi|223690016|gb|ACN13299.1| PstS1 [Desulfobacterium autotrophicum HRM2]
          Length = 277

 Score =  172 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 86/272 (31%), Positives = 137/272 (50%), Gaps = 11/272 (4%)

Query: 1   MRFFFVVLMCFVVLEVYCGTG--TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           M+   + +     +    G      +R+ I I GSST++P++ ++AE F +    FKTP 
Sbjct: 1   MKKALLTIFALAFVAGVAGPSFADASRDYISIVGSSTVYPFATVVAERFGKSTK-FKTPK 59

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
           +ES GS  G K F  G+G    DI NSSR+I ++E ++  K+G+  I EV IG+DGI++ 
Sbjct: 60  IESTGSGGGHKLFGAGVGVQHPDITNSSRRIKKSEFEKATKNGIR-IVEVKIGYDGIVVA 118

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVV----FNPLKKWSEIRPDFPEVRIAIYVPSG 174
           + +      LT  DL+ ALA  +   D +      NP K W ++ P  P+V+I +  P  
Sbjct: 119 NSKQAAPFKLTRRDLFLALAKTVPSTDNIAGNTQPNPYKTWKDVNPSLPDVKIEVLGPPP 178

Query: 175 KHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTET 234
             GTR+   + V++ G         ++ M K + +     C +VR+DG  IE   +    
Sbjct: 179 TSGTRDAFVELVMEAGAEEFG---WIKAMAKTDKKAYKALCHTVREDGAYIEAGENDNLI 235

Query: 235 LARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
           + ++E N D  G  G SF   N D ++   ID
Sbjct: 236 VQKLEANPDALGIFGFSFLDQNTDKIQGSFID 267


>gi|229013491|ref|ZP_04170628.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides DSM 2048]
 gi|229135095|ref|ZP_04263898.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST196]
 gi|228648383|gb|EEL04415.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus BDRD-ST196]
 gi|228747903|gb|EEL97769.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides DSM 2048]
          Length = 284

 Score =  172 bits (434), Expect = 9e-41,   Method: Composition-based stats.
 Identities = 70/330 (21%), Positives = 130/330 (39%), Gaps = 48/330 (14%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +     T     +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G 
Sbjct: 1   MSTAFATNEMGEVRVDGSSTVFPIIEAVAEEYTKAHPNVKIS-ISISGTGGGFNRFSKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR +   E +  +K  +             ++V+ ++    ++T+++L  
Sbjct: 59  ---EVDINNASRLMKPVEENAMQKKFIQFTPFEVAYDGLTIVVNRQNTWVNNMTIDELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +             LK+WS+I   +P  ++  Y P    GT +  +  VLQ   +   
Sbjct: 116 LWSEN---------GRLKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVVLQNNRLVKT 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K+   FVG ++Y  
Sbjct: 167 -----------------------------VSLSEDDQVIMQGVMNDKNAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K + +DG+ P+  TI SG Y P+SRPL  YV      + + +  YV F +     
Sbjct: 198 NRDKVKAIQVDGVFPTKETIQSGTYKPLSRPLFTYVNHASIRNKINVANYVEFMI----K 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              S   + G + +  E+       +   K
Sbjct: 254 HVGSLAEEVGYVKLPKEKYNEQLRMLTEIK 283


>gi|309791213|ref|ZP_07685745.1| phosphate binding protein [Oscillochloris trichoides DG6]
 gi|308226775|gb|EFO80471.1| phosphate binding protein [Oscillochloris trichoides DG6]
          Length = 354

 Score =  172 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 67/326 (20%), Positives = 129/326 (39%), Gaps = 50/326 (15%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             I I GSST+FP ++  A  F  + P+ +       G+  G K+FC G     I I ++
Sbjct: 51  GTISIDGSSTVFPITEAAAITFRRFVPQVEISL-GVSGTGGGFKKFCAG----EIVIADA 105

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR I   E   C + G+  I+         ++V   +  +  +TVE+L +          
Sbjct: 106 SRPIKAEESATCAEAGIEYIELPIAFDGISVVVHPDNQWATCMTVEELRRLWQPQS---- 161

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                 + +WS+IR  +PE  I +Y   G  GT +   + ++       ++++       
Sbjct: 162 ---GGVIVRWSQIRAGWPENAIHLYGAGGDSGTYDYFTEAIVGSARASRQDYTA------ 212

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                                   D       +  + D  GF G ++Y  +A+ L+ + I
Sbjct: 213 ----------------------SEDDYLLAQDLSADPDGLGFFGYAYYVEHAENLRAIGI 250

Query: 266 D----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           D     + PS+ +I  G Y P++RP+  YV     +    +  ++ F +++      + +
Sbjct: 251 DNGAGCVAPSVTSIADGSYQPLARPIFLYVNAAALD-RPEVTAFLDFYLTNG----PALV 305

Query: 321 FQYGLIPISNEERKSVRDSIAVGKSG 346
                IP+ +     ++  +A   +G
Sbjct: 306 QDARYIPLPDTIYPLLKARLAQRSTG 331


>gi|325108979|ref|YP_004270047.1| phosphate binding protein [Planctomyces brasiliensis DSM 5305]
 gi|324969247|gb|ADY60025.1| phosphate binding protein [Planctomyces brasiliensis DSM 5305]
          Length = 336

 Score =  172 bits (434), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 76/368 (20%), Positives = 147/368 (39%), Gaps = 65/368 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNR--------------IRIAGSSTLFPYSKIIAEN 46
           MR  +   +  + +      G    +               ++IAGSST+ P S  +AE 
Sbjct: 1   MRNNWKSFVLALGVSCGLIAGCEQPSENGMGGGGAAGTGYVVQIAGSSTVSPVSSAVAEE 60

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
                       VE+ G+  G+++          DI  +SR I  +E+++C+ +GV  I+
Sbjct: 61  --ADNALGIKATVETTGTGPGMEKL----SRKECDISGASRPIKDSEVEKCQANGVEPIE 114

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
                    ++V+  +     L+V+ L K              + +KKWS++ P++PE  
Sbjct: 115 FEICIDGLSVVVNPENDWCECLSVDQLKKLWE---------YESGVKKWSDLNPEWPEEE 165

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           I ++ P  + GT +   + ++ +                          +  R D     
Sbjct: 166 IKLFGPDHESGTFDYFNEVIIGDVPEG---------------------QSPCRTDYT--- 201

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI-------DGIVPSMGTIVSGL 279
              + T  +  ++ +K   G+ G ++Y  N D LK++ I       D + PS  TI  G 
Sbjct: 202 QSVNDTTLVDGVKGSKYALGYFGYAYYVMNKDQLKVIGIANKDDKSDCVAPSETTIGDGS 261

Query: 280 Y-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRD 338
           Y P+SRPL  YV ++   +   ++++V + ++D        +   G I +  +  ++ R 
Sbjct: 262 YAPLSRPLFIYVNKEALQTKPEVKQFVEYYLNDGQAQ----VGDVGYIELPADRLEASRK 317

Query: 339 SIAVGKSG 346
            +A    G
Sbjct: 318 KLAENAEG 325


>gi|239617109|ref|YP_002940431.1| phosphate binding protein [Kosmotoga olearia TBF 19.5.1]
 gi|239505940|gb|ACR79427.1| phosphate binding protein [Kosmotoga olearia TBF 19.5.1]
          Length = 274

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 69/326 (21%), Positives = 138/326 (42%), Gaps = 59/326 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+  F+++     L +           + I GS+T++P +++ AE F +  P+     +E
Sbjct: 1   MKKAFLLVFLLTALIISA-------ETLVIKGSNTVYPVAQLWAEEFKKLHPDVDIS-IE 52

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GSS G+K       +   DI N+SR +  +E+ +             + +DGI ++ +
Sbjct: 53  GAGSSTGIKAL----FNRQTDIANASRWLKSSEIKKMNA-EGRYFIPFIVAYDGIAIIVN 107

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           + +   S+T++ LYK           +    + KW++I P  P+ RI +Y      GT E
Sbjct: 108 KSLGIDSITIDQLYK-----------IYSGKITKWNQIDPSLPKKRIVVYSRDNASGTFE 156

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + V+++                                   +++       + R++ 
Sbjct: 157 YFVEHVMKKEKF-----------------------------APYVQMLPSTNAEVERVKQ 187

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           NK   G++G+ +     D +K + ++GI P++  + SG YPISRPL  +V          
Sbjct: 188 NKYAIGYIGMGYVT---DEVKALKVEGIEPTVENVNSGKYPISRPLFMFVDATEGLPTGL 244

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLI 326
           + +++ F++S E  A    + + G +
Sbjct: 245 VMDFIRFALSPEGQA---LVLKVGYV 267


>gi|218231613|ref|YP_002369079.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus B4264]
 gi|218159570|gb|ACK59562.1| phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus B4264]
          Length = 305

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 73/348 (20%), Positives = 138/348 (39%), Gaps = 51/348 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR    V +  +    +  +  FA      +R+ GSST+FP  + +AE +++   + K  
Sbjct: 4   MRTPIKVFVLSIWFLCFEMSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHADVKIS 63

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            +   G+  G   F +G     +DI N+SR + Q E +E KK+ +             ++
Sbjct: 64  -ISISGTGGGFNRFSKG----EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIV 118

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+  +     ++V++L    +              K+WS+I   +P  ++  Y P    G
Sbjct: 119 VNRHNTWVDDMSVDELRLLWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSG 169

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +  +  +LQ   +  +                             + +  D    +  
Sbjct: 170 TYDYFQNVILQNHRIVKK-----------------------------VSLSEDDQVIMQG 200

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  +K    FVG ++Y  N D +K + ++G+ P+  TI SG Y P+SRPLL YV      
Sbjct: 201 VMNDKHAIAFVGYAYYMANRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIR 260

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           + + +  YV F +        +   + G + +  E+       +   K
Sbjct: 261 NKMNVANYVEFMI----QHVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 304


>gi|327540736|gb|EGF27305.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodopirellula baltica WH47]
          Length = 352

 Score =  171 bits (433), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 79/372 (21%), Positives = 135/372 (36%), Gaps = 72/372 (19%)

Query: 1   MRFF---FVVLMCFVVLEVYCGTGTFARNR----------------IRIAGSSTLFPYSK 41
           M+F    F  L+   V+   C   + +                   I++ GSST+ P S 
Sbjct: 1   MKFSSYAFSCLIALAVISTGCDKSSSSTETGADPSAPAAESNLVGTIKVDGSSTVQPISN 60

Query: 42  IIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHG 101
            I E F +  P      V   G+  G K F     D   DI ++SR I   E + CK +G
Sbjct: 61  AIREGFIKQHPNVDI-IVSGNGTGNGFKSF----YDKGTDISDASRPIKSGEFENCKTNG 115

Query: 102 VSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPD 161
           V  ++         ++V+ ++     LTV+ L                +  K WS++ P 
Sbjct: 116 VEFVELPVAYDGLTIVVNPQNDWVKELTVDQLKSMFVGD---------DAAKNWSDVDPS 166

Query: 162 FPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQD 221
           +PE  I IY P    GT +   + + ++     R                          
Sbjct: 167 WPEEAIQIYAPGTGSGTYDYFHEVLAKKSKKELR-------------------------- 200

Query: 222 GIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG------IVPSMGTI 275
              + ++ D    +  +  NK   GF G+++Y+ N D L+ VP+          P+   I
Sbjct: 201 -GDMNLNEDDNILVKGVSDNKFSIGFFGVAYYEENKDKLRAVPVVNPKDEVAYEPTTENI 259

Query: 276 VSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERK 334
            S  Y P SRPL  YV     N    ++ +V + + +          + G + +      
Sbjct: 260 ASNKYAPFSRPLFIYVNTDSLNRA-EVQTFVEYFLVN----TPEVSEKVGYVRLPEPVMA 314

Query: 335 SVRDSIAVGKSG 346
             + ++   K+G
Sbjct: 315 KAQTNLDAVKTG 326


>gi|156744215|ref|YP_001434344.1| phosphate binding protein [Roseiflexus castenholzii DSM 13941]
 gi|156235543|gb|ABU60326.1| phosphate binding protein [Roseiflexus castenholzii DSM 13941]
          Length = 369

 Score =  171 bits (432), Expect = 1e-40,   Method: Composition-based stats.
 Identities = 68/327 (20%), Positives = 130/327 (39%), Gaps = 50/327 (15%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              I I GSST++P +++  + F+   P          G+  G K+FC GI     DI N
Sbjct: 66  SGEIIIDGSSTVYPITELAMQQFAAVAPRVTIQL-GVSGTGGGFKKFCAGI----TDISN 120

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR I  +E D C+ +G++ ++         ++++  +  +  +TV+DL +  A      
Sbjct: 121 ASRPIKPDESDTCRANGIAFVEIPVAFDGISVIINRDNTWAQCMTVDDLKRMWAPESE-- 178

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                  +  W +IR D+P+    +Y P    GT +     ++ +      ++       
Sbjct: 179 -----GSVTTWRQIRSDWPDQPFKLYAPGVDSGTHDYFTAAIVGKEDASRNDY------- 226

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                                    D    + R+  +     +VG ++Y+  AD + +V 
Sbjct: 227 ---------------------IGSEDDYVLMQRVIEDAQGIAYVGYAYYQEYADKVGVVA 265

Query: 265 ID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
           +D     + PS+ TI  G Y P+SRPL  YV+    +    +  +V F ++         
Sbjct: 266 VDAGQGCVSPSLTTITEGTYTPLSRPLFIYVRADRLD-RPAMLAFVEFYINRAEQ----L 320

Query: 320 LFQYGLIPISNEERKSVRDSIAVGKSG 346
           +     IP+     + V+  +    +G
Sbjct: 321 VQDARYIPLPQRAYELVQQRVDRRVTG 347


>gi|229061965|ref|ZP_04199292.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH603]
 gi|229169018|ref|ZP_04296734.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH621]
 gi|228614427|gb|EEK71536.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH621]
 gi|228717349|gb|EEL69021.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH603]
          Length = 284

 Score =  171 bits (432), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 70/330 (21%), Positives = 130/330 (39%), Gaps = 48/330 (14%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +     T     +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G 
Sbjct: 1   MSTAFATNEMGEVRVDGSSTVFPIIEAVAEEYTKAHPNVKIS-ISISGTGGGFNRFSKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR +   E +  +K  +             ++V+ ++    ++T+++L  
Sbjct: 59  ---EVDINNASRLMKPVEENAMQKKSIQFTPFEVAYDGLTIVVNRQNTWVNNMTIDELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +             LK+WS+I   +P  ++  Y P    GT +  +  VLQ   +   
Sbjct: 116 LWSEN---------GRLKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVVLQNNRLVKT 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K+   FVG ++Y  
Sbjct: 167 -----------------------------VSLSEDDQVIMQGVMNDKNAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K + +DG+ P+  TI SG Y P+SRPL  YV      + + +  YV F +     
Sbjct: 198 NRDKVKAIQVDGVFPTKETIQSGTYKPLSRPLFTYVNHASIRNKINVANYVEFMI----K 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              S   + G + +  E+       +   K
Sbjct: 254 HVGSLAEEVGYVKLPKEKYNEQLRMLTEIK 283


>gi|228916905|ref|ZP_04080467.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
 gi|228935592|ref|ZP_04098408.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228947985|ref|ZP_04110271.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228811675|gb|EEM58010.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar monterrey BGSC 4AJ1]
 gi|228824130|gb|EEM69946.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar andalousiensis BGSC 4AW1]
 gi|228842729|gb|EEM87815.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pulsiensis BGSC 4CC1]
          Length = 278

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 65/320 (20%), Positives = 132/320 (41%), Gaps = 48/320 (15%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+
Sbjct: 5   GEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNA 59

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR + Q E +E K++ +             ++V+ ++    ++TV++L    +       
Sbjct: 60  SRVMKQVEENEMKRNSIQFTPFEVAYDGLTIVVNRQNTWVDNMTVDELRLLWSEDESE-- 117

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +  +          
Sbjct: 118 -------KRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRIVKK---------- 160

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                              + +  D    +  +  +K+   FVG ++Y  N D ++ + +
Sbjct: 161 -------------------VSLSEDDQVIMQGVMNDKNAIAFVGYAYYMANRDKVRAIKV 201

Query: 266 DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           +G++P+  TI SG Y P+SR L  YV      + + +  Y+ F +        +   + G
Sbjct: 202 NGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNKMNVANYIEFMI----QHVGNLAEEVG 257

Query: 325 LIPISNEERKSVRDSIAVGK 344
            + +  E+       +   K
Sbjct: 258 YVKLPKEKYNEQLRMLTEIK 277


>gi|32474706|ref|NP_867700.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodopirellula baltica SH 1]
 gi|32445245|emb|CAD75247.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Rhodopirellula baltica SH 1]
          Length = 310

 Score =  170 bits (431), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 74/328 (22%), Positives = 125/328 (38%), Gaps = 53/328 (16%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             I++ GSST+ P S  I E F +  P      V   G+  G K F     D   DI ++
Sbjct: 3   GTIKVDGSSTVQPISNAIREGFIKQHPNVDI-IVSGNGTGNGFKSF----YDKGTDISDA 57

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR I   E + CK +GV  ++         ++V+ ++     LTV+ L            
Sbjct: 58  SRPIKSGEFENCKTNGVEFVELPVAYDGLTIVVNPQNDWVKELTVDQLKSMFVGD----- 112

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
               +  K WS++ P +PE  I IY P    GT +   + + ++     R          
Sbjct: 113 ----DAAKNWSDVDPSWPEEAIQIYAPGTGSGTYDYFHEVLAKKSKKELR---------- 158

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                              + ++ D    +  +  NK   GF G+++Y+ N D L+ VP+
Sbjct: 159 -----------------GDMNLNEDDNILVKGVSDNKFSIGFFGVAYYEENKDKLRAVPV 201

Query: 266 DG------IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDS 318
                     P+   I S  Y P SRPL  YV     N    ++ +V + + +       
Sbjct: 202 VNPKDEVAYEPTTENIASNKYAPFSRPLFIYVNTDSLNRA-EVQTFVEYFLVN----TPE 256

Query: 319 QLFQYGLIPISNEERKSVRDSIAVGKSG 346
              + G + +        + ++  GK+G
Sbjct: 257 VSEKVGYVRLPEPVMAKAQTNLDAGKTG 284


>gi|89099173|ref|ZP_01172051.1| Phosphate-binding protein [Bacillus sp. NRRL B-14911]
 gi|89086019|gb|EAR65142.1| Phosphate-binding protein [Bacillus sp. NRRL B-14911]
          Length = 329

 Score =  170 bits (430), Expect = 2e-40,   Method: Composition-based stats.
 Identities = 86/377 (22%), Positives = 144/377 (38%), Gaps = 81/377 (21%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGT----------------------------FARNRIRIAG 32
           M+ F  + +  ++  V   T                                +  I I G
Sbjct: 1   MKSFKYLALSAMIGAVLAFTAACGNSEEGTTNGSQTDGGNSTEQASDEDKQLQGEINIDG 60

Query: 33  SSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQN 92
           SST++P  + + E F    P  K   V S G+  G K F  G      D+ N+SR I + 
Sbjct: 61  SSTVYPIMEAVVEEFGMEQPGVKVS-VASSGTGGGFKAFIAG----DTDLSNASRPIKEE 115

Query: 93  ELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPL 152
           E  E +  G+   +         ++VS  +     LTVE+L K           +    +
Sbjct: 116 EAAELESKGIEYTEFKLANDGLSVVVSKDNDWVDHLTVEELKKMW---------IEDGSV 166

Query: 153 KKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLS 212
           KKWS+IR  +PE  I  Y P    GT +  ++ +L+E  +  +                 
Sbjct: 167 KKWSDIREGWPEEEIKFYSPGTDSGTYDYFDEVILEEAPIVEKA---------------- 210

Query: 213 VACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----I 268
                         +  D    +  +  +K+  G+ G ++Y  N D LK+VPIDG    +
Sbjct: 211 -------------TLSEDDNVLVQGVTGDKNAIGYFGYAYYAENKDSLKVVPIDGGNGPV 257

Query: 269 VPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIP 327
            P+  T+ SG Y P+SRPL  YVK +       + E+V +++ +  +         G + 
Sbjct: 258 EPNNETVESGEYAPLSRPLFTYVKNESL-KNEEVYEFVKYTIENAGV----LSEDVGYVK 312

Query: 328 ISNEERKSVRDSIAVGK 344
           + +EE      ++   K
Sbjct: 313 LKDEEYDEAMKTLEGLK 329


>gi|228929316|ref|ZP_04092341.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
 gi|229123810|ref|ZP_04253004.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 95/8201]
 gi|228659631|gb|EEL15277.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus 95/8201]
 gi|228830330|gb|EEM75942.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar pondicheriensis BGSC 4BA1]
          Length = 278

 Score =  170 bits (429), Expect = 3e-40,   Method: Composition-based stats.
 Identities = 65/320 (20%), Positives = 132/320 (41%), Gaps = 48/320 (15%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+
Sbjct: 5   GEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNA 59

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR + Q E +E K++ +             ++V+ ++    ++TV++L    +       
Sbjct: 60  SRVMKQVEENEMKRNSIQFTPFEVAYDGLTIVVNRQNTWVDNMTVDELRLLWSEDESE-- 117

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +  +          
Sbjct: 118 -------KRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRIVKK---------- 160

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                              + +  D    +  +  +K+   FVG ++Y  N D ++ + +
Sbjct: 161 -------------------VSLSEDDQVIMQGVMNDKNAIAFVGYAYYMANRDKVRAIKV 201

Query: 266 DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           +G++P+  TI SG Y P+SR L  YV      + + +  Y+ F +        +   + G
Sbjct: 202 NGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNKMNIANYIEFMI----QHVGNLAEEVG 257

Query: 325 LIPISNEERKSVRDSIAVGK 344
            + +  E+       +   K
Sbjct: 258 YVKLPKEKYNEQLRMLTEIK 277


>gi|33865820|ref|NP_897379.1| ABC transporter substrate-binding protein [Synechococcus sp. WH
           8102]
 gi|33632990|emb|CAE07801.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. WH 8102]
          Length = 382

 Score =  170 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 75/344 (21%), Positives = 141/344 (40%), Gaps = 50/344 (14%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF-VES 61
             F+V+     L    G+   + + IRI+GSST+FP +K   + F          F V+ 
Sbjct: 45  RSFLVIAGCSALIGLAGSSAESADTIRISGSSTVFPITKAAIQGFRTTGQGKSVDFDVKE 104

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            GS+ G +EFC       I + N+SR I+  EL  C ++G++ I+         ++V+  
Sbjct: 105 TGSTAGFREFCSA----NIPLANASRPISGKELKRCAENGINFIELPIAFDAITVVVNPG 160

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           +  + S+TV +L +                + +W+++  D+P+  I +  P    GT +V
Sbjct: 161 NHWARSMTVNELSRLWNKS-------AQGTINRWNQVNLDYPDQAIKLCGPGNDSGTYDV 213

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
             K +         ++                                D  E +  +  N
Sbjct: 214 FNKTINGSKTNSRTDY----------------------------LASEDDNELVKCVADN 245

Query: 242 KDVFGFVGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
           +    + G ++YKNN   LK V I     + ++PS+ ++ +  Y P+SRPL  Y+  Q  
Sbjct: 246 RQALAYFGYAYYKNNIKKLKAVKIVNSKDNAVMPSVKSVQNEKYRPLSRPLFLYINDQSL 305

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
            +    R+++S+ + +      S +     IP+ +   + V   
Sbjct: 306 RNNKPFRQFISYYLRN----ISSLVTTSNYIPLPDATYRLVDSK 345


>gi|284165750|ref|YP_003404029.1| phosphate binding protein [Haloterrigena turkmenica DSM 5511]
 gi|284015405|gb|ADB61356.1| phosphate binding protein [Haloterrigena turkmenica DSM 5511]
          Length = 324

 Score =  170 bits (429), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 79/348 (22%), Positives = 140/348 (40%), Gaps = 53/348 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARN--RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV 59
           R F       +   +   +G FA    ++ +AGSST+FP ++ IA  FSE  P       
Sbjct: 16  RDFLAAAGVALSGGLAGCSGVFAAEGKQVNVAGSSTVFPVTEAIASAFSEKNPTVNISLS 75

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ++G        FC G      DI N+SR+I   E+++C  + V+ I+         ++V+
Sbjct: 76  KTGTGGGFGNFFCAG----RTDINNASREIADAEIEQCGNNDVTPIEFQIATDALTVVVN 131

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
                   LTVE L +   +             ++WS++  ++P+  I +Y  +   GT 
Sbjct: 132 PEADWVDCLTVEQLQEIWRTDG----------AQRWSDLNDEWPDEEIELYGAATTSGTF 181

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           +   + VL E      ++                                     +  + 
Sbjct: 182 DYFNEAVLGEELNHRSDYYAT----------------------------ERDRTIVQGVR 213

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQH 294
            ++   G+ G S+Y  N D +K V ID     + PS+ T +SG Y P+SRPL  YV ++ 
Sbjct: 214 GSETAMGYFGFSYYSENPDSIKAVSIDSGDGCVEPSIETAMSGKYTPLSRPLFIYVAKES 273

Query: 295 FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             +   +R +V F +     A    +   G +PI+ ++R    + +  
Sbjct: 274 L-TKPAVRNFVRFYME---QAATDLVSDVGYVPITEDKRDENLEKLDA 317


>gi|219847437|ref|YP_002461870.1| phosphate binding protein [Chloroflexus aggregans DSM 9485]
 gi|219541696|gb|ACL23434.1| phosphate binding protein [Chloroflexus aggregans DSM 9485]
          Length = 361

 Score =  169 bits (428), Expect = 4e-40,   Method: Composition-based stats.
 Identities = 68/330 (20%), Positives = 132/330 (40%), Gaps = 50/330 (15%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
           +     I+I GSST+FP ++ +A  F+E  P+         G+  G   FC G      D
Sbjct: 55  SSLSGEIKIDGSSTVFPITERVALAFNELSPQVTIRL-GVSGTGGGFSRFCAG----ETD 109

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR I Q+E++ C  +G++ ++         ++V  ++     LTV +L +  +   
Sbjct: 110 ISNASRPIKQSEMETCTANGITFVELPVAFDGLSVVVHPQNDWVQCLTVAELKRMWSPEA 169

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
                     + +W++IR D+P+  + +Y      GT +     ++ +  +  R+++   
Sbjct: 170 ETV-------ITRWNQIRADWPDAPLHLYGAGTDSGTYDYFTSAIVGQEGISRRDYTA-- 220

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                                       D       +  ++   GF G ++Y   AD L+
Sbjct: 221 --------------------------SEDDYLLAQDVAGDQFGLGFFGYAYYAEYADRLR 254

Query: 262 LVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            V ID     + PS+ TI +G Y P++RP+  YV+         +R +V   +       
Sbjct: 255 AVAIDNGNGCVAPSIETISNGQYQPLARPIFIYVRADRLARA-EVRTFVDLYL----QNG 309

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                Q   +P+ +   +     +   ++G
Sbjct: 310 SLFASQALYVPLPSTAYELALRRVERRRTG 339


>gi|257386428|ref|YP_003176201.1| phosphate binding protein [Halomicrobium mukohataei DSM 12286]
 gi|257168735|gb|ACV46494.1| phosphate binding protein [Halomicrobium mukohataei DSM 12286]
          Length = 376

 Score =  169 bits (428), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 68/330 (20%), Positives = 135/330 (40%), Gaps = 44/330 (13%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
                 +RI+GSST++P ++ ++  ++E + +     +   GS  G +           D
Sbjct: 80  ASLSGDVRISGSSTVYPVAEEVSRLWNEEYGDGVGFNITPDGSGGGFENV---FIPGDSD 136

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR I   EL  C+ +G+  ++         ++V++       +++EDL    +   
Sbjct: 137 INNASRPIKDEELQRCRDNGIEPVEFYVAQDALTVVVNNDADFIDEISLEDLKTIWSPDT 196

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
                      + WS++  D+P+  + +Y P+   GT +   + V+ E            
Sbjct: 197 ---------APEMWSDVNSDWPDEPLDLYGPASTSGTYDYFIEAVIGE------------ 235

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                     + +   +R D    E   +       +  N+  FG++  ++Y NN D +K
Sbjct: 236 ----------TESDQPIRSD---FEGTEEDNLIAQGVSGNEYAFGYLPFAYYTNNPDSVK 282

Query: 262 LVP-----IDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            +       D + PS+    SG YP++RPL FY           L+E++ F V++     
Sbjct: 283 ALGLVEGGNDPVEPSLEGAQSGNYPLARPLFFYANMNKLQEKTHLQEFIRFYVNEA--DE 340

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           D      G +P S++  +    ++  G +G
Sbjct: 341 DYIASDVGYVPSSDQMVEDNLANLEAGIAG 370


>gi|300868504|ref|ZP_07113123.1| Protein sphX [Oscillatoria sp. PCC 6506]
 gi|300333493|emb|CBN58311.1| Protein sphX [Oscillatoria sp. PCC 6506]
          Length = 341

 Score =  169 bits (427), Expect = 6e-40,   Method: Composition-based stats.
 Identities = 66/330 (20%), Positives = 130/330 (39%), Gaps = 50/330 (15%)

Query: 22  TFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTID 81
              +  I+I GSST++P ++ +AE F +     +     SG      K+FCRG      D
Sbjct: 35  AQGQRTIKIDGSSTVYPVTEAVAEEFQKANRGVQVTVGVSGTGGG-FKKFCRG----ETD 89

Query: 82  IVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYL 141
           I N+SR I + E+ EC   G+  ++         ++++ ++    SLTV +L K      
Sbjct: 90  ISNASRPILKAEMQECASKGIKYMELPVAYDALTVVINPQNTWVKSLTVAELKKMWEPG- 148

Query: 142 IVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMR 201
                     +  WS+IR  FP   + ++ P    GT +   + ++ +      +++   
Sbjct: 149 ------AQGKINNWSQIRSGFPNAPLKLFGPGTASGTFDYFTEAIVGKSKSSRGDYTA-- 200

Query: 202 DMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
                                       D    +  +  +K+  G+ G ++Y+ N   LK
Sbjct: 201 --------------------------SEDDNVLVQGVTRDKNAIGYFGFAYYEENKGKLK 234

Query: 262 LVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAP 316
            VPI+     ++PS   + +G Y P+SRPL  YV  +  +    +++++ F + +     
Sbjct: 235 AVPINSGKGAVLPSYQAVQNGTYTPLSRPLFIYVNAKSADK-PEVKQFIEFYLKNGAK-- 291

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                +   + +      +        + G
Sbjct: 292 --LAREVKYVALPAVAYTTAMGHFNKRRVG 319


>gi|229093341|ref|ZP_04224450.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-42]
 gi|228690065|gb|EEL43864.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-42]
          Length = 278

 Score =  169 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 66/320 (20%), Positives = 133/320 (41%), Gaps = 48/320 (15%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G     +DI N+
Sbjct: 5   GEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG----EVDINNA 59

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR + Q E +E K++ +             ++V+ ++    ++TV++L    +       
Sbjct: 60  SRVMKQVEENEMKRNSIQFTPFEVAYDGLTIVVNRQNTWVDNMTVDELRLLWSEDESE-- 117

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +  +          
Sbjct: 118 -------KRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRIVKK---------- 160

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                              + +  D    +  +  +K+   FVG ++Y  N D ++ + +
Sbjct: 161 -------------------VSLSEDDQVIMQGVMNDKNAIAFVGYAYYMANRDKVRAIKV 201

Query: 266 DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           +G++P+  TI SG Y P+SR L  YV      + + +  Y+ F +        +   + G
Sbjct: 202 NGVLPTKDTIQSGEYKPLSRSLFAYVNHASIRNKMNVANYIEFMI----QHVGNLAEEVG 257

Query: 325 LIPISNEERKSVRDSIAVGK 344
            + +S E+       +   K
Sbjct: 258 YVKLSKEKYNEQLRMLTEIK 277


>gi|326326062|ref|YP_004250871.1| putative protein sphX [Vibrio nigripulchritudo]
 gi|323669113|emb|CBJ93162.1| Putative protein sphX precursor [Vibrio nigripulchritudo]
          Length = 331

 Score =  169 bits (426), Expect = 7e-40,   Method: Composition-based stats.
 Identities = 81/340 (23%), Positives = 141/340 (41%), Gaps = 48/340 (14%)

Query: 13  VLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFC 72
            L      G +A++ I+I GSST++P +  IAE +           V   G+  G ++FC
Sbjct: 15  FLLAGVTCGAYAKDLIKIEGSSTVYPITHQIAERYMLSEGTGTQVVVGISGTGGGFRKFC 74

Query: 73  RGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVED 132
           RG      D+ N+SR +  NE   C+++ +  I E+ +  D I +V +R+   +S    D
Sbjct: 75  RG----RTDVSNASRPMKANEKALCQENSIEYI-ELPVALDAITIVVNRNNDWLSALSLD 129

Query: 133 LYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCV 192
             K L       +    N +  W  +RP +P + I ++ P    GT +     V   G  
Sbjct: 130 DLKLL------WEVGAQNSITTWRHLRPHYPAIPINLHGPGMDSGTYDYFVD-VTLGGQK 182

Query: 193 RSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSF 252
             +++                              + D    +A +  +K+   F+G ++
Sbjct: 183 SRQDY----------------------------RANEDDEAMVAEVAEDKNAMAFLGFAY 214

Query: 253 YKNNADVLKLVPID--GIVPSMGTIVS---GLYP-ISRPLLFYVKRQHFNSVLGLREYVS 306
           Y  N D LK V I   G VP++ ++ S   G Y  +SRPL  YV +        +R ++ 
Sbjct: 215 YLKNQDKLKAVAISERGGVPTLPSVGSVTQGQYGSLSRPLFIYVNKTALEKRGSVRRFLE 274

Query: 307 FSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                  +  +  + + G IP+S+    +VR  +    SG
Sbjct: 275 LYFHPSNI--NGIVTRAGYIPLSSRMYSAVRQRLKNKVSG 312


>gi|120599602|ref|YP_964176.1| phosphate binding protein [Shewanella sp. W3-18-1]
 gi|146292401|ref|YP_001182825.1| phosphate binding protein [Shewanella putrefaciens CN-32]
 gi|120559695|gb|ABM25622.1| phosphate binding protein [Shewanella sp. W3-18-1]
 gi|145564091|gb|ABP75026.1| phosphate binding protein [Shewanella putrefaciens CN-32]
 gi|319425701|gb|ADV53775.1| phosphate binding protein [Shewanella putrefaciens 200]
          Length = 323

 Score =  169 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 51/360 (14%), Positives = 112/360 (31%), Gaps = 61/360 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +           A                  +   GS TL     + AE
Sbjct: 1   MKLKKLVGAMTLTAAGVFSATAMASIDQSLPTYEKTSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F   +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  EFKHMYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEIEAFEKHYGYKP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFP 163
            E+ +  D + +   +D     LT E +    +S            +++W    +  ++ 
Sbjct: 116 TEIRVAIDALAVFVHKDNPIKGLTAEQVDGIFSSTHKCGGS----DIQRWGDLGLDGNWS 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              + +Y  +   GT    ++  L +G  +                              
Sbjct: 172 AKDVQLYGRNSVSGTYGYFKEHALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +     + I  +     +G YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAVGYSGIGYVTAGVKAVPIAKKGNEFIEATPENAANGTYP 262

Query: 282 ISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +Q   +     +E++ + +S +       + + G + +         + +
Sbjct: 263 LSRYLYVYVNKQPNKDLAPMEKEFIRYVLSKQGQQ---VVEKDGYVTLPKSVVAKDLEQL 319


>gi|87124426|ref|ZP_01080275.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. RS9917]
 gi|86167998|gb|EAQ69256.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. RS9917]
          Length = 355

 Score =  169 bits (426), Expect = 8e-40,   Method: Composition-based stats.
 Identities = 68/345 (19%), Positives = 136/345 (39%), Gaps = 50/345 (14%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF-VES 61
           F         +L V       A+  IRI+GSST++P +    + F +        F ++ 
Sbjct: 18  FAVTATALTSLLAVAAQQPLLAQATIRISGSSTVYPITARAIQRFEKTSEGKNVKFDLKE 77

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
            GSS G ++FC G     + + N+SR I+  E+  CK  G+  I+         ++V+ +
Sbjct: 78  TGSSAGFRDFCSG----KVPMANASRPISSKEIKACKAKGIQFIELPIAFDAITVVVNPK 133

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           +  + ++T ++L +                + +W+++  DFP+  I +  P    GT ++
Sbjct: 134 NTWATTVTPKELSRLWRKQ-------AQGTVTRWNQVNHDFPDQPIRLCGPGNDSGTYDI 186

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
             K + +       +++                               D    +  +  +
Sbjct: 187 FNKAINKSTTNTRTDYTA----------------------------SEDDNVLVKCVATD 218

Query: 242 KDVFGFVGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
            +  G+ G  +YK N+  LK + +     + I PS+  +   LY P+SRPL  Y+  +  
Sbjct: 219 PNALGYFGFGYYKKNSQRLKALKVVNPKGNSIAPSVANVQKELYQPLSRPLFLYINDKTL 278

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           N     R +V+  +        S + +   IP+ +   + V   +
Sbjct: 279 NQNKAFRSFVTSYLRHAQ----SLVEKADYIPLPSRTYRLVESKL 319


>gi|217968822|ref|YP_002354056.1| phosphate binding protein [Thauera sp. MZ1T]
 gi|217506149|gb|ACK53160.1| phosphate binding protein [Thauera sp. MZ1T]
          Length = 326

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 66/333 (19%), Positives = 139/333 (41%), Gaps = 51/333 (15%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T   A + +++ GSST++P ++ +AE+F +         V   G+  G K+FCRG     
Sbjct: 16  TSVQAESLVKVDGSSTVYPVTEAVAEDFQKSVKGEIKVTVGISGTGGGFKKFCRG----E 71

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
           ID+ N+SR I + E+++C K G++   E+ +  D + +V + +     L+V  L K    
Sbjct: 72  IDVANASRPILKKEMEDCAKEGITYY-ELPVAFDALTVVVNPNSKITQLSVAQLKKMWEP 130

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
                       +  W+++ P FP+  + ++      GT +   + +  +      +++ 
Sbjct: 131 D-------AQGKVSNWNQVDPSFPDAPLNLFGAGSDSGTFDYFTEAINGKSKASRGDYTA 183

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
                                         D    +  +  + +  G+ G ++Y  N   
Sbjct: 184 ----------------------------SEDDNVLVQGVSRDVNAIGYFGYAYYAENQGK 215

Query: 260 LKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
           LK V I     D ++PS  +++ G Y P++RP+  YV  +       +R++V F + +  
Sbjct: 216 LKAVAIVNAKGDAVLPSEKSVIDGSYNPLARPIFIYVSAKALERA-EVRQFVDFYMKNA- 273

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
               +   +   +P+  +  ++  + +   K G
Sbjct: 274 ---PALTSEVKYVPLPAKAYEANMEHMKSKKLG 303


>gi|228993016|ref|ZP_04152939.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           pseudomycoides DSM 12442]
 gi|228766664|gb|EEM15304.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           pseudomycoides DSM 12442]
          Length = 284

 Score =  168 bits (425), Expect = 9e-40,   Method: Composition-based stats.
 Identities = 71/330 (21%), Positives = 134/330 (40%), Gaps = 50/330 (15%)

Query: 18  CGTGTFARN--RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
             T + A +   +R+ GSST+FP  + IAE +++  P  K   +   G+  G   F +G 
Sbjct: 1   MSTPSAANDVREVRVDGSSTVFPIMEAIAEEYTKKEPRVKIS-ISISGTGGGFHRFGKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR++ Q E +  K++ +             ++V+ ++  + ++T+E+L  
Sbjct: 59  ---EVDINNASRQVKQVEENFMKENSIQFTPFEIAYDGLTIIVNRQNTWADNMTIEELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +              K+WS I P +P  ++  Y P    GT +  +  VL+   +   
Sbjct: 116 LWSED---------GRTKRWSHIHPKWPHEKVQFYAPGVDSGTYDYFQSVVLRNNRLAKT 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K+   FVG ++Y  
Sbjct: 167 -----------------------------VALSEDDQVIMQGVMNDKNAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K V ++G+ P+   I SG+Y P+SRPL  YV      +   + EYV F +     
Sbjct: 198 NRDKVKAVKVNGVPPTKANIQSGVYKPLSRPLFAYVNHASIRNKSSVAEYVVFMM----Q 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
                  + G + +  ++       +   K
Sbjct: 254 HAGGLAEEVGYVKLPQKKYSEQLRMLTEIK 283


>gi|75909920|ref|YP_324216.1| phosphate binding protein [Anabaena variabilis ATCC 29413]
 gi|75703645|gb|ABA23321.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Anabaena variabilis ATCC 29413]
          Length = 352

 Score =  168 bits (425), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/372 (19%), Positives = 139/372 (37%), Gaps = 69/372 (18%)

Query: 1   MR----FFFVVLMCFVVLEVYCGTGTFARNR-----------------IRIAGSSTLFPY 39
           M+       + L  F V+     T   +                    + + GSST++P 
Sbjct: 1   MKTTAEKLALTLGIFAVVSGCTATSNNSAQTQDSAKVTEVANSTKVASVTVDGSSTVYPI 60

Query: 40  SKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
           ++ IA+ F           V   G+  G  +FC G      DI N+SR ITQ E+ +C +
Sbjct: 61  TQAIAKEFQANSKNNLQVQVNISGTGGGFTKFCAG----QTDINNASRPITQAEMADCNR 116

Query: 100 HGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR 159
           +G+  I+         + V+ ++  +  +TV +L K                + +W+++R
Sbjct: 117 NGIRYIELPVAFDALTIAVNPQNDWAKDITVAELKKIWEPG-------AEGKITRWNQVR 169

Query: 160 PDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVR 219
             +P+  + +Y    + GT +   + +  +      +++                     
Sbjct: 170 ASWPDRPLNLYGAGKQSGTFDYFTEAITGKAKASRNDYTA-------------------- 209

Query: 220 QDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTI 275
                     D    +A I  + +  G+ G ++Y+ N   LK++ +D     I PS  T+
Sbjct: 210 --------SEDDEVLVAGISKDPNALGYFGYAYYEENQKSLKVLAVDNGKGAITPSRETV 261

Query: 276 VSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERK 334
               Y P+SRPL  YV      +   + ++  + +              G +P+S+E  +
Sbjct: 262 EKSKYQPLSRPLFIYVNPWSSQNKSAVYQFADYYI----KQAPKTAKAVGYVPLSSEAYQ 317

Query: 335 SVRDSIAVGKSG 346
                +  GK+G
Sbjct: 318 INYVHLNQGKAG 329


>gi|229081530|ref|ZP_04214029.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock4-2]
 gi|228701837|gb|EEL54324.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock4-2]
          Length = 284

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 69/330 (20%), Positives = 132/330 (40%), Gaps = 48/330 (14%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +        +  +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G 
Sbjct: 1   MSTAFALNDKGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGTGGGFNRFSKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR + Q E +E KK+ +             ++V+  +     ++V++L  
Sbjct: 59  ---EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIVVNRHNTWVDDMSVDELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +              K+WS+I   +P  ++  Y P    GT +  +  +LQ   +  +
Sbjct: 116 LWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQNVILQNHRIVKK 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K    FVG ++Y  
Sbjct: 167 -----------------------------VSLSEDDQVIMQGVMNDKHAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + +  YV F +     
Sbjct: 198 NRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIRNKMNVANYVEFMI----Q 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              +   + G + +  E+       +   K
Sbjct: 254 HVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 283


>gi|309390012|gb|ADO77892.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Halanaerobium praevalens DSM 2228]
          Length = 300

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 69/346 (19%), Positives = 131/346 (37%), Gaps = 53/346 (15%)

Query: 1   MRFF---FVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR     F V+    +L +           I+I GSST++P ++ +AE FS   P  +  
Sbjct: 1   MRKITTLFFVITILAILVLPVSAAEQLEGTIKIDGSSTVYPVTQAMAEEFSYVNPRVRVT 60

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
              SG                  D+ N+SR+I  +E     ++G+   Q +       + 
Sbjct: 61  VGVSG-----SGGGFAKFNVGETDLSNASREIKDSEAKIAAENGIEFTQFIVGYDGITVA 115

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V   +  +  +TV +L +       V+         KWS++R ++P+  I +Y P    G
Sbjct: 116 VHPENDWANDMTVGELKQIWEPNSSVE---------KWSDLRAEWPDEEIDLYGPGADSG 166

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +   + +  +      +F+                               D    +  
Sbjct: 167 TFDYFTEAINGKSGASRSDFTA----------------------------SEDDNVLVRG 198

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFN 296
           +  NK   G+ G ++Y+ N++ LK V ++G++P+  TI +  Y P++RPL  Y K     
Sbjct: 199 VSGNKYALGYFGYAYYEENSEKLKAVAVNGVLPNPETIAAKEYKPLARPLFVYAKNSAVE 258

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
               +  +++F   +        + Q G  P+ +     V   +  
Sbjct: 259 -RPEVEAFLNFYFKNAA----EIVPQTGYAPLPS--YDEVLAKVEK 297


>gi|229006614|ref|ZP_04164249.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides Rock1-4]
 gi|228754663|gb|EEM04073.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides Rock1-4]
          Length = 284

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 71/330 (21%), Positives = 134/330 (40%), Gaps = 50/330 (15%)

Query: 18  CGTGTFARN--RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
             T + A +   +R+ GSST+FP  + IAE +++  P  K   +   G+  G   F +G 
Sbjct: 1   MSTPSAANDVREVRVDGSSTVFPIMEAIAEEYTKKEPRVKIS-ISISGTGGGFHRFGKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR++ Q E +  K++ +             ++V+ ++  + ++T+E+L  
Sbjct: 59  ---EVDINNASRQVKQVEENFMKENSIQFTPFEIAYDGLTIIVNRQNTWADNMTIEELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +              K+WS I P +P  ++  Y P    GT +  +  VL+   +   
Sbjct: 116 LWSED---------GRTKRWSHIHPKWPHEKVQFYAPGVDSGTYDYFQSVVLRNNRLAKT 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K+   FVG ++Y  
Sbjct: 167 -----------------------------VALSEDDQVIMQGVMNDKNAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K V ++G+ P+   I SG+Y P+SRPL  YV      +   + EYV F +     
Sbjct: 198 NRDKVKSVKVNGVPPTKANIQSGVYKPLSRPLFAYVNHASIRNKSSVAEYVVFMM----Q 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
                  + G + +  ++       +   K
Sbjct: 254 HAGGLAEEVGYVKLPQKKYNEQLRMLTEIK 283


>gi|229019493|ref|ZP_04176313.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1273]
 gi|229025736|ref|ZP_04182139.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1272]
 gi|228735566|gb|EEL86158.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1272]
 gi|228741804|gb|EEL91984.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus AH1273]
          Length = 284

 Score =  168 bits (424), Expect = 1e-39,   Method: Composition-based stats.
 Identities = 68/330 (20%), Positives = 130/330 (39%), Gaps = 48/330 (14%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +     T     +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G 
Sbjct: 1   MSTAFATNEMGEVRVDGSSTVFPIIEAVAEEYTKAHPNVKIS-ISISGTGGGFNRFSKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR + + E +  KK+ +             ++V+ ++    ++T+++L  
Sbjct: 59  ---EVDINNASRVMKRVEENAMKKNSIQFTPFEVAYDGLTIVVNRQNTWVNNITIDELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
                            K+WS+I   +P  +I  Y P    GT +  +  VLQ   +   
Sbjct: 116 LWGED---------GSSKRWSQIHSSWPREQIKFYAPGVDSGTYDYFQNIVLQNSRLVKT 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K+   FVG ++Y  
Sbjct: 167 -----------------------------VSLSEDDQVIMQGVMNDKNAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K + ++G+ P+  TI SG Y P++RPL  YV      + + +  YV F +     
Sbjct: 198 NRDKVKAIKVNGVFPTKETIQSGAYKPLARPLFTYVNDASIRNKMNVANYVEFMI----K 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              +   + G + +  E+       +   K
Sbjct: 254 HVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 283


>gi|228999066|ref|ZP_04158648.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides Rock3-17]
 gi|228760683|gb|EEM09647.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           mycoides Rock3-17]
          Length = 284

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 71/330 (21%), Positives = 134/330 (40%), Gaps = 50/330 (15%)

Query: 18  CGTGTFARN--RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
             T + A +   +R+ GSST+FP  + IAE +++  P  K   +   G+  G   F +G 
Sbjct: 1   MSTPSAANDVREVRVDGSSTVFPIMEAIAEEYTKKEPRVKIS-ISISGTGGGFHRFGKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR++ Q E +  K++ +             ++V+ ++  + ++T+E+L  
Sbjct: 59  ---EVDINNASRQVKQVEENFMKENSIQFTPFEIAYDGLTIIVNRQNTWADNMTIEELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +              K+WS I P +P  ++  Y P    GT +  +  VL+   +   
Sbjct: 116 LWSED---------GRTKRWSHIHPKWPHEKVQFYAPGVDSGTYDYFQSVVLRNNRLAKT 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K+   FVG ++Y  
Sbjct: 167 -----------------------------VALSEDDQVIMQGVMNDKNAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K V ++G+ P+   I SG+Y P+SRPL  YV      +   + EYV F +     
Sbjct: 198 NRDKVKSVKVNGVPPTKANIQSGVYKPLSRPLFAYVNHASIRNKSSVAEYVVFMM----Q 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
                  + G + +  ++       +   K
Sbjct: 254 HAGGLAEEVGYVKLPQKKYSEQLRMLTEIK 283


>gi|229163217|ref|ZP_04291172.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus R309803]
 gi|228620280|gb|EEK77151.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus R309803]
          Length = 284

 Score =  167 bits (423), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 69/330 (20%), Positives = 132/330 (40%), Gaps = 48/330 (14%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +           +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G 
Sbjct: 1   MTTAFAVSEMGEVRVDGSSTVFPIIEAVAEEYTKVHPNVKIS-ISVSGTGGGFNRFSKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR + Q E +E KK+ V             ++V+ ++     ++V++L  
Sbjct: 59  ---EVDINNASRVMKQVEENEMKKNSVQFTPFEVAYDGLTIVVNRQNHWVDDMSVDELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +              K+WS+I   +P  ++  Y P    GT +  +  +LQ+  +  +
Sbjct: 116 LWSED---------GREKRWSQIHSSWPREQVKFYAPGVDSGTYDYFQNVILQKSRIVKK 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K+   FVG ++Y  
Sbjct: 167 -----------------------------VSLSEDDQVIMQGVMNDKNAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K + ++G+ P+ GTI SG Y P+SR L  YV      + + +  YV F +     
Sbjct: 198 NRDKVKAIRVNGVFPTKGTIQSGKYKPLSRSLFTYVNDASIRNEMNVASYVEFMI----Q 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              +   + G + +  E+       +   K
Sbjct: 254 HVGNLAEEVGYVKLPKEKYNEQLRMLTEIK 283


>gi|205373989|ref|ZP_03226789.1| phosphate-binding protein [Bacillus coahuilensis m4-4]
          Length = 323

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 75/322 (23%), Positives = 123/322 (38%), Gaps = 53/322 (16%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           I I GSST++P  + +AE F    P      V   G+  G ++F  G       I ++SR
Sbjct: 50  ITIDGSSTVYPIMEAVAEEFMMANPNVNV-TVGLSGTGGGFEKFTAG----ETQISDASR 104

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            I   E+      G+   +         ++V+  +     LTVE+L              
Sbjct: 105 PIKDEEVQALADAGIEWTEFKVANDGLSVVVNTENDWVDYLTVEELAMMWKED------- 157

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYN 207
                KKWS+IR  +PE  I  Y P    GT +   +++L+E  +               
Sbjct: 158 --GTAKKWSDIREGWPEEEIKFYSPGTDSGTFDYFNEEILEEEPMVEAA----------- 204

Query: 208 VQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG 267
                              +  D    +  +  +K+  GF G ++Y  N D LK+VPID 
Sbjct: 205 ------------------TLSEDDNVLVQGVTGDKNAIGFFGYAYYIENQDSLKVVPIDN 246

Query: 268 ----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQ 322
               + P+  T+  G Y P+SRPL FYV          + EYV F + +      +   +
Sbjct: 247 GEGPVEPTAETVEDGSYAPLSRPLFFYVDNAAV-KDAHVYEYVKFVIENSA----TLSEE 301

Query: 323 YGLIPISNEERKSVRDSIAVGK 344
            G + + +   +    ++   K
Sbjct: 302 VGYVKLEDAAYEEALSTLEGLK 323


>gi|37519577|ref|NP_922954.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
 gi|35210568|dbj|BAC87949.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
          Length = 340

 Score =  167 bits (422), Expect = 2e-39,   Method: Composition-based stats.
 Identities = 71/325 (21%), Positives = 130/325 (40%), Gaps = 49/325 (15%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            I++ GSST+FP ++ +AE F +         V   G+  G K+FCRG      DI ++S
Sbjct: 37  TIKVDGSSTVFPITEAVAEEFQKSKKGAVRVTVGVSGTGGGFKKFCRG----ETDISDAS 92

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R I + E+D CK+  +  ++         ++V+  +  + ++TV +L K           
Sbjct: 93  RPILKKEMDACKEAAIQYVELPVAYDALTVMVNPSNTWASTMTVAELKKIWEPE------ 146

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W+++R  FP   + +Y P    GT +   + V+ +      +F+        
Sbjct: 147 -AQGKVTNWNQVRSSFPNAPLKLYGPGADSGTFDYFTEAVVGKSKASRGDFTA------- 198

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                                  D    +  I  +K+  G+ G ++Y  N   LK V +D
Sbjct: 199 ---------------------SEDDNVLVQGIANDKNALGYFGYAYYAENKSKLKAVGVD 237

Query: 267 GIV----PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
           G      PS  T+  G Y P+SRP+  YV  +       ++E+V F +     +  + + 
Sbjct: 238 GGKGPVLPSDKTVEDGTYNPLSRPIFIYVSNKAMA-RPEVKEFVEFYL----KSAPTLVK 292

Query: 322 QYGLIPISNEERKSVRDSIAVGKSG 346
           Q   +P+  +            + G
Sbjct: 293 QVKYVPLPKKAYDVALSHFQKNRMG 317


>gi|228923023|ref|ZP_04086316.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
 gi|228836656|gb|EEM82004.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar huazhongensis BGSC 4BD1]
          Length = 284

 Score =  167 bits (421), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 69/330 (20%), Positives = 131/330 (39%), Gaps = 48/330 (14%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +           +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G 
Sbjct: 1   MSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGTGGGFNRFSKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR + Q E +E KK+ +             ++V+  +     ++V++L  
Sbjct: 59  ---EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIVVNRHNTWVDDMSVDELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +              K+WS+I   +P  ++  Y P    GT +  +  +LQ   +  +
Sbjct: 116 LWSED---------GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQNVILQNHRIVKK 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K    FVG ++Y  
Sbjct: 167 -----------------------------VSLSEDDQVIMQGVMNDKHAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + +  YV F +     
Sbjct: 198 NRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIRNKMNVANYVEFMI----Q 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              +   + G + +  E+       +   K
Sbjct: 254 HVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 283


>gi|228954555|ref|ZP_04116580.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
 gi|228805212|gb|EEM51806.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar kurstaki str. T03a001]
          Length = 284

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 69/330 (20%), Positives = 131/330 (39%), Gaps = 48/330 (14%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +           +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G 
Sbjct: 1   MSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGTGGGFNRFSKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR + Q E +E KK+ +             ++V+  +     ++V++L  
Sbjct: 59  ---EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLTIVVNRHNTWVDDMSVDELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +              K+WS+I   +P  ++  Y P    GT +  +  +LQ   +  +
Sbjct: 116 LWSEN---------GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQNVILQNHRIVKK 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K    FVG ++Y  
Sbjct: 167 -----------------------------VSLSEDDQVIMQGVMNDKHAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + +  YV F +     
Sbjct: 198 NRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLAYVNNASIRNKMNVANYVEFMI----Q 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              +   + G + +  E+       +   K
Sbjct: 254 HVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 283


>gi|37519582|ref|NP_922959.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
 gi|35210573|dbj|BAC87954.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Gloeobacter violaceus PCC 7421]
          Length = 343

 Score =  166 bits (420), Expect = 3e-39,   Method: Composition-based stats.
 Identities = 74/358 (20%), Positives = 139/358 (38%), Gaps = 54/358 (15%)

Query: 1   MRFFFVVLMCFVVLEVY----CGTGTFAR-NRIRIAGSSTLFPYSKIIAENFSEYFPEFK 55
           M+   VV +   VL           T AR +++ I GSST+ P ++   E F    P+  
Sbjct: 5   MKKSVVVGISVAVLAAASMVLAAQNTTARPSQVSIDGSSTVHPITRTAVEEFLSRNPQIA 64

Query: 56  --TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHD 113
                V   G+  GLK+ C G     IDI  +SR I++ E+  C+ + ++ ++       
Sbjct: 65  KGAFAVGFSGTGGGLKKLCTG----EIDIAGASRPISRQEIQSCRNNNIAFMELPVAFDA 120

Query: 114 GILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPS 173
             ++V  ++  +  +TV +L K         ++     + +WS++RP +P+  + +Y P 
Sbjct: 121 LTVVVHPKNTWASEITVAELKKIW-------ERASQGKITRWSQVRPGWPDRPLKLYGPG 173

Query: 174 GKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTE 233
              GT +   + +L      +R+                                 D   
Sbjct: 174 RDSGTYDYFAEAILGSANTDTRSDY---------------------------VDSEDDDV 206

Query: 234 TLARIEVNKDVFGFVGLSFYKNNADVLKLVPI----DGIVPSMGTIVSGLY-PISRPLLF 288
            +  +  + D   + G ++Y+ +   LK + +      + PS   +   LY P++RPL  
Sbjct: 207 LVRGVSEDPDALSYFGYAYYEASRGRLKALAVANGLGAVAPSRQAVEKNLYQPLARPLFL 266

Query: 289 YVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           YV      +   +RE+V F +          +   G +P+  E      +    GK G
Sbjct: 267 YVNMVSSQTKPPVREFVGFYL----QHAGRIVNAVGYVPLPPEGYHIANNHFWRGKRG 320


>gi|296121744|ref|YP_003629522.1| phosphate binding protein [Planctomyces limnophilus DSM 3776]
 gi|296014084|gb|ADG67323.1| phosphate binding protein [Planctomyces limnophilus DSM 3776]
          Length = 338

 Score =  166 bits (420), Expect = 4e-39,   Method: Composition-based stats.
 Identities = 72/324 (22%), Positives = 135/324 (41%), Gaps = 53/324 (16%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              I + GSST+FP S+ +AE F   FPE K   V   G+  G K+F      + ID+  
Sbjct: 57  SGTIAVDGSSTVFPISQAVAEEFEGKFPEVKL-TVAMSGTGGGFKKFIA----EEIDVTG 111

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
           +SR IT+ E  ECK  G+  ++         ++++  +  +  +TV +L K  A+     
Sbjct: 112 ASRPITEKEAAECKAKGIDYVEFQVAIDGLTVVINPANTFAECMTVAELNKIWAADS--- 168

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                  + KWSE+R  +P+  I ++      GT +   + +  +      +++      
Sbjct: 169 ------KVSKWSEVREGWPDEPIQLFGADTASGTFDYFTEVINGKAKSSRSDYTA----- 217

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                                  + +    +  +  +K   G+ G +++  NA  LK V 
Sbjct: 218 -----------------------NSNDNILVQGVVDSKGALGYFGYAYFAENASKLKAVK 254

Query: 265 ID------GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           I        + P+  TI SG Y P+SRPL  Y  +        + E++ F +S++    D
Sbjct: 255 ISDGKKAVCVEPTPATIESGEYTPLSRPLFIYTTKAKL-KRPEVAEFIKFLLSEKG---D 310

Query: 318 SQLFQYGLIPISNEERKSVRDSIA 341
             + +   I +    +++++  +A
Sbjct: 311 QLVEEVKYIKVPKSVKETMQQRLA 334


>gi|17228589|ref|NP_485137.1| periplasmic phosphate-binding protein of ABC transporter [Nostoc
           sp. PCC 7120]
 gi|17130440|dbj|BAB73051.1| periplasmic phosphate-binding protein of ABC transporter [Nostoc
           sp. PCC 7120]
          Length = 352

 Score =  166 bits (419), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 69/372 (18%), Positives = 138/372 (37%), Gaps = 69/372 (18%)

Query: 1   MR----FFFVVLMCFVVLEVYCGTGTFARNR-----------------IRIAGSSTLFPY 39
           M+       + L  F V+     T   +                    + + GSST++P 
Sbjct: 1   MKTTAEKLALTLGIFAVVSGCTATSNNSTQSPESAKVTEVANSTKVASVTVDGSSTVYPI 60

Query: 40  SKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
           ++ IA+ F           V   G+  G  +FC G      DI N+SR ITQ E+ +C +
Sbjct: 61  TQAIAQEFQANSKNNLQVQVNISGTGGGFAKFCAG----KTDINNASRPITQAEMADCNR 116

Query: 100 HGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR 159
           +G+  I+         + V+ ++  +  +T+ +L K                + +W+++R
Sbjct: 117 NGIRYIELPVAFDALTIAVNPQNDWAKDITIAELKKIWEPG-------AEGKITRWNQVR 169

Query: 160 PDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVR 219
             +P+  + +Y    + GT +   + +  +      +++                     
Sbjct: 170 ASWPDRPLNLYGAGKQSGTFDYFTEAITGKAKASRNDYTA-------------------- 209

Query: 220 QDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV----PSMGTI 275
                     D    +A I  + +  G+ G ++Y+ N   LK++ +D       PS  T+
Sbjct: 210 --------SEDDEVLVAGISKDPNALGYFGYAYYEENQKSLKVLAVDNGKGAIIPSRETV 261

Query: 276 VSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERK 334
               Y P+SRPL  YV      +   + ++  + +              G +P+S+E  +
Sbjct: 262 EKSKYQPLSRPLFIYVNPWSSQNKSAVYQFADYYI----KQAPKTAKAVGYVPLSSEAYQ 317

Query: 335 SVRDSIAVGKSG 346
                +  GK+G
Sbjct: 318 INYVHLNQGKAG 329


>gi|228941436|ref|ZP_04103987.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|228974367|ref|ZP_04134936.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228980960|ref|ZP_04141263.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis Bt407]
 gi|228778751|gb|EEM27015.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis Bt407]
 gi|228785417|gb|EEM33427.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar thuringiensis str. T01001]
 gi|228818217|gb|EEM64291.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar berliner ATCC 10792]
 gi|326942054|gb|AEA17950.1| phosphate-binding protein [Bacillus thuringiensis serovar chinensis
           CT-43]
          Length = 284

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 68/318 (21%), Positives = 129/318 (40%), Gaps = 48/318 (15%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G     +DI N+
Sbjct: 11  GEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISVSGTGGGFNRFSKG----EVDINNA 65

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR + Q E +E KK+ +             ++V+  +     ++V++L    +       
Sbjct: 66  SRVMKQVEKNEMKKNSIQFTPFEVANDGLTIVVNRHNTWVDDMSVDELRLLWSED----- 120

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
                  K+WS+I   +P  ++  Y P    GT +  +  +LQ   +  +          
Sbjct: 121 ----GREKRWSQIHSTWPREQVKFYAPGVDSGTYDYFQNVILQNHRIVKK---------- 166

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                              + +  D    +  +  +K    FVG ++Y  N D +K + +
Sbjct: 167 -------------------VSLSEDDQVIMQGVMNDKHAIAFVGYAYYMANRDKVKAIKV 207

Query: 266 DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           +G+ P+  TI SG Y P+SRPLL YV      + + +  YV F +        +   + G
Sbjct: 208 NGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVANYVEFMI----QHVGNLAEEVG 263

Query: 325 LIPISNEERKSVRDSIAV 342
            + +  E+       +  
Sbjct: 264 YVKLRKEKYNEQLRMLTE 281


>gi|159900510|ref|YP_001546757.1| phosphate binding protein [Herpetosiphon aurantiacus ATCC 23779]
 gi|159893549|gb|ABX06629.1| phosphate binding protein [Herpetosiphon aurantiacus ATCC 23779]
          Length = 651

 Score =  165 bits (418), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 66/326 (20%), Positives = 123/326 (37%), Gaps = 45/326 (13%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
               +  I  AGSST++P S+ +AE F+E         ++S G+  G + FC        
Sbjct: 73  PAMVKGDIVSAGSSTVYPLSEAVAEIFTEDGYTGNI-TIDSIGTGAGFERFCTAA---ET 128

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           DI N+SR I   E   C   G   ++         ++VS ++    +LT   +       
Sbjct: 129 DIANASRAIKDEEAKACADKGREVVEFRVGTDALAVVVSSKNTFVSNLTEAQV------- 181

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
                 +     K W ++   +P   I +Y P    GT +   +    +           
Sbjct: 182 ----ADIFSGTYKTWDQVDASYPAEAIKLYSPGTDSGTFDYFVEHFYAKEGKFI------ 231

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                                G   ++  D    +  IE + +  G+ G ++Y  N   L
Sbjct: 232 --------------------LGANPQLSEDDNVLVTGIEGDANAIGYFGYAYYNENKAKL 271

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           K + IDG+ P+  T   G YP++RPL  Y  +        +  ++++ +++     +  +
Sbjct: 272 KALTIDGVEPTEATTEDGSYPLARPLYIYSAKNILTEKPQVAAFINYYLTN----VNDVI 327

Query: 321 FQYGLIPISNEERKSVRDSIAVGKSG 346
            + G  P S+E     +D++    +G
Sbjct: 328 LEVGYFPASDEALGEAKDALVNALTG 353



 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 64/320 (20%), Positives = 118/320 (36%), Gaps = 45/320 (14%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
               +  I  AGSST++P S+ +AE F E         ++S G+  G + FC        
Sbjct: 372 PAAVQGDIVSAGSSTVYPLSEAVAEIFGEDGYSGNI-TIDSIGTGAGFERFCTAA---ET 427

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           DI N+SR I   E   C   G   ++         ++VS ++    +LT   +       
Sbjct: 428 DIANASRAIKDEEAKACADKGREVVEFRVGTDALAVVVSSKNTFVTNLTEAQV------- 480

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
                 +     K W ++   +P   I +Y P    GT +   +    +           
Sbjct: 481 ----ADIFSGTYKTWDQVDASYPAEAIKLYSPGTDSGTFDYFVEHFYAKEEKFM------ 530

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                                G   ++  D    +  IE + +  G+ G ++Y  N   L
Sbjct: 531 --------------------LGANPQLSEDDNVLVTGIEGDANAIGYFGYAYYNENKSKL 570

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           K + IDG+ P+  T   G YP++RPL  Y  +        +  ++++ +++     +  +
Sbjct: 571 KALTIDGVEPTEATTEDGSYPLARPLYIYSAKNILAEKAQVAAFINYYLTN----VNEVI 626

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G  P S E     + ++
Sbjct: 627 LEVGYFPASEEALNEAKQNL 646


>gi|163751024|ref|ZP_02158255.1| phosphate-binding protein [Shewanella benthica KT99]
 gi|161329185|gb|EDQ00184.1| phosphate-binding protein [Shewanella benthica KT99]
          Length = 358

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 55/360 (15%), Positives = 114/360 (31%), Gaps = 61/360 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +         + A                  +   GS TL     + AE
Sbjct: 36  MKLKQLVGAVSLTAASLFSAASIAAIDPSLPVYEKTSGVSGTLSSVGSDTLANMMTLWAE 95

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F E +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 96  EFKEMYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEVEAFEKHYGYQP 150

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFP 163
             + +  D + +   +D     L++E +    ++            +K+W    +   + 
Sbjct: 151 TVIRVAIDALAVFVHKDNPIKGLSIEQIDNIFSATHKCGGS----EVKRWGDLGLEGSWF 206

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              + +Y  +   GT    +KK L +G  +                              
Sbjct: 207 ARDVQLYGRNSVSGTYGYFKKKALCKGDFK-----------------------------A 237

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +       I  +     SG+YP
Sbjct: 238 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVRAVAIAKKGTKYIEANAANAASGVYP 297

Query: 282 ISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +  +       RE++ F++S +       + + G +P+           +
Sbjct: 298 LSRYLYIYVNKHPNKELSPMDREFLKFALSKQGQQ---IVEKDGYVPLPRSVTAKDLAKV 354


>gi|300710212|ref|YP_003736026.1| phosphate binding protein [Halalkalicoccus jeotgali B3]
 gi|299123895|gb|ADJ14234.1| phosphate binding protein [Halalkalicoccus jeotgali B3]
          Length = 306

 Score =  165 bits (417), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 65/341 (19%), Positives = 133/341 (39%), Gaps = 52/341 (15%)

Query: 8   LMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVG 67
           +   + L       +     + IAGSST+FP ++ +A +F +  P+      ++G     
Sbjct: 6   VTGAIGLAGCTRAASSEPKEVNIAGSSTVFPIAEAVASDFVQENPDINVSVSQTGSGGGF 65

Query: 68  LKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVS 127
              FC G+     D+ N+SR I ++E  +C  +G+  I+         ++V+        
Sbjct: 66  SNFFCPGM----TDLNNASRSIAEDEQTQCSDNGIEPIEFTVGTDALTVVVNPEADWVDC 121

Query: 128 LTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVL 187
           +T+++L +                 ++WS++R D+P+     Y  +   GT +   + V+
Sbjct: 122 VTIDELRQIWQ----------TGGAERWSDVREDWPDEPFEFYGAATVSGTFDYFRETVI 171

Query: 188 QEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGF 247
            E      ++S                                    +  +  +    G+
Sbjct: 172 GEDANHRNDYSAT----------------------------EKDRTIVRGVRGSPYAIGY 203

Query: 248 VGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGL 301
            G ++Y  N D +K + ID      + PS+ T  SG Y P+SR L  Y  ++       +
Sbjct: 204 FGFAYYSENPDSIKALAIDDGDGTCVEPSLETAKSGRYQPLSRSLFTYAAKEALA-DPAV 262

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
            ++V + +          + + G +PI+ EE+++  D +  
Sbjct: 263 EKFVRYFIEKSAT---DLVSEVGYVPITEEEKQANLDRLDA 300


>gi|24373130|ref|NP_717173.1| phosphate-binding protein [Shewanella oneidensis MR-1]
 gi|24347329|gb|AAN54617.1|AE015602_3 phosphate-binding protein [Shewanella oneidensis MR-1]
          Length = 323

 Score =  165 bits (417), Expect = 9e-39,   Method: Composition-based stats.
 Identities = 53/360 (14%), Positives = 114/360 (31%), Gaps = 61/360 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +           A                  +   GS TL     + AE
Sbjct: 1   MKLKKLVGAMTLTAAGVFSATAMAAIDPSLPTYEKTSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F + +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  EFKQMYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEVEAFEKHYGYKP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFP 163
            E+ +  D + +   +D     LT E +    +S            +++W    +  D+ 
Sbjct: 116 TEIRVAIDALAVFVHKDNPIKGLTAEQVDGIFSSTHKCGGA----DIQRWGDLGLSGDWS 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              + +Y  +   GT    ++K L +G  +                              
Sbjct: 172 AKDVQLYGRNSVSGTYGYFKEKALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +     + I  +     +G YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAVGYSGIGYKTAGVKAVAIAKKGNEFIEATAENAANGTYP 262

Query: 282 ISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +Q   +     +E++ + +S +       + + G + +         + +
Sbjct: 263 LSRYLYVYVNKQPNKDLAPMEKEFIRYVLSKQGQQ---VVEKDGYVTLPKSVVAKDLEQL 319


>gi|261408697|ref|YP_003244938.1| phosphate-binding protein [Paenibacillus sp. Y412MC10]
 gi|329929162|ref|ZP_08282948.1| phosphate binding protein [Paenibacillus sp. HGF5]
 gi|261285160|gb|ACX67131.1| phosphate binding protein [Paenibacillus sp. Y412MC10]
 gi|328936839|gb|EGG33274.1| phosphate binding protein [Paenibacillus sp. HGF5]
          Length = 334

 Score =  165 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 84/329 (25%), Positives = 134/329 (40%), Gaps = 50/329 (15%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
            T T     I I GSSTL P ++ IAE F    P+ + P    G          +   + 
Sbjct: 51  STTTALSGTIEIDGSSTLHPLTEAIAEEFGAANPDVRIPIGTGG-----TGGGFKRFNNG 105

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
            I I N+SR I  +E +E K  G+S  + +       ++V+  +     LTV++L K   
Sbjct: 106 EIPISNASRPIKDSEAEEAKSKGISYHEVLVAYDGLSVVVNPSNEFVDKLTVDELKKIYE 165

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                        +K W+++R  +P   I IY P   HGT +   + +  E      +  
Sbjct: 166 PNS---------TVKTWADVREGWPAEEIKIYSPGTDHGTFDYFTEAINGEAQASRNDSQ 216

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
                                     I    D    +  +  +K+  G+ G SFY+ N D
Sbjct: 217 --------------------------ITFSADTNAVVQGVAGDKNSIGYFGFSFYEENQD 250

Query: 259 VLKLVPIDG----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
            LKLVPID     + PSM TI    Y P+SRPLL YV  +       +  +++F + +  
Sbjct: 251 KLKLVPIDNGTATVAPSMETIKDNSYAPLSRPLLLYVNDKELE-RPEVSAFMTFYLDNAA 309

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIAV 342
               S   + G +P+ +E+ +  +D +A 
Sbjct: 310 ----SLAGEVGFVPLQDEQYQEEKDKLAK 334


>gi|228967339|ref|ZP_04128374.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar sotto str. T04001]
 gi|228792374|gb|EEM39941.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis serovar sotto str. T04001]
          Length = 284

 Score =  165 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 69/330 (20%), Positives = 131/330 (39%), Gaps = 48/330 (14%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +           +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G 
Sbjct: 1   MSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGTGGGFNRFGKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR + Q E +E KK+ +             ++V+  +     ++V++L  
Sbjct: 59  ---EVDINNASRVMKQVEKNEMKKNSIQFTPFEVAKDGLTIVVNWHNTWVDDMSVDELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +              K+WS+I   +P  ++  Y P    GT +  +  +LQ   +  +
Sbjct: 116 LWSED---------GSEKRWSQIHSTWPREQVNFYAPGVDSGTYDYFQNVILQNHRIVKK 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K    FVG ++Y  
Sbjct: 167 -----------------------------VSLSEDDQVIMQGVMNDKHAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + +  YV F +     
Sbjct: 198 NRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVANYVEFMI----Q 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              +   + G + +  E+       +   K
Sbjct: 254 HVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 283


>gi|126173618|ref|YP_001049767.1| phosphate binding protein [Shewanella baltica OS155]
 gi|152999898|ref|YP_001365579.1| phosphate-binding protein [Shewanella baltica OS185]
 gi|160874523|ref|YP_001553839.1| phosphate-binding protein [Shewanella baltica OS195]
 gi|217974137|ref|YP_002358888.1| phosphate-binding protein [Shewanella baltica OS223]
 gi|304409490|ref|ZP_07391110.1| phosphate binding protein [Shewanella baltica OS183]
 gi|307303848|ref|ZP_07583601.1| phosphate binding protein [Shewanella baltica BA175]
 gi|125996823|gb|ABN60898.1| phosphate binding protein [Shewanella baltica OS155]
 gi|151364516|gb|ABS07516.1| phosphate binding protein [Shewanella baltica OS185]
 gi|160860045|gb|ABX48579.1| phosphate binding protein [Shewanella baltica OS195]
 gi|217499272|gb|ACK47465.1| phosphate binding protein [Shewanella baltica OS223]
 gi|304352008|gb|EFM16406.1| phosphate binding protein [Shewanella baltica OS183]
 gi|306912746|gb|EFN43169.1| phosphate binding protein [Shewanella baltica BA175]
 gi|315266762|gb|ADT93615.1| phosphate binding protein [Shewanella baltica OS678]
          Length = 323

 Score =  165 bits (416), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 51/360 (14%), Positives = 113/360 (31%), Gaps = 61/360 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +           A                  +   GS TL     + AE
Sbjct: 1   MKLKKLVGAITLTAAGVFSATAMASIDQSLPTYEKASGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F + +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  EFKQMYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEIEAFEKHYGYKP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFP 163
             V +  D + +   +D     L+VE +    +S            +++W    +  ++ 
Sbjct: 116 TAVRVAIDALAVFVHKDNPIKGLSVEQVDGIFSSTHKCGSS----DIQRWGELGLDGNWS 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              + +Y  +   GT    ++  L +G  +                              
Sbjct: 172 AKDVQLYGRNSVSGTYGYFKEHALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +     + I  +     +G YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVAIAKKGEEFIEATAENAANGTYP 262

Query: 282 ISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +Q   +     +E++ + +S +       + + G + +         + +
Sbjct: 263 LSRYLYVYVNKQPNKDLAPMEKEFLRYVLSKQGQQ---VVEKDGYVTLPKSVVAKDLEQV 319


>gi|114048267|ref|YP_738817.1| phosphate binding protein [Shewanella sp. MR-7]
 gi|113889709|gb|ABI43760.1| phosphate binding protein [Shewanella sp. MR-7]
          Length = 323

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 52/360 (14%), Positives = 112/360 (31%), Gaps = 61/360 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +           A                  +   GS TL     + AE
Sbjct: 1   MKLKKLVGAMTLTAAGVFSATAMASVDQSLPTYEKASGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F + +P      +++ GSS        G    T      SRK+  NE +  +KH     
Sbjct: 61  EFKQMYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEEEAFEKHYGYKP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFP 163
             V +  D + +   +D     LTVE +    +S            +++W    +  ++ 
Sbjct: 116 TAVRVAIDALAVFVHKDNPIKGLTVEQVDGIFSSTHKCGSS----DIQRWGELGLDGNWS 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              + +Y  +   GT    ++  L +G  +                              
Sbjct: 172 AKDVQLYGRNSVSGTYGYFKEHALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +     + I  +     +G YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVAIAKKGNEFIEATAENAANGTYP 262

Query: 282 ISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +Q   +     +E++ + +S +       + + G + +         + +
Sbjct: 263 LSRYLYVYVNKQPNKDLAPMEKEFIRYVLSKQGQQ---VVEKDGYVTLPKSVVAKDLEQL 319


>gi|113971042|ref|YP_734835.1| phosphate binding protein [Shewanella sp. MR-4]
 gi|117921318|ref|YP_870510.1| phosphate binding protein [Shewanella sp. ANA-3]
 gi|113885726|gb|ABI39778.1| phosphate binding protein [Shewanella sp. MR-4]
 gi|117613650|gb|ABK49104.1| phosphate binding protein [Shewanella sp. ANA-3]
          Length = 323

 Score =  164 bits (415), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 52/360 (14%), Positives = 112/360 (31%), Gaps = 61/360 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +           A                  +   GS TL     + AE
Sbjct: 1   MKLKKLVGAMTLTAAGVFSATAMASVDQSLPTYEKASGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F + +P      +++ GSS        G    T      SRK+  NE +  +KH     
Sbjct: 61  EFKQMYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEEEAFEKHYGYKP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFP 163
             V +  D + +   +D     LTVE +    +S            +++W    +  ++ 
Sbjct: 116 TAVRVAIDALAVFVHKDNPIKGLTVEQVDGIFSSTHKCGSS----DIQRWGDLGLDGNWS 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              + +Y  +   GT    ++  L +G  +                              
Sbjct: 172 AKDVQLYGRNSVSGTYGYFKEHALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +     + I  +     +G YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVAIAKKGNEFIEATAENAANGTYP 262

Query: 282 ISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +Q   +     +E++ + +S +       + + G + +         + +
Sbjct: 263 LSRYLYVYVNKQPNKDLAPMEKEFIRYVLSKQGQQ---VVEKDGYVTLPKSVVAKDLEQL 319


>gi|75759757|ref|ZP_00739836.1| Phosphate-binding protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228902786|ref|ZP_04066932.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis IBL 4222]
 gi|74492755|gb|EAO55892.1| Phosphate-binding protein [Bacillus thuringiensis serovar
           israelensis ATCC 35646]
 gi|228856860|gb|EEN01374.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           thuringiensis IBL 4222]
          Length = 284

 Score =  164 bits (415), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 69/330 (20%), Positives = 131/330 (39%), Gaps = 48/330 (14%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +           +R+ GSST+FP  + +AE +++  P+ K   +   G+  G   F +G 
Sbjct: 1   MSTAFALNDTGEVRVDGSSTVFPIIEAVAEEYTKVHPDVKIS-ISISGTGGGFNRFGKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR + Q E +E KK+ +             ++V+  +     ++V++L  
Sbjct: 59  ---EVDINNASRVMKQVEKNEMKKNSIQFTPFEVANDGLAIVVNWHNTWVDDMSVDELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +              K+WS+I   +P  ++  Y P    GT +  +  +LQ   +  +
Sbjct: 116 LWSED---------GSEKRWSQIHSTWPREQVNFYAPGVDSGTYDYFQNVILQNHRIVKK 166

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        + +  D    +  +  +K    FVG ++Y  
Sbjct: 167 -----------------------------VSLSEDDQVIMQGVMNDKHAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K + ++G+ P+  TI SG Y P+SRPLL YV      + + +  YV F +     
Sbjct: 198 NRDKVKAIKVNGVFPTKETIQSGKYKPLSRPLLTYVNNASIRNKMNVANYVEFMI----Q 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              +   + G + +  E+       +   K
Sbjct: 254 HVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 283


>gi|229098743|ref|ZP_04229683.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-29]
 gi|228684822|gb|EEL38760.1| Phosphate ABC transporter, phosphate-binding protein [Bacillus
           cereus Rock3-29]
          Length = 284

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 65/330 (19%), Positives = 126/330 (38%), Gaps = 48/330 (14%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +           +R+ GSST+FP  + +AE +++  P  K   +   G+  G   F +G 
Sbjct: 1   MSTAFAVNEMGEVRVDGSSTVFPIIEAVAEEYTKEHPNVKIS-ISVSGTGGGFNRFSKG- 58

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
               +DI N+SR + Q E +E K + +             ++V+  +    ++TV++L  
Sbjct: 59  ---EVDINNASRVMKQVEENEMKNNSIQFTPFEVAYDGLTIVVNRHNTWVDNMTVDELRL 115

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +              K+WS++   +P  ++  Y P    GT +  +  +L        
Sbjct: 116 LWSED---------GREKRWSQVHSIWPRAQVKFYAPGVDSGTYDYFQNVIL-------- 158

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                  R+    + +  D    +  +  +K+   FVG ++Y  
Sbjct: 159 ---------------------QNRRIVKKVSLSEDDQVIMQGVMHDKNAIAFVGYAYYMA 197

Query: 256 NADVLKLVPIDGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMM 314
           N D +K + ++G+ P+  TI SG Y P+SR L  YV        + +  Y  F +     
Sbjct: 198 NRDRVKAIKVNGVFPTKETIQSGDYKPLSRSLFTYVNDASIRQKINVANYAEFMI----K 253

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGK 344
              +   + G + +  E+       +   K
Sbjct: 254 HVGNLAEEVGYVKLRKEKYNEQLRMLTEIK 283


>gi|212638722|ref|YP_002315242.1| phosphate ABC transporter periplasmic protein [Anoxybacillus
           flavithermus WK1]
 gi|212560202|gb|ACJ33257.1| ABC-type phosphate transport system, periplasmic component
           [Anoxybacillus flavithermus WK1]
          Length = 348

 Score =  164 bits (414), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 77/363 (21%), Positives = 135/363 (37%), Gaps = 62/363 (17%)

Query: 1   MRF-----FFVVLMCFVVLEVYCGTGT---------FARNRIRIAGSSTLFPYSKIIAEN 46
           M+         V    +     CG G               + + GSST++P  +  AE 
Sbjct: 29  MKKNKWFALAGVTSAVLAFTTACGGGADQGGENGGEQLSGNVVVDGSSTVYPILEAAAEA 88

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           ++   P+ K   V   G+  G ++F +G      D  N+SR I   E    +++G+   +
Sbjct: 89  YAGEQPDVKVS-VGLSGTGGGFEKFTKG----ETDFSNASRPIKDEEKKAAEQNGIQFEE 143

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
                    +L++  +     LTV++L K   S       V  N   KWS+IRP++P   
Sbjct: 144 FQVAFDGLSVLINKDNDWVDYLTVDELKKIFTS-----GAVNGNDKVKWSDIRPEWPNEE 198

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           I ++ P    GT +  ++ +L    +                                 +
Sbjct: 199 IKLFSPGHDSGTFDYFDEVILDGQPLNKTA-----------------------------Q 229

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-P 281
           +  D    +  I  +K+  G+ G ++Y  N D LK VPID     + P+  TI SG Y P
Sbjct: 230 LSEDDNVLVQGIAGDKNALGYFGFAYYIENKDKLKAVPIDNGNGPVEPTHETIQSGEYAP 289

Query: 282 ISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           +SRPL  Y   +       + ++  F + +          + G + +  E+       + 
Sbjct: 290 LSRPLFTYANVKALKEKPQVYDFAKFLLENGA----EFAEEVGYVALPQEKYDEQLKKLE 345

Query: 342 VGK 344
             K
Sbjct: 346 GLK 348


>gi|148242465|ref|YP_001227622.1| ABC-type phosphate transport system, substrate binding protein
           [Synechococcus sp. RCC307]
 gi|147850775|emb|CAK28269.1| ABC-type phosphate transport system, substrate binding protein
           [Synechococcus sp. RCC307]
          Length = 352

 Score =  164 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 73/351 (20%), Positives = 140/351 (39%), Gaps = 52/351 (14%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKT---PFVE 60
              V +  +      G    A   I I GSST+ P + +  + F       K    P VE
Sbjct: 14  MLAVGVGLLTASGAGGLKAQATAPILITGSSTVGPITTLAIQGFRSTAAGRKVRFSPVVE 73

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           S G+S G ++FC G       I N+SR I+Q EL  C   G+   +         ++V+ 
Sbjct: 74  S-GTSAGFRDFCSG----KTPISNASRPISQKELKRCADQGIKFFELPIAFDAITVVVNP 128

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +  + S++V +L +  +             +K+W+++  D+PE  IA+Y P    GT +
Sbjct: 129 ANTWAKSISVAELRRLWSRS-------AQGTIKRWNQVSLDWPEKPIALYGPGADSGTFD 181

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + +         ++                                +    +  +  
Sbjct: 182 TFNQAINGSKRDSRSDYVS----------------------------SENDNVLVQGVAS 213

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHF 295
           N +  G+ G ++Y  N + L+ +P++     ++PS+ T+ +G Y P+SRP+  YV  +  
Sbjct: 214 NSNALGYFGYAYYAANRNKLRALPVESDQGPVMPSLETVQNGSYSPLSRPVFIYVNAKSL 273

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                LR +V + +++        + + G IP++  +   V+  +     G
Sbjct: 274 KDSASLRAFVQYYLNNATQ----LVEKEGSIPLTKAQYLVVKSKMLKQVQG 320


>gi|257387841|ref|YP_003177614.1| phosphate binding protein [Halomicrobium mukohataei DSM 12286]
 gi|257170148|gb|ACV47907.1| phosphate binding protein [Halomicrobium mukohataei DSM 12286]
          Length = 332

 Score =  164 bits (413), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 72/323 (22%), Positives = 128/323 (39%), Gaps = 54/323 (16%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKE-FCRGIGDDTIDIVNS 85
           ++ + GSST+FP S  +AE F E         V+  GS  G +  FC G      DI  S
Sbjct: 54  QVIVKGSSTVFPISDTMAEEFMEEHGNVNV-TVDPTGSGGGFENWFCAG----DSDINGS 108

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR IT  E+D+C  + V  ++    G      V++       ++ E+L +  +       
Sbjct: 109 SRPITDAEVDQCATNDVEPVEFQVAGDALTAAVNNDAEWVECMSFEELRQIWS------- 161

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
               N + +WS++R D+P+ ++ +Y P+   GT +   + V+ E    + ++        
Sbjct: 162 ---DNDVTRWSDVREDWPDRKLELYGPASTSGTFDWFNEHVVGEEIEHTTDYQPT----- 213

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                                   +    +  I  N    G+ G ++Y +N++ +K + I
Sbjct: 214 -----------------------EEDETIVRGIRDNGGGMGYFGYAYYSSNSEAVKAIDI 250

Query: 266 ------DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQ 319
                     PS+     G YP++RPL  YV  +       + EYV + +     A    
Sbjct: 251 KAEAGDKCTPPSLPNAKDGSYPMARPLFLYV-AESALQREEVYEYVRYYLE---QAETDV 306

Query: 320 LFQYGLIPISNEERKSVRDSIAV 342
           +   G +P S E+R      +  
Sbjct: 307 VQDIGYVPSSAEQRDENLAKLEE 329


>gi|309951514|gb|ADO95180.1| putative phosphate ABC transporter [Sinorhizobium sp. M14]
          Length = 376

 Score =  164 bits (413), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 70/343 (20%), Positives = 133/343 (38%), Gaps = 47/343 (13%)

Query: 10  CFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLK 69
              +  +   +       + I GSST+FP S+ +AE F +         V S G+  G K
Sbjct: 53  IVTLGLLVAPSFAQQAPTVLIDGSSTVFPISEAMAEEFQKAQAGKTLVTVGSSGTGGGFK 112

Query: 70  EFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLT 129
           +FCRG      DI  +SR I  +E++ CK++GV  I+          +V+  +  +  +T
Sbjct: 113 KFCRG----ETDITGASRPIKSDEIELCKQNGVEFIELPVAIDALATIVNPANDWATCMT 168

Query: 130 VEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQE 189
           VE+L K                +  W+++R +FP+ ++ ++      GT +     +  +
Sbjct: 169 VEELKKIWEPE-------AQGKVTNWNQVRGEFPDAKLGLFGAGTDSGTYDYYTFAINGK 221

Query: 190 GCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVG 249
                 +++                               D   T+  +  +K+  GF+G
Sbjct: 222 EHASRGDYTAT----------------------------EDDNITIQGVGGDKNAIGFLG 253

Query: 250 LSFYKNNADVLKLVPID-----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLRE 303
           L++   NA  +K V I       + PS+ T   G Y P++RPL +Y  ++       +R 
Sbjct: 254 LAYLTENAGKVKAVEIKQADGSCVAPSIETATDGTYQPLTRPLFYYASKKSAEEKEHVRA 313

Query: 304 YVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
           +  F    +    +  + + G + +  E             +G
Sbjct: 314 FAEFLF--DAKNQEELVSEVGYVALPAEAAGLALKKFEKRVTG 354


>gi|119774213|ref|YP_926953.1| phosphate-binding protein [Shewanella amazonensis SB2B]
 gi|119766713|gb|ABL99283.1| phosphate-binding protein [Shewanella amazonensis SB2B]
          Length = 323

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 58/359 (16%), Positives = 114/359 (31%), Gaps = 61/359 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGT---------------GTFARNRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +                        +     +   GS TL     + AE
Sbjct: 1   MKLKQLVGAMTLTAAGLFTAAASAALDPALHTYEKTSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F   +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  EFKTIYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEVEAFEKHYGYKP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFP 163
            E+ +  D + +   +D     LT+E L    +S          N + +W    +   + 
Sbjct: 116 TEIRVAIDALAVFVHKDNPIKGLTIEQLDGIFSSTHKCGG----NDVARWGDLGLDSSWA 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              I +Y  +   GT    ++K L +G  +                              
Sbjct: 172 AKDIQLYGRNSVSGTYGYFKEKGLCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + L     + I  S+    +G YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVALAKKGNEFIDASIENAANGTYP 262

Query: 282 ISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           +SR L  YV +  + +     RE++ + +S +       + + G IP+         + 
Sbjct: 263 LSRYLYVYVNKHPNKDLAPMEREFIRYVLSKQGQ---MVVEKDGYIPLPASVIAKDLEK 318


>gi|300715553|ref|YP_003740356.1| phosphate binding protein [Erwinia billingiae Eb661]
 gi|299061389|emb|CAX58499.1| phosphate binding protein [Erwinia billingiae Eb661]
          Length = 308

 Score =  163 bits (412), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 55/346 (15%), Positives = 107/346 (30%), Gaps = 41/346 (11%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+  F++L+    L      G  A   +   GS TL     +  ++F+  FP      V+
Sbjct: 1   MKKLFLMLLACFSLTTQAQEGMLA-GNLTSVGSDTLGSLMTLWGDSFNRQFPGVNV-QVQ 58

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           + GSS        G       I   SR +   E    +         V +  D +++V +
Sbjct: 59  AAGSSTAPTSLAAGA----AQIGAMSRPMQAVERQLFEDRYGYPPLAVPVAMDALVVVVN 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +D     L  + L    +           +        +P +    +  +  +   GT  
Sbjct: 115 QDNPIKGLNTQQLDAIFSVTRRCGALSAVHRWGDVQLTQPSWVSRPLQRFGRNSASGTWG 174

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             +++ L  G  R+                              +         +  +  
Sbjct: 175 FFKQQALCNGDFRND-----------------------------VGEYPGSAAVVQAVAG 205

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNS 297
             +  G+  +  + +    L +     + + P    I SG YP +R L  YV +      
Sbjct: 206 TLNAIGYASMGIHLSGVKTLPVSRDGQNWVAPDAANIRSGRYPYARKLYLYVNKPPGKPL 265

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
                 ++   +S +  A    + Q G +P+S E+    R  I   
Sbjct: 266 EPLTAAFLHHVLSADGQA---LVTQAGYLPLSPEQVSQARALIEDR 308


>gi|148658246|ref|YP_001278451.1| phosphate binding protein [Roseiflexus sp. RS-1]
 gi|148570356|gb|ABQ92501.1| phosphate binding protein [Roseiflexus sp. RS-1]
          Length = 666

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 62/317 (19%), Positives = 126/317 (39%), Gaps = 39/317 (12%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             I  AGSST+FP ++ +AE F +         ++S G+  G + FC+       DI N+
Sbjct: 90  GNIVTAGSSTVFPLTQRMAERFKDEGYTGNI-TIDSIGTGAGFERFCKA---GETDISNA 145

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR I   E++ C+  G   ++         ++V+  +    SLT   L            
Sbjct: 146 SRPIKAAEVENCRAIGREPVEFRVGTDALAVVVNPANTFVDSLTKAQL-----------A 194

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +     K W ++ PD+P   I ++ P    GT +   + V+     +    + +     
Sbjct: 195 DIFSGKAKTWKDVNPDWPANPIKLFSPGSDSGTFDFFVEVVMDPAFEKKGKEAIL----- 249

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                          +   I++  +    +  +E + +  G+ G +++    D LK V +
Sbjct: 250 ---------------NAPGIQLSENDNVLVQGVEGDPNAIGYFGYAYFVPEKDRLKAVKV 294

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGL 325
           +G+ P+  T  +G YP++RPL  Y   +       +  +++F ++      + ++   G 
Sbjct: 295 EGVEPTEKTAETGEYPLARPLFIYSDAKIMKEKPQVAAFINFYLT----FVNDEVLDVGY 350

Query: 326 IPISNEERKSVRDSIAV 342
            P S +     + +   
Sbjct: 351 FPASQQAINVAKANWLA 367



 Score =  160 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 63/317 (19%), Positives = 126/317 (39%), Gaps = 39/317 (12%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             I  AGSST+FP ++ +AE F +         ++S G+  G + FC+       DI N+
Sbjct: 385 GNIVTAGSSTVFPLTQRMAERFKDEGYTGNI-TIDSIGTGAGFERFCKA---GETDISNA 440

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR I   E++ C+  G   ++         ++V+  +    SLT   L            
Sbjct: 441 SRPIKAAEVENCRAIGREPVEFRVGTDALAVVVNPANTFVDSLTKAQL-----------A 489

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +     K W ++ PD+P   I ++ P    GT +   + V+     +    + +     
Sbjct: 490 DIFSGKAKTWKDVNPDWPANPIKLFSPGTDSGTFDFFVEVVMDPAFEKKGKEAIL----- 544

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                          +   I++  +    +  +E + +  G+ G +++    D LK V +
Sbjct: 545 ---------------NAPGIQLSENDNVLVQGVEGDPNAIGYFGYAYFIAEKDRLKAVKV 589

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGL 325
           +G+ P+  T  SG YP++RPL  Y   +       +  +++F ++      + ++   G 
Sbjct: 590 EGVEPNDQTAESGQYPLARPLFIYSDAKIMKEKPQVAAFINFYLT----FVNDEVLDVGY 645

Query: 326 IPISNEERKSVRDSIAV 342
            P S +     + +   
Sbjct: 646 FPASQQAINVAKLNWLA 662


>gi|289191692|ref|YP_003457633.1| phosphate binding protein [Methanocaldococcus sp. FS406-22]
 gi|288938142|gb|ADC68897.1| phosphate binding protein [Methanocaldococcus sp. FS406-22]
          Length = 273

 Score =  162 bits (410), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 69/333 (20%), Positives = 127/333 (38%), Gaps = 66/333 (19%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNR-----IRIAGSSTLFPYSKIIAENFSEYFPEFK 55
           MR F  + +  +V+   CG     +       I +AG + L P  +   + F +  P  K
Sbjct: 1   MRKFLGIFIGILVVLCLCGCINSNKETVKEEKITLAGGTALVPIMEEAGKEFMKKHPNVK 60

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
              V  GGS  G+K+   G     +DI  + R +   E ++     V       IG+DG+
Sbjct: 61  V-IVSGGGSGFGIKQVGEG----YVDIGMAGRDLKPEEKEKYPNLKVY-----RIGYDGV 110

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
            +V +       LT E + K           +    +  W E+     +  I IY    +
Sbjct: 111 AIVVNPKNPIDGLTKEQVKK-----------IFAGEITNWKEV--GGKDAPINIYTRDPE 157

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GTR+   + VL +G +  +                               V     E  
Sbjct: 158 SGTRDTFWRLVLDKGNITKKAI-----------------------------VVASNGEMK 188

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHF 295
           A+I ++++  G++ + +       +K + +DGI P+   ++ G+Y + RPL      +  
Sbjct: 189 AKIAMDENGIGYLSVGYVD---KSVKAIKLDGIAPTQENVMKGIYKVYRPLNLITNGEPK 245

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPI 328
                ++E++ F +SDE       + + G IP+
Sbjct: 246 GV---VKEFIDFVLSDEGQK---IVEEKGFIPV 272


>gi|56751670|ref|YP_172371.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Synechococcus elongatus PCC 6301]
 gi|81301254|ref|YP_401462.1| phosphate binding protein [Synechococcus elongatus PCC 7942]
 gi|730807|sp|P39665|SPHX_SYNE7 RecName: Full=Protein sphX; Flags: Precursor
 gi|2126519|pir||S54402 SphX protein - Synechococcus sp
 gi|496319|dbj|BAA05147.1| SphX [Synechococcus elongatus PCC 7942]
 gi|56686629|dbj|BAD79851.1| periplasmic phosphate-binding protein of ABC transporter
           [Synechococcus elongatus PCC 6301]
 gi|81170135|gb|ABB58475.1| Phosphate binding protein [Synechococcus elongatus PCC 7942]
          Length = 337

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 69/349 (19%), Positives = 132/349 (37%), Gaps = 53/349 (15%)

Query: 4   FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGG 63
             + +             +  R  +   GSST+FP S+ +AE F +           SG 
Sbjct: 13  VLLPIAAVASSLFPIQEASAQRALVTADGSSTVFPISEAVAEEFQKRNKNINVTVGVSGT 72

Query: 64  SSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDM 123
                K FC G     IDI N+SR I + E++ C+K G+  I E+ +  D + +V ++  
Sbjct: 73  GGG-FKRFCNG----EIDIANASRPIKKEEVEACRKKGIRYI-ELPVAFDALTVVVNKSN 126

Query: 124 VSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLE 183
              S+T  +L K          +        W +++  FP + + +Y P    GT +   
Sbjct: 127 PVNSITTAELAKIF-------GRDAEKKTTNWRQVKSSFPNLPLRVYAPGTDSGTYDYFN 179

Query: 184 KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKD 243
           + +L +      + +                               D    +  +  ++ 
Sbjct: 180 EAILNKKG-TRGDLTA----------------------------SEDDNILVQGVSRDRG 210

Query: 244 VFGFVGLSFYKNNADVLKLVPI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNS 297
             GF G S+Y+ N   LK + +       ++PS+  +++G Y P++RP+  YV  +    
Sbjct: 211 GIGFFGFSYYEENKGKLKALAVVNSNGKAVMPSVQNVLNGTYDPLARPVFIYVS-EQAAK 269

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
              +R +V+F +            + G +P+  +   +        K+G
Sbjct: 270 KANVRSFVNFYL----QNAGKLSREVGFVPLPAKAYTAATQRFRSNKTG 314


>gi|302342493|ref|YP_003807022.1| phosphate binding protein [Desulfarculus baarsii DSM 2075]
 gi|301639106|gb|ADK84428.1| phosphate binding protein [Desulfarculus baarsii DSM 2075]
          Length = 276

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 69/331 (20%), Positives = 116/331 (35%), Gaps = 59/331 (17%)

Query: 1   MRF---FFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP 57
           MR       V+       +  G    A ++I I+GS+T+ P ++  AE + +  P     
Sbjct: 1   MRKKSLIKSVICLAAAGVMLLGGAALAADKISISGSTTVLPIAQKAAEVYMKTNPGAAEI 60

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            V   GS  GLK    G     IDI +SSR     E+    + GV  + +  +  D I+ 
Sbjct: 61  SVSGTGSGDGLKALVEGS----IDIADSSRAAKDKEIKRADEKGVK-LVKHVVALDCIVP 115

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V +       LT   +             +    +K WSE+     +  I +       G
Sbjct: 116 VVNPANKVTGLTKAQIKD-----------IYTGAIKNWSEV--GGDDGPIVVISRDSSSG 162

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T EV  + VL +                            VR D    ++          
Sbjct: 163 TFEVWNELVLHK--------------------------ERVRPDA---QLQASNGAVAQA 193

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNS 297
           +  NK   G+VG+ +    +  LK + +DG+  S        YP+SR L  Y   +    
Sbjct: 194 VASNKYAIGYVGIGYL---SKDLKGLTVDGVAASSDAARDKSYPVSRELYMYTNGEPTG- 249

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPI 328
              ++ ++ F +  E         + G +P+
Sbjct: 250 --AVKAFIDFVMGAEGQK---IAGEEGFVPV 275


>gi|91201117|emb|CAJ74176.1| strongly similar to phosphate binding protein of ABC-type phosphate
           transport system [Candidatus Kuenenia stuttgartiensis]
          Length = 324

 Score =  162 bits (409), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 52/323 (16%), Positives = 111/323 (34%), Gaps = 46/323 (14%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS T+       AE F+  +P  K   +E  GS+        G    T  I  
Sbjct: 42  SGNLNSIGSDTMNNLMTFWAEGFNRLYPNVKV-QIEGKGSTTAPPALISG----TAQIGP 96

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR +   E+D  +K       E+    D + +  ++D     L++  +    +S     
Sbjct: 97  MSRAMKPTEIDAFEKKYGYKPTEIRTALDALAVYVNKDNPIKGLSLPQIDAIFSSTRRGG 156

Query: 145 DKVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
                  +K W    +  D+    I++Y  +   GT    ++  L +G  ++        
Sbjct: 157 ---YKEDIKTWGQLGLTADWASKPISLYGRNSASGTYGYFKEHALFKGDFKNT------- 206

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                 ++        +  I  ++   G+ G+ +  +    + +
Sbjct: 207 ----------------------VKEQPGSASVVQGITEDRYSIGYSGIGYQTSGIKTVPV 244

Query: 263 VPIDGI---VPSMGTIVSGLYPISRPLLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDS 318
              +G          +++G YP++R L  Y+ ++        +RE+V F +S+E      
Sbjct: 245 ALKEGRHFVEAKSENVLNGSYPLARFLYIYINKKPGQPLDPLIREFVRFILSNEGQQ--- 301

Query: 319 QLFQYGLIPISNEERKSVRDSIA 341
            + + G +P+ +   +     I 
Sbjct: 302 IVIKDGYMPLPSSVVEKELKKIE 324


>gi|310766803|gb|ADP11753.1| Putative phosphate binding protein [Erwinia sp. Ejp617]
          Length = 307

 Score =  162 bits (409), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 53/344 (15%), Positives = 109/344 (31%), Gaps = 41/344 (11%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  V +  +   G  A   +   GS TL     +  + FS+ +P        
Sbjct: 1   MKHLIALALLLVCMLAHAKEGMLA-GNLNSVGSDTLGNLMALWGDRFSQQYPGVNVQIQA 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           +G S+                    SR +   E              V +  D +++V +
Sbjct: 60  AGSSTAPTALAAGAAQLGA-----MSRPMQAAERQLFADRYGYPPLAVPVAIDALVVVVN 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +D     L  + L    +   +    +           +P + +  I  +  +   GT  
Sbjct: 115 QDNPLTGLNAQQLDAIFSVTRLCGGGLSPRTWGDLQLTQPGWAQRGIQRFGRNSASGTWG 174

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             +++ L  G                           +R D   +         +  +  
Sbjct: 175 FFKQQALCNGD--------------------------LRND---VGEYPGSAAVVQAVAG 205

Query: 241 NKDVFGFVGLSFYKNNADVLKLV--PIDGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNS 297
           + +  G+    F+ +   V+ +       I P+   I SG YP +RPL  YV +      
Sbjct: 206 SLNGIGYASAGFHLSGVKVVPVARDCHHWIAPTAENIRSGRYPYARPLYIYVNKAPGKPL 265

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
                 ++  ++S+   A    + + G +P+S  +R+     IA
Sbjct: 266 EPLSAAFLRLALSNAGQA---LVSRAGYLPLSEAQREQALAMIA 306


>gi|284166703|ref|YP_003404982.1| phosphate binding protein [Haloterrigena turkmenica DSM 5511]
 gi|284016358|gb|ADB62309.1| phosphate binding protein [Haloterrigena turkmenica DSM 5511]
          Length = 328

 Score =  162 bits (409), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 61/319 (19%), Positives = 127/319 (39%), Gaps = 47/319 (14%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            I IAGSST++P  + I+E ++E   +     + S GS  G ++          D  N+S
Sbjct: 43  EIDIAGSSTVYPLMEAISEKYNEDEDDSVGFNISSTGSGGGFEDH---FCPGETDFNNAS 99

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R +   E  +CK++ V  I+ V       +++++ +  +  +T+E+L +   +       
Sbjct: 100 RAMKDEEKSKCKENDVEWIELVAATDALTVVINNENDWATEMTIEELAQIWEA------- 152

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
              +  + WS++  ++P+  I  +      GT +   + V+ E    + ++         
Sbjct: 153 ---DAAETWSDVNSEWPDEEIGRHGADDTSGTYDYFLENVMGEDRGHTDDYQAT------ 203

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266
                                  +    +  ++ ++   G+ G S+Y  N D +  V ID
Sbjct: 204 ----------------------ENDDNIVTGVQGDQYAIGYFGFSYYYQNPDQVTAVAID 241

Query: 267 G----IVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
                + PS+ T  SG Y P+SR L  Y           + ++  F V ++         
Sbjct: 242 NGDGPVEPSLDTAASGEYQPLSRSLYTYPSVGSLEDKDHVADFARFFV-EQTTNESLVAD 300

Query: 322 QYGLIPISNEERKSVRDSI 340
             G +P++ +++    D +
Sbjct: 301 DVGYVPLTEDQQSEQMDKL 319


>gi|259909295|ref|YP_002649651.1| Putative phosphate binding protein [Erwinia pyrifoliae Ep1/96]
 gi|224964917|emb|CAX56440.1| Putative phosphate binding protein [Erwinia pyrifoliae Ep1/96]
 gi|283479350|emb|CAY75266.1| putative phosphate binding protein [Erwinia pyrifoliae DSM 12163]
          Length = 307

 Score =  161 bits (407), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 52/344 (15%), Positives = 110/344 (31%), Gaps = 41/344 (11%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+    + +  V +  +   G  A   +   GS TL     +  + FS+ +P        
Sbjct: 1   MKHLIALALLLVCMLAHAKEGMLA-GNLNSVGSDTLGNLMALWGDRFSQQYPGVNVQIQA 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           +G S+                    SR +   E              V +  D +++V +
Sbjct: 60  AGSSTAPTALAAGAAQLGA-----MSRPMQAAERQLFADRYGYPPLAVPVAIDALVVVVN 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +D     L  + L    +   +    +           +P + +  I  +  +   GT  
Sbjct: 115 QDNPLTGLNAQQLDAIFSVTRLCGGGLSPRTWGDLQLTQPGWAQRGIQRFGRNSASGTWG 174

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             +++ L  G                           +R D   +         +  +  
Sbjct: 175 FFKQQALCNGD--------------------------LRND---VGEYPGSAAVVQAVAG 205

Query: 241 NKDVFGFVGLSFYKNNADVLKLV--PIDGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNS 297
           + +  G+    F+ +   V+ +     + + P+   I SG YP +RPL  YV +      
Sbjct: 206 SLNGIGYASAGFHLSGVKVVPVARDDHNWVAPTAENIRSGRYPYARPLYIYVNKAPGKPL 265

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
                 ++  ++S+   A    + + G +P+S  +R+     IA
Sbjct: 266 EPLSAAFLRLALSNAGQA---LVSRAGYLPLSEAQREQALAMIA 306


>gi|304407967|ref|ZP_07389617.1| phosphate binding protein [Paenibacillus curdlanolyticus YK9]
 gi|304342986|gb|EFM08830.1| phosphate binding protein [Paenibacillus curdlanolyticus YK9]
          Length = 340

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 78/328 (23%), Positives = 134/328 (40%), Gaps = 51/328 (15%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
                 +  + I GSST++P ++  AE F +   + +     SG      K FC G    
Sbjct: 59  TAAVGLKGEVEIDGSSTVYPLTEAAAEEFGKDNADVRVTVGVSGTGGG-FKRFCNG---- 113

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
              I ++SR I   E   CK  G+             ++VS  +     LTVE+L K   
Sbjct: 114 ETAISDASRPIKDEEAAACKAKGIEYTDLQVAYDGLSIVVSKDNDFIDHLTVEELNKIF- 172

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                   V  + +K W+++R  +P   I +Y P    GT +   +++L++         
Sbjct: 173 --------VTGSTVKTWADVRAGWPAEEIKMYSPGADSGTYDYFNEEILEK--------- 215

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
                              +R D   I    D    +  +E +KD  G+ G ++Y+ NAD
Sbjct: 216 -----------------KGIRNDTQ-ISFSEDDNTLVQGVEGSKDAIGYFGFAYYEENAD 257

Query: 259 VLKLVPID----GIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEM 313
            LKLVP+D     I P++ TI  G Y P+SRPL  YV ++       +  +V + +++  
Sbjct: 258 KLKLVPVDAGKGAISPTVETIKDGTYAPLSRPLFIYVNKKELE-RPEVSAFVDYYINNIG 316

Query: 314 MAPDSQLFQYGLIPISNEERKSVRDSIA 341
                   + G +P+ +E+  +    + 
Sbjct: 317 ----DMAKEVGYVPLPDEKYDAEAAKLQ 340


>gi|156740607|ref|YP_001430736.1| phosphate binding protein [Roseiflexus castenholzii DSM 13941]
 gi|156231935|gb|ABU56718.1| phosphate binding protein [Roseiflexus castenholzii DSM 13941]
          Length = 669

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 63/317 (19%), Positives = 127/317 (40%), Gaps = 39/317 (12%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             I  AGSST+FP ++ +AE F +         ++S G+  G + FC+       DI N+
Sbjct: 93  GNIVTAGSSTVFPLTQRMAERFKDEGYAGNI-TIDSIGTGAGFERFCKA---GETDISNA 148

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR I   E++ C+  G   ++         ++V+  +    +LT   L            
Sbjct: 149 SRPIRPAEVENCRAIGREPVEFRVGTDALAVVVNPANTFVDTLTKAQL-----------A 197

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +     K W ++ PD+P   I ++ P    GT +   + V+     +    + +     
Sbjct: 198 DIFSGKAKTWKDVNPDWPANPIKLFSPGSDSGTFDFFVEVVMDPAFEKKGKEAIL----- 252

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                          +   I++  +    +  +E + +  G+ G +++    D LK V I
Sbjct: 253 ---------------NAPGIQLSENDNVLVQGVEGDPNAIGYFGYAYFIAEKDRLKAVKI 297

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGL 325
           +G+ P+  T  SG YP++RPL  Y   +       + ++++F ++      + ++   G 
Sbjct: 298 EGVEPNDQTAESGTYPLARPLFIYSDAKIMKEKPQVADFINFYLT----YVNDEVLDVGY 353

Query: 326 IPISNEERKSVRDSIAV 342
            P S +     + +   
Sbjct: 354 FPASQQAINVAKANWLA 370



 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 63/315 (20%), Positives = 127/315 (40%), Gaps = 39/315 (12%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             I  AGSST+FP ++ +AE F +         ++S G+  G + FC+       DI N+
Sbjct: 388 GNIVTAGSSTVFPLTQRMAERFKDEGYAGNI-TIDSIGTGAGFERFCKA---GETDISNA 443

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR I   E++ C+  G   ++         ++V+  +    +LT   L            
Sbjct: 444 SRPIRPAEVENCRAIGREPVEFRVGTDALAVVVNPANTFVDTLTKAQL-----------A 492

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +     K W ++ PD+P   I ++ P    GT +   + V+     +    + +     
Sbjct: 493 DIFSGKAKTWKDVNPDWPANPIKLFSPGSDSGTFDFFVEVVMDPAFEKKGKEAIL----- 547

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                          +   I++  +    +  +E + +  G+ G +++    D LK V I
Sbjct: 548 ---------------NAPGIQLSENDNVLVQGVEGDPNAIGYFGYAYFIAEKDRLKAVKI 592

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGL 325
           +G+ P+  T  SG YP++RPL  Y   +       + ++++F ++      + ++   G 
Sbjct: 593 EGVEPNDQTAESGTYPLARPLFIYSDAKIMKEKPQVADFINFYLT----YVNDEVLDVGY 648

Query: 326 IPISNEERKSVRDSI 340
            P S +     + + 
Sbjct: 649 FPASQQAITVAKLNW 663


>gi|87302283|ref|ZP_01085108.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. WH 5701]
 gi|87283208|gb|EAQ75164.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. WH 5701]
          Length = 345

 Score =  161 bits (406), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 64/348 (18%), Positives = 125/348 (35%), Gaps = 53/348 (15%)

Query: 3   FFFVVLMCFV----VLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTP- 57
            +  +L        +       G  ++  IRI+GSST+FP +   +  F +  P      
Sbjct: 5   LWICLLAALAPLPTLGTSGPALGQSSKGVIRISGSSTVFPITAEASRRFRQSPPGRDVRF 64

Query: 58  FVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILL 117
            ++  G++ G + FC G     + I N+SR I   EL  C   G+  I+         + 
Sbjct: 65  ELKETGTTGGFRAFCSGA----VAISNASRPINSQELKACAAKGIRFIELPIAFDALTVA 120

Query: 118 VSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHG 177
           V+ R+  + +++  +L         + ++     + +W+++   +P   I +  P    G
Sbjct: 121 VNPRNSWARTISPREL-------GRLWNRSAQGRIMRWNQVNSAWPAKPITLCGPDKDSG 173

Query: 178 TREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLAR 237
           T +   K V         ++                                D    +  
Sbjct: 174 TFDYFNKAVNGNATNSRSDY----------------------------RSSEDDNVLVNC 205

Query: 238 IEVNKDVFGFVGLSFYKNNADVLKLVPIDGI----VPSMGTIVSGLY-PISRPLLFYVKR 292
           +  +    G+ G S+Y  N + L+ + ++G      PS+ T+    Y P SRPL  Y+  
Sbjct: 206 VANDLQALGYFGYSYYAANRNRLRALAVEGPKGAVHPSLETVQKERYLPFSRPLFLYINN 265

Query: 293 QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +       L+ +V+  V          +   G IP++      V   +
Sbjct: 266 EQLQERPELQRFVTAFVRQG----RRIVKAAGAIPLTESTYLLVETKL 309


>gi|121996906|ref|YP_001001693.1| phosphate-binding protein [Halorhodospira halophila SL1]
 gi|121588311|gb|ABM60891.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Halorhodospira halophila SL1]
          Length = 321

 Score =  160 bits (405), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 55/314 (17%), Positives = 111/314 (35%), Gaps = 46/314 (14%)

Query: 32  GSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQ 91
           GS TL     + AE F +++P      +E  GS         G    T +    SR +  
Sbjct: 47  GSDTLNNLMTLWAEEFQDFYPNVSVE-IEGAGSGTAPVALAEG----TANFGPMSRDMRS 101

Query: 92  NELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNP 151
           +E+++ +     +  +V +  D I +  +RD     LT+E +    +           + 
Sbjct: 102 SEIEDFEDAHGYEPTKVRVAIDTIAVFVNRDNPIDGLTMEQVDGMFSETQRCGG----DD 157

Query: 152 LKKWSEI--RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQ 209
           + +W ++     +    I +Y  +   GT     +  L +G  +                
Sbjct: 158 ITRWGDVGLDGAWSNRDIILYSRNAVSGTYGFFRENALCDGDFK---------------- 201

Query: 210 QLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG-- 267
                         AI         +  +  + +  G+ G+ +  +    + L   +   
Sbjct: 202 -------------DAINEQPGSASVVQGVSESLNGIGYSGIGYKTSGVKAIALGDDEDNL 248

Query: 268 IVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL-REYVSFSVSDEMMAPDSQLFQYGLI 326
             P+    VSG YP+SR L  YV +     +  + RE++   +S E       + + G I
Sbjct: 249 YEPNAENAVSGDYPLSRFLYVYVNKDPNGELPPIEREFLRLVLSKEGQ---EVVRRDGFI 305

Query: 327 PISNEERKSVRDSI 340
           P+  E  +  ++ +
Sbjct: 306 PMPAEAAEREKERL 319


>gi|332705975|ref|ZP_08426048.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1,
           substrate-binding protein [Lyngbya majuscula 3L]
 gi|332355235|gb|EGJ34702.1| phosphate ABC transporter, PhoT family TC 3.A.1.7.1,
           substrate-binding protein [Lyngbya majuscula 3L]
          Length = 283

 Score =  160 bits (404), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 68/309 (22%), Positives = 122/309 (39%), Gaps = 49/309 (15%)

Query: 43  IAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV 102
           +AE F +  P  K   V   G+  G K+FC        DI N SR I  +E++ CKK G+
Sbjct: 1   MAEEFQKANPGIKV-TVGISGTGGGFKKFCA----RETDISNGSRPIKASEIELCKKGGI 55

Query: 103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDF 162
             I+         ++V+  +  +  L   +L K         +    + +  W +IRP F
Sbjct: 56  EYIELPIAFDGLSVVVNKENNFASCLKTAELKKIW-------EPAAQDKVNNWKQIRPGF 108

Query: 163 PEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDG 222
           P+ ++ +Y P    GT +   +  + +      +++                        
Sbjct: 109 PDTKLGLYGPGTDSGTYDYFMENTVGKDAGSRGDYTA----------------------- 145

Query: 223 IAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSG 278
                  D    +  +  +K    F G ++Y+ N D LKL+ I+G    + P+  TI  G
Sbjct: 146 -----SEDDNLLVQGVSTDKGGLAFFGYAYYEENKDKLKLLEINGGSGCVAPNKATIADG 200

Query: 279 LY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
            Y P+SRP   YV ++  N    ++ +V + +          + + G +P+  +    VR
Sbjct: 201 SYKPLSRPEFIYVNKEAAN-RPEVKAFVEYHL---AAENSKLISEVGYVPMPEDIMMLVR 256

Query: 338 DSIAVGKSG 346
              + G  G
Sbjct: 257 KRFSEGTVG 265


>gi|292656502|ref|YP_003536399.1| putative phosphate ABC transporter periplasmic substrate-binding
           protein [Haloferax volcanii DS2]
 gi|291372133|gb|ADE04360.1| ABC-type transport system periplasmic substrate-binding protein
           (probable substrate phosphate) [Haloferax volcanii DS2]
          Length = 345

 Score =  160 bits (403), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 71/325 (21%), Positives = 135/325 (41%), Gaps = 49/325 (15%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGL-KEFCRGIGDDTIDIV 83
              I IAGSST+FP +  +AE F     E     ++S GS  G    FC G      D  
Sbjct: 57  SGTIDIAGSSTVFPLATAMAERFQTEHSEVNI-NLQSTGSGGGFANYFCTG----QTDFN 111

Query: 84  NSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIV 143
           N+SR I   E D+C+ + V+ ++         ++V++ +         +  + + S    
Sbjct: 112 NASRPIKGEEQDQCESNDVTPVELKVATDALTVIVNNDNDFLGEGLTVEQLQTIFS---- 167

Query: 144 DDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
                 +    WS++  ++P+  I IY P+   GT +   + ++ E              
Sbjct: 168 ----AESTPTTWSDVNSEWPDEEIEIYGPTNASGTYDYFIEAIIGEEGP----------- 212

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                          RQD  A          +  +E ++   G++G ++Y  N D ++ V
Sbjct: 213 -------------GHRQDYSAT---EQDRTIIQGVEGSEYAIGYLGFAYYSENTDAVQAV 256

Query: 264 PI-----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPD 317
           PI     + + PS+ T +SG Y P+SRPL  Y  R+       + E+  + + +   + +
Sbjct: 257 PIENDAGEFVEPSLDTALSGEYNPLSRPLFTYPARESLAE-EHVAEFARYWIENS-TSRE 314

Query: 318 SQLFQYGLIPISNEERKSVRDSIAV 342
               + G +P+  ++++ + D++  
Sbjct: 315 IVADEVGYVPLDEDDQQEMLDTLNA 339


>gi|77165862|ref|YP_344387.1| phosphate binding protein [Nitrosococcus oceani ATCC 19707]
 gi|76884176|gb|ABA58857.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Nitrosococcus oceani ATCC 19707]
          Length = 332

 Score =  160 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 55/369 (14%), Positives = 120/369 (32%), Gaps = 63/369 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA-----------------RNRIRIAGSSTLFPYSKII 43
           M+   ++ +   VL V     + A                    +   GS TL     + 
Sbjct: 1   MQIRMIIGILGPVLGVLLSGNSMATNSLDPDLKEYDKASGVAGTLSSVGSDTLANLMTLW 60

Query: 44  AENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS 103
           AE F + +P        +G S+         + ++T +I   SRK+  NEL+  +     
Sbjct: 61  AEEFKKLYPSVNIQVQAAGSSTA-----PPALTENTANIGPMSRKMKGNELEAFENKYGY 115

Query: 104 DIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPD 161
               + +  D + +  ++D     +T+  +    ++            ++ W    +  +
Sbjct: 116 KPTPIRVAIDALAVYVNKDNPIEKITLPQIDAIFSATRKCG---YPEDIRTWGDLGLGGE 172

Query: 162 FPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQD 221
           +   RI ++  +   GT    +K  L +G  ++                           
Sbjct: 173 WVHRRIQLFGRNSVSGTYGYFKKAALCKGDFKNT-------------------------- 206

Query: 222 GIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG---IVPSMGTIVSG 278
              +         +  +  + +  G+ G+ +  +    L L    G   +  +    V G
Sbjct: 207 ---VNEQPGSASVVQGVTKSINGIGYSGIGYQTSGVRALPLATKTGAPSVEATAENAVKG 263

Query: 279 LYPISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
            YP++R L  YV +  +   +   +E++   +S         + + G IP+         
Sbjct: 264 QYPLTRFLYVYVNKHPNKPLLPLEQEFIKMVLSKAGQ---RVVIKDGYIPLPARIVAKDL 320

Query: 338 DSIAVGKSG 346
             I V + G
Sbjct: 321 AKIGVKELG 329


>gi|188534671|ref|YP_001908468.1| Putative phosphate binding protein [Erwinia tasmaniensis Et1/99]
 gi|188029713|emb|CAO97592.1| Putative phosphate binding protein [Erwinia tasmaniensis Et1/99]
          Length = 307

 Score =  160 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 56/344 (16%), Positives = 110/344 (31%), Gaps = 41/344 (11%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ F  + +  V +  +   G  A   +   GS TL     +  +NFS  +P        
Sbjct: 1   MKNFIALTLLLVSVLAHAKEGMLA-GNLNSVGSDTLGNLMALWGDNFSRQYPGVNVQIQA 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
           +G S+                    SR +   E    +         V +  D +++V +
Sbjct: 60  AGSSTAPTALAAGAAQLGA-----MSRPMQTAERQLLEDRYGYPPLAVPVAIDALVVVVN 114

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +D     +  + L    +   +                +P + +  I  +  +   GT  
Sbjct: 115 QDNPLAGVNAQQLDAIFSVTRLCGALFTPKTWGDLQLKQPGWTQRGIQRFGRNSASGTWG 174

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             +++ L  G                           +RQD   +         +  +  
Sbjct: 175 FFKQQALCNGD--------------------------LRQD---VGEYPGSAAVIQAVAG 205

Query: 241 NKDVFGFVGLSFYKNNADVLKLV--PIDGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNS 297
           + +  G+    F+ +   VL +     + I P+   I SG YP +RPL  YV +      
Sbjct: 206 SLNGIGYASAGFHLSGVKVLPVARDDHNWIAPTAENIRSGRYPYARPLYIYVNKAPGKPL 265

Query: 298 VLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
                 ++  ++S         + Q G +P+S  +R+     IA
Sbjct: 266 EPLTAAFLRLALSGAGQG---VVSQAGYLPLSEAQRQQALAMIA 306


>gi|304407968|ref|ZP_07389618.1| phosphate binding protein [Paenibacillus curdlanolyticus YK9]
 gi|304342987|gb|EFM08831.1| phosphate binding protein [Paenibacillus curdlanolyticus YK9]
          Length = 308

 Score =  160 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 73/345 (21%), Positives = 132/345 (38%), Gaps = 51/345 (14%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVES 61
           +   V     +++    G  +  +  I I GSST++P ++ +AE F +   + +     S
Sbjct: 8   KLAVVAACLSLMVSAQAGAASNLKGTIEIDGSSTVYPITEAVAEEFGKVHKDVRVTVGVS 67

Query: 62  GGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDR 121
           G      K FC G     I I ++SR I+ +E D CK  G++            ++++  
Sbjct: 68  GTGGG-FKRFCNG----EIAISDASRPISSSEKDACKAKGITYTDLTVAYDGITVVINKN 122

Query: 122 DMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREV 181
           +  +  LT  +L                  +K W+++R  FP+ +I IY P    GT + 
Sbjct: 123 NTWASKLTTAELKSIFQKDS---------KVKTWADVRKGFPDEKINIYSPGADSGTFDF 173

Query: 182 LEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVN 241
             +KV  +      +                            I    D    +  +  +
Sbjct: 174 FTEKVNGKAKESRSDKQ--------------------------ITFSEDDNVLVEGVTKD 207

Query: 242 KDVFGFVGLSFYKNNADVLKLVPI------DGIVPSMGTIVSGLYPISRPLLFYVKRQHF 295
           K   G+ G ++Y  N   LK V I        + P+  TI +G Y +SRP+  YV ++  
Sbjct: 208 KYAIGYFGYAYYVENKAKLKSVAIYMANGKTPVGPTPTTIATGKYFLSRPIFIYVSKKEL 267

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
                ++E+  F ++           + G IP+S+   KS    +
Sbjct: 268 A-RPEVKEFAKFYMAHGA----ELSKEVGYIPLSSGWYKSQASKL 307


>gi|114563931|ref|YP_751445.1| phosphate binding protein [Shewanella frigidimarina NCIMB 400]
 gi|114335224|gb|ABI72606.1| phosphate binding protein [Shewanella frigidimarina NCIMB 400]
          Length = 323

 Score =  160 bits (403), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 55/360 (15%), Positives = 113/360 (31%), Gaps = 61/360 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +         + A                  +   GS TL     + AE
Sbjct: 1   MKLNKLVGAITLTAAGVFSAASMAAIDPTLPIYEKTSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F   +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  EFKHIYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEVEAFEKHYGYQP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFP 163
             V +  D + +   +D     L++E +    +S      K     + +W +     ++ 
Sbjct: 116 TAVRVAIDALAVFVHKDNPITGLSIEQIDAIFSSTHKCGGK----EINRWGDAGLDGNWA 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              + +Y  +   GT    ++K L +G  R                              
Sbjct: 172 AKDVQLYGRNSVSGTYGYFKEKALCKGDFR-----------------------------P 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +       I  +      G YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVAISKKGDKFIEATAANAADGTYP 262

Query: 282 ISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +  + +     RE++ F +S +       + + G +P+         + +
Sbjct: 263 LSRYLYVYVNKHPNKDLSPMDREFLRFVLSKQGQQ---IVEKDGYVPLPTSVITKDLEKV 319


>gi|283470603|emb|CAQ49814.1| phosphate-binding protein PstS (PBP) [Staphylococcus aureus subsp.
           aureus ST398]
          Length = 371

 Score =  159 bits (402), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 64/356 (17%), Positives = 125/356 (35%), Gaps = 65/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---------RNRIRIAGSSTLFPYSKIIAENFSEYF 51
           M+ +  V    +   +  G              +   +  GSST+ P  + + E +++  
Sbjct: 1   MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
            + K    ++ G+  G ++F  G     ID  ++SR I   E  + +   +   +     
Sbjct: 61  SDAKISAGQA-GTGAGFQKFIAG----DIDFADASRPIKDEEKQKLQNKNIKYKEFKIAQ 115

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               + V+  +     L  + L             +     K W ++   +P+ +I    
Sbjct: 116 DGVTVAVNKENDFVDELDKQQLKA-----------IYSGKAKTWKDVNSKWPDKKINAVS 164

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P+  HGT +  E +V+ +  +++   +                               D 
Sbjct: 165 PNSSHGTYDFFENEVMNKEDIKAEKNA-------------------------------DT 193

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLYPISRPL 286
              ++ +  NK+  G+ G +FY  N D LK V I         P+  TI    Y +SRPL
Sbjct: 194 NAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKKTIQDNSYALSRPL 253

Query: 287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             YV  +       + E++ F + D+  A      + G +    +  KS  D +  
Sbjct: 254 FIYVNEKALKDNKVMSEFIKFVLEDKGKA----AEEAGYVAAPEKTYKSQLDDLKA 305


>gi|87124691|ref|ZP_01080539.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. RS9917]
 gi|86167570|gb|EAQ68829.1| ABC transporter, substrate binding protein component, possibly
           phosphate [Synechococcus sp. RS9917]
          Length = 305

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 62/312 (19%), Positives = 121/312 (38%), Gaps = 50/312 (16%)

Query: 36  LFPYSKIIAENFSEYFPEFKTPFV-ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNEL 94
           +FP  +     + +         V    G++ G++EFC G     I I N+SR I  +EL
Sbjct: 1   MFPVIERAITAYRKTRNGKDVKLVLNEVGTTGGIREFCAG----KIPIANASRPINSSEL 56

Query: 95  DECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKK 154
             C  +GV+ I+         ++V+  +  + S++ ++L +                +  
Sbjct: 57  ATCADNGVTFIELPLAFDALSVVVNSDNDWAKSISTKELARTWGKQ-------AEGKVTT 109

Query: 155 WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA 214
           W +I  D+P+  + + VP    GT +   + +         +                  
Sbjct: 110 WRDINLDWPDRPLKLCVPGTDSGTYDYFNEAINGNKTDARSD------------------ 151

Query: 215 CTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV----- 269
                     ++   D    +  +  N D   + G ++Y+ N   LK + I G       
Sbjct: 152 ----------VQSSEDDNVLVECVASNPDAMAYFGFAYYQANRQKLKALSIIGTEGESVP 201

Query: 270 PSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPI 328
           PS+ T+  G Y P+SRPL  YV  Q   +   +R +V +++S+ +      + + G IP+
Sbjct: 202 PSVETVQDGTYKPLSRPLFIYVNDQQMRNNNEIRRFVEYTLSNGL----RFVDEAGYIPL 257

Query: 329 SNEERKSVRDSI 340
             +  + V   +
Sbjct: 258 PADTYRIVESKL 269


>gi|192360067|ref|YP_001983241.1| phosphate binding protein [Cellvibrio japonicus Ueda107]
 gi|190686232|gb|ACE83910.1| phosphate binding protein [Cellvibrio japonicus Ueda107]
          Length = 323

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 52/363 (14%), Positives = 113/363 (31%), Gaps = 61/363 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M    ++    V   + C     A                  +   GS TL     + AE
Sbjct: 1   MNAKQIIKGLVVASSLVCAAALQAAVDSKLPEYKVTTGVSGTVNSVGSDTLNNLMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
           +F +++P      ++  GSS        G    T +    SR +   E+   +       
Sbjct: 61  DFKKWYPNVNI-QIQGAGSSTAPPALTEG----TSNFGPMSRTMKAEEIQSFEAKHGYKP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFP 163
             V +  D + +  ++D     LT+  +    ++            + +W E+     + 
Sbjct: 116 TAVPVAIDVLAVYVNKDNPIKGLTIPQVDAIFSATRKCG---APKDMTRWGEVGLTGAWE 172

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
           +    IY  +   GT    +++ L +G  +                              
Sbjct: 173 KRDFTIYSRNAVSGTYGYFKEEALCKGDFK-----------------------------A 203

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV---PSMGTIVSGLY 280
           +I         +  +  + +  G+ G+ +  +    + L   +G     P     + G Y
Sbjct: 204 SINEQPGSASVVQGVSESLNGIGYSGIGYITSGVRAVPLARKEGQEFITPDAAHALDGSY 263

Query: 281 PISRPLLFYVKRQHFNSVLGLR-EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           P+SR L  Y+ +     +  L+ E++   +S +       + + G IP+     +     
Sbjct: 264 PLSRVLFVYINKHPNRPLDALQLEFLKLVLSKQGQET---VERDGYIPLPAAMAEKALAE 320

Query: 340 IAV 342
           +  
Sbjct: 321 LQK 323


>gi|127513675|ref|YP_001094872.1| phosphate binding protein [Shewanella loihica PV-4]
 gi|126638970|gb|ABO24613.1| phosphate binding protein [Shewanella loihica PV-4]
          Length = 323

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 53/359 (14%), Positives = 113/359 (31%), Gaps = 61/359 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +         + A                  +   GS TL     + AE
Sbjct: 1   MKLKQLVGAVSLTAASVFSAASMAALDPSLPTYEKTSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            + E +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  EYKEMYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEIEAFEKHYGYQP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFP 163
             + +  D + +   +D     L++E +    ++            +++W ++     + 
Sbjct: 116 TAIRVAIDALAVFVHKDNPIKGLSIEQIDGIFSATHKCGGS----DVQRWGDVGLDGSWA 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              + +Y  +   GT    +KK L +G  +                              
Sbjct: 172 AKDVQLYGRNSVSGTYGYFKKKALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +     + I  S      G YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVAIAKKGTNYIEASAANAADGSYP 262

Query: 282 ISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           +SR L  YV +  +       RE++ F +S +       + + G +P+         + 
Sbjct: 263 LSRYLYVYVNKHPNKELAPLEREFLRFVLSKQGQQ---IVMKDGYVPLPRSVTAKDLEK 318


>gi|260776659|ref|ZP_05885554.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607882|gb|EEX34147.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Vibrio coralliilyticus ATCC BAA-450]
          Length = 319

 Score =  159 bits (402), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 58/355 (16%), Positives = 110/355 (30%), Gaps = 55/355 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA----------RNRIRIAGSSTLFPYSKIIAENFSEY 50
           M+     L+            + +             +   GS TL   + +  E F + 
Sbjct: 1   MKLALTTLIVSACFSFGVQAASTSLSEYQKVPGITGSLTSVGSDTLAGMTTLWVEEFKQL 60

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
           +P      V++ GSS        G    T      SR +   E++  ++       E+ I
Sbjct: 61  YPSVN-GQVQASGSSTAPPALTEG----TAQFGPMSRPMRNREIEAFEREHGYKPTELRI 115

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFPEVRIA 168
             D I +   RD     L    L    ++ L          +  W    +   + +  + 
Sbjct: 116 AIDAIGIFVHRDNPLKGLNFTQLDNIFSATLRCGG---TQSISTWAELGLDYHWAKRSMQ 172

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +   L  G  +S                              +   
Sbjct: 173 LFGRNSVSGTYGYFKNNALCGGDFKS-----------------------------NVNEQ 203

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPISRPL 286
                 +  +    +  G+ G+ +  +   +L +     D I  S   I++G YP+SR L
Sbjct: 204 PGSASVVQSVASAINTIGYSGVGYQVSGVKLLPIAKQGEDYIEASQENILTGKYPLSRYL 263

Query: 287 LFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
             YV +          RE++ F  S +       + + G +PIS E  +S    +
Sbjct: 264 YVYVNKNPFKPLPPIEREFIRFMYSQQGQK---LVEKDGYVPISEEIARSELAKV 315


>gi|91793904|ref|YP_563555.1| phosphate binding protein [Shewanella denitrificans OS217]
 gi|91715906|gb|ABE55832.1| Phosphate binding protein [Shewanella denitrificans OS217]
          Length = 323

 Score =  159 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 54/359 (15%), Positives = 112/359 (31%), Gaps = 61/359 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +         + A                  +   GS TL     + AE
Sbjct: 1   MKLKQLVSAMTLTAVSVFSAASMASIDAALPTYEKTSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F   +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  EFKHIYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEVEAFEKHYGYQP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFP 163
             + +  D + +   +D     L++  +    +S          +   +W    +  ++ 
Sbjct: 116 TAIRVAIDALAVFVHKDNPIKGLSIAQIDSIFSSTNKCGG----DEANRWGQLGLDGNWK 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
           E  I +Y  +   GT    ++K L +G  +                              
Sbjct: 172 EKDIQLYGRNSVSGTYGYFKEKALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG--IVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       L +    G  I  +     SG YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVRALAISKKGGELIAATPENAASGTYP 262

Query: 282 ISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           +SR L  Y+ +  +       RE++ + +S +       + + G +P+         + 
Sbjct: 263 LSRYLYVYINKHPNKELSPMDREFIRYVLSKQGQQ---VVEKDGYVPLPRSVVAKDLEK 318


>gi|196248927|ref|ZP_03147627.1| phosphate binding protein [Geobacillus sp. G11MC16]
 gi|196211803|gb|EDY06562.1| phosphate binding protein [Geobacillus sp. G11MC16]
          Length = 320

 Score =  159 bits (400), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 76/367 (20%), Positives = 139/367 (37%), Gaps = 70/367 (19%)

Query: 1   MRFFFVVLMC-----FVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKI 42
           M  +  +++       +V    CG G  A                + + GSST++P ++ 
Sbjct: 1   MNKWKRLMLSGVLSGMMVFVAACGGGNKAGGNDAEGESASELSGEVIMDGSSTVYPIAEA 60

Query: 43  IAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGV 102
            AE +    P  K   V   G+  G ++F +G      D  N+SR I + E      + +
Sbjct: 61  AAEEYMAEQPNVKVS-VGMSGTGGGFEKFSKG----ESDFSNASRPIKEEEKQAAAANDI 115

Query: 103 SDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDF 162
              +         ++V+  +     LTV++L K                +KKWS+IR  +
Sbjct: 116 EFQEFQLAYDGLSVIVNKENDWVDYLTVDELKKMWTED---------GKVKKWSDIRSGW 166

Query: 163 PEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDG 222
           P+  I  + P    GT +  ++ +L+   +                              
Sbjct: 167 PDEEIQFFSPGHDSGTYDYFDEVILEGKEMVKTA-------------------------- 200

Query: 223 IAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSG 278
              ++  D    +  +E ++   G+ G ++Y  N D LK+VPID     I P+  TI +G
Sbjct: 201 ---QLSEDDNILVRGVEGDRYAIGYFGYAYYLENKDKLKIVPIDAGNGPIEPTNETIETG 257

Query: 279 LY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
            Y P+SRPL  YV  +       + +Y+ F +            + G + +  E+ K   
Sbjct: 258 KYTPLSRPLFTYVNVKSLKEKPQVYDYMEFLLETAG----DLAEEVGYVRLPEEKYKEQL 313

Query: 338 DSIAVGK 344
           +++   K
Sbjct: 314 ETLQGLK 320


>gi|254434463|ref|ZP_05047971.1| phosphate binding protein [Nitrosococcus oceani AFC27]
 gi|207090796|gb|EDZ68067.1| phosphate binding protein [Nitrosococcus oceani AFC27]
          Length = 328

 Score =  159 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 50/332 (15%), Positives = 111/332 (33%), Gaps = 46/332 (13%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
            +     +   GS TL     + AE F + +P        +G S+         + ++T 
Sbjct: 34  ASGVAGTLSSVGSDTLANLMTLWAEEFKKLYPSVNIQVQAAGSSTA-----PPALTENTA 88

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           +I   SRK+  NEL+  +         + +  D + +  ++D     +T+  +    ++ 
Sbjct: 89  NIGPMSRKMKGNELEAFENKYGYKPTPIRVAIDALAVYVNKDNPIEKITLPQIDAIFSAT 148

Query: 141 LIVDDKVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                      ++ W    +  ++   RI ++  +   GT    +K  L +G  ++    
Sbjct: 149 RKCG---YPEDIRTWGDLGLGGEWVHRRIQLFGRNSVSGTYGYFKKAALCKGDFKNT--- 202

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
                                     +         +  +  + +  G+ G+ +  +   
Sbjct: 203 --------------------------VNEQPGSASVVQGVTKSINGIGYSGIGYQTSGVR 236

Query: 259 VLKLVPIDG---IVPSMGTIVSGLYPISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMM 314
            L L    G   +  +    V G YP++R L  YV +  +   +   +E++   +S    
Sbjct: 237 ALPLATKTGAPSVEATAENAVKGQYPLTRFLYVYVNKHPNKPLLPLEQEFIKMVLSKAGQ 296

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                + + G IP+           I V + G
Sbjct: 297 ---RVVIKDGYIPLPARIVAKDLAKIGVKELG 325


>gi|237808811|ref|YP_002893251.1| phosphate binding protein [Tolumonas auensis DSM 9187]
 gi|237501072|gb|ACQ93665.1| phosphate binding protein [Tolumonas auensis DSM 9187]
          Length = 324

 Score =  159 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 49/358 (13%), Positives = 113/358 (31%), Gaps = 58/358 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------------RIRIAGSSTLFPYSKIIA 44
           M+   VV +          + ++A                   +   GS TL     + A
Sbjct: 1   MKLNKVVSVVGFAAATLVASQSWASGVDQALPEYQKVSGISGNLSSVGSDTLANMMTLWA 60

Query: 45  ENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD 104
           E +   +P      +++ GSS        G    T      SRK+ + E++  +K     
Sbjct: 61  EEYKRLYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKEGEIEAFEKRYGYK 115

Query: 105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPE 164
              V +  D + + + +D     +T+  L +  +S +                +  ++  
Sbjct: 116 PTAVPVAIDALAVFAHKDNPIKGMTMLQLDETFSSTMKCGGTQTTTNWGD-LGLTGEWAG 174

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
             I ++  +   GT    ++  L +G  ++                              
Sbjct: 175 KDIQLFGRNSVSGTYGYFKEHALCKGDFKNT----------------------------- 205

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI---VPSMGTIVSGLYP 281
           +         +  +  + +  G+ G+ +  +    + L    G      +    ++G YP
Sbjct: 206 VNEQPGSASVVQSVAASLNGLGYSGIGYKTSGVKAVPLSKDGGKTFVEATEDNAINGTYP 265

Query: 282 ISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRD 338
           +SR L  YV +          +E++   +S       + + + G IP+  +  +   +
Sbjct: 266 LSRYLFVYVNKAPNKPLDPMQKEFLKMMLSKTGQ---NIVEKDGYIPLPAKVVEKQLE 320


>gi|157376433|ref|YP_001475033.1| phosphate binding protein [Shewanella sediminis HAW-EB3]
 gi|157318807|gb|ABV37905.1| phosphate binding protein [Shewanella sediminis HAW-EB3]
          Length = 323

 Score =  159 bits (400), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 54/357 (15%), Positives = 110/357 (30%), Gaps = 57/357 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V              + A                  +   GS TL     + AE
Sbjct: 1   MKLKQLVSAVSFTAASVFSAASMAAIDQSLPVYEKSSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F E +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  EFKEMYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEVEAFEKHYGYQP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEV 165
             + +  D + +   +D     L++E +    ++        V         +   +   
Sbjct: 116 TAIRVAIDALAVFVHKDNPIKGLSIEQIDNIFSATHKCGGSDV--KRWGDLGLEGGWSAR 173

Query: 166 RIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI 225
            + +Y  +   GT    +KK L +G  +                               +
Sbjct: 174 DVQLYGRNSVSGTYGYFKKKALCKGDFK-----------------------------ANV 204

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPIS 283
                    +  +  + +  G+ G+ +       + +       I  +     SG YP+S
Sbjct: 205 NEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVAISKKGTKFIEATAANAASGTYPLS 264

Query: 284 RPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           R L  YV +  + +     RE++ F++S +       + + G +P+         + 
Sbjct: 265 RYLYVYVNKHPNKDLAPMDREFLKFALSKQGQQ---IVEKDGYVPLPRSVTAKDLEK 318


>gi|88858375|ref|ZP_01133017.1| putative phosphate ABC transporter [Pseudoalteromonas tunicata D2]
 gi|88819992|gb|EAR29805.1| putative phosphate ABC transporter [Pseudoalteromonas tunicata D2]
          Length = 322

 Score =  159 bits (400), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 55/359 (15%), Positives = 117/359 (32%), Gaps = 59/359 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNR----------IRI----AGSSTLFPYSKIIAEN 46
           M+F  +V      +     T   A  +          I       GS TL       AE 
Sbjct: 1   MKFKNIVAAMGFAVTTLVTTQASAIEQALPEYTKVSGISGNFSSVGSDTLANMMTFWAEE 60

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           +   +P      +++ GSS        G    T +    SRK+   E++  +K       
Sbjct: 61  YKRQYPNVNI-QIQAAGSSTAPPALTEG----TANFGPMSRKMKSKEIEAFEKRFGYKPT 115

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFPE 164
           E+ +  D + +   +D     L ++ +    +S            + +WS++    ++  
Sbjct: 116 EIRVAIDALAVFVHKDNPIEGLRIDQVDAIFSSTRKCG---ADKEVTRWSDVGLTGEWAT 172

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
             + +Y  +   GT    + K L +G  R                               
Sbjct: 173 KDVQLYGRNSVSGTYGYFKDKALCKGDFR-----------------------------NN 203

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPI 282
           +         +  I  + +  G+ G+ +  +    + L     + +  ++  + SG YP+
Sbjct: 204 VNEQPGSASVVQSISSSVNAIGYSGIGYKTSGVRTVPLAKKGNNFVDATIDNVASGQYPL 263

Query: 283 SRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           SR L  YV +  + +      E++   +S         + + G +P+S +  +     +
Sbjct: 264 SRFLYVYVNKHPNKDLSPIETEFLKMVLSKMGQ---EIVEKDGYVPLSAKLVEQELTKL 319


>gi|197335355|ref|YP_002156817.1| phosphate-binding protein [Vibrio fischeri MJ11]
 gi|197316845|gb|ACH66292.1| phosphate-binding protein [Vibrio fischeri MJ11]
          Length = 312

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 52/319 (16%), Positives = 105/319 (32%), Gaps = 41/319 (12%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE+F   +P        SG S+         + + T     
Sbjct: 29  SGNLSSIGSDTLANMMTLWAEDFQRIYPRVHIQIQASGSSTAAP-----ALIESTAQFGP 83

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+ Q+E    ++       E+ +  D + +   +D     L    L    ++ L   
Sbjct: 84  MSRKMRQSEKAAFERQFGYPPTEIRVAIDALGIFVHQDNPVKGLNFTQLDAIFSATLRCG 143

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                N  +    +   + + RI ++  +   GT    +   L  G  +           
Sbjct: 144 ALKSINRWQD-LGVHTSWAKHRIQLFGRNSVSGTYGYFKNNALCNGDFK----------- 191

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                             + +         +  I  + +  G+ G+ +  +   +L +  
Sbjct: 192 ------------------VNVNEQPGSASVVQGISASLNGIGYSGVGYQMSGVKLLPISK 233

Query: 265 I--DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL-REYVSFSVSDEMMAPDSQLF 321
           I  D I P+   I++G YP++R L  Y+ +     +  L  E++ + +S E       + 
Sbjct: 234 IGTDYIEPTTDNIINGQYPLARFLYIYINKPPTAKLPPLDAEFIRYMLSREGQDR---VE 290

Query: 322 QYGLIPISNEERKSVRDSI 340
           Q G I +           +
Sbjct: 291 QDGYIALPERFVLQELSKL 309


>gi|332535569|ref|ZP_08411342.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Pseudoalteromonas haloplanktis ANT/505]
 gi|332035026|gb|EGI71545.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Pseudoalteromonas haloplanktis ANT/505]
          Length = 322

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 55/357 (15%), Positives = 117/357 (32%), Gaps = 55/357 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNR-------IRIA-------GSSTLFPYSKIIAEN 46
           M+F  +V    V +  +      A ++       I          GS TL       AE 
Sbjct: 1   MKFKNLVAAMGVAVTTFVSAQAVALDQNIPEYQKISGVSGNFSSVGSDTLANMMTFWAEE 60

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           +   +P      +++ GSS        G    T ++   SRK+   E++  +K       
Sbjct: 61  YKRIYPNVNI-QIQAAGSSTAPPALTEG----TANLGPMSRKMKSKEIEAFEKRYGYKPT 115

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
           EV +  D + +   +D     L ++ +    +S          N       +  D+    
Sbjct: 116 EVRVAIDALAVFVHKDNPIEGLRIDQVDAIFSSTRKCGAPEQVNRWSD-VGLTGDWAAKD 174

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           + +Y  +   GT    +KK L +G  R                               + 
Sbjct: 175 VQLYGRNSVSGTYGYFKKKALCKGDFR-----------------------------NNVN 205

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISR 284
                   +  I  + +  G+ G+ +  +    + L     + +  ++  +  G YP+SR
Sbjct: 206 EQPGSASVVQSISSSLNAIGYSGIGYKTSGVRTVPLAKKGDNFVDATLDNVAQGKYPLSR 265

Query: 285 PLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            L  YV +  +        +++   +S +       + + G +P+S +  ++    +
Sbjct: 266 FLYLYVNKHPNKPLSPMEAQFLKMVLSKDGQQ---IVEKDGYVPLSAKLVETELKKL 319


>gi|33469603|gb|AAQ19844.1| phosphate-binding protein [Alcaligenes faecalis]
          Length = 330

 Score =  158 bits (399), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 69/326 (21%), Positives = 136/326 (41%), Gaps = 48/326 (14%)

Query: 27  RIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSS 86
            + I GSST+FP S+ +AE F           V   G+  G K+FCRG     +DI  +S
Sbjct: 29  TVLIDGSSTVFPISEAVAEEFQNAQKGKTRVTVGVSGTGGGFKKFCRG----ELDITGAS 84

Query: 87  RKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDK 146
           R I + E++ CK++GV  I+   +      +++ ++  +  L+V +L K           
Sbjct: 85  RPIKKEEMELCKQNGVEFIEMPIVIDALATIINPQNNWAECLSVAELKKMWEPE------ 138

Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206
                +  W++I   FP+  + ++      GT +     ++ +      +F+        
Sbjct: 139 -AQGKITNWNQINSKFPDAPLVLFGAGTDSGTYDYYTFAIVGKEHSSRGDFTAT------ 191

Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI- 265
                                  D   ++  +  +K+  GF+GL++Y +N D +K V I 
Sbjct: 192 ----------------------EDDNVSVQGVARDKNAIGFLGLAYYDHNKDKIKPVAIR 229

Query: 266 ----DGIVPSMGTIVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
                 ++PS+ T V G Y P++RP+ +YV +   +    + +++ F+   +       +
Sbjct: 230 QADGSCVLPSVETAVDGTYQPLTRPIFYYVDKSKADK-KHVADFIHFAFDPKNQQE--LI 286

Query: 321 FQYGLIPISNEERKSVRDSIAVGKSG 346
            + G + +  E   +        K+G
Sbjct: 287 SEVGYVSLPAEIANAATKKFDSRKTG 312


>gi|294139923|ref|YP_003555901.1| phosphate-binding protein [Shewanella violacea DSS12]
 gi|293326392|dbj|BAJ01123.1| phosphate-binding protein [Shewanella violacea DSS12]
          Length = 323

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 52/357 (14%), Positives = 110/357 (30%), Gaps = 57/357 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   ++    +         + A                  +   GS TL     + AE
Sbjct: 1   MKLKQLIGAVSLTAASVFSAASIAAIDPSLPNYEKTSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F E +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  EFKEIYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEIEAFEKHYGYQP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEV 165
             + +  D + +   +D     L+++ +    ++        V         +   +   
Sbjct: 116 TAIRVAIDALAVFVHKDNPIKGLSIQQIDDIFSATHKCGGSDV--KRWGDLGLESSWAAR 173

Query: 166 RIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI 225
            + +Y  +   GT    +KK L +G  +                               +
Sbjct: 174 DVQLYGRNSVSGTYGYFKKKALCKGDFK-----------------------------ANV 204

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPIS 283
                    +  +  + +  G+ G+ +       + +       I  +     SG YP+S
Sbjct: 205 NEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVRAVAIAKKGTKYIEANAANAASGTYPLS 264

Query: 284 RPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           R L  YV +  + +     RE++ F++S +       + + G +P+           
Sbjct: 265 RYLYVYVNKHPNKDLSPMDREFLKFALSKQGQQ---IVEKDGYVPLPRSVTAKDLAK 318


>gi|317052741|ref|YP_004113857.1| phosphate-binding protein [Desulfurispirillum indicum S5]
 gi|316947825|gb|ADU67301.1| phosphate binding protein [Desulfurispirillum indicum S5]
          Length = 326

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 51/357 (14%), Positives = 112/357 (31%), Gaps = 57/357 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGT-----------FARNRIRIAGSSTLFPYSKIIAENFSE 49
           M+    +L+   VL V                      +   GS TL     + AE F  
Sbjct: 7   MKGLATLLVSASVLAVTATADVDPKLPTYKETRGVSGNLSSIGSDTLNNLMTLWAEEFQG 66

Query: 50  YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVT 109
           ++P      ++  G+S        G    T +    SR +   E    ++        V 
Sbjct: 67  FYPNVNI-QIQGAGTSTAPPALTEG----TSNFGPMSRGMRDTEKAAFEQRHGYPPVLVP 121

Query: 110 IGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFPEVRI 167
           +  D + +  ++D     L++  +    +S        + N + +W ++     +    I
Sbjct: 122 VAIDMVAVFVNKDNPIQGLSIPQIDAIFSSTRRCG---LGNDINRWGQVGLTGAWANRDI 178

Query: 168 AIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEV 227
            +Y  +   GT     +  + +G  +                              +I  
Sbjct: 179 TLYSRNAVSGTYGFFRQHAMCDGDFK-----------------------------DSINE 209

Query: 228 DGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG---IVPSMGTIVSGLYPISR 284
               +  +  +  + +  G+ G+ +  +   V+ L    G      +     SG YP++R
Sbjct: 210 QPGSSSVVQGVTESLNGIGYSGIGYRTSGVRVVPLAREHGGKFAEATAENAASGDYPLAR 269

Query: 285 PLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            L   V +  +       RE++   +S +       + + G +P+       +R  +
Sbjct: 270 YLYLAVNKHPNRPLPPMEREFLKMVLSKQGQ---DVVNRDGFVPLPESVAGKIRKDL 323


>gi|26992005|ref|NP_747430.1| phosphate ABC transporter phosphate-binding protein [Pseudomonas
           putida KT2440]
 gi|24987138|gb|AAN70894.1|AE016733_6 phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pseudomonas putida KT2440]
          Length = 332

 Score =  158 bits (398), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 49/326 (15%), Positives = 102/326 (31%), Gaps = 42/326 (12%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE + + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAEAYKKEYPNVNI-QIQAAGSSTAPPALTEG----TANLGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   EL   ++        + +  D + +   +D     LT+  +    +S  +  
Sbjct: 95  MSRKMKDVELQAFEQKYGYKPTAIPVAVDALAVFVHKDNPIKGLTMAQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K           +  D     I ++  +   GT    +++ L +G  +           
Sbjct: 155 GKADIKTWGD-VGVTGDLANKPIQLFGRNSVSGTYGYFKEEALCKGDFK----------- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I  + +  G+ G+ +   +   + L  
Sbjct: 203 ------------------PNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVPLAK 244

Query: 265 IDGIVPSMGTIV---SGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQL 320
            +G            +G YP+SR L  YV +           E+V   +S         +
Sbjct: 245 KEGGEFVEDNEANALNGTYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSQAGQQ---VV 301

Query: 321 FQYGLIPISNEERKSVRDSIAVGKSG 346
            + G IP+  +        + +  +G
Sbjct: 302 VKDGYIPLPAKVVDKTLADLGLSHTG 327


>gi|330952434|gb|EGH52694.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae Cit 7]
          Length = 332

 Score =  158 bits (398), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 49/362 (13%), Positives = 110/362 (30%), Gaps = 55/362 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L           T                    +   GS TL     + AE + 
Sbjct: 4   KRLMTALTLVAAGVTAANTLAAVDPAIQAYTRTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           L  YV +           E+V   +S +       + + G IP+     +     + +  
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADLGLQG 325

Query: 345 SG 346
           +G
Sbjct: 326 AG 327


>gi|254506691|ref|ZP_05118831.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           parahaemolyticus 16]
 gi|219550272|gb|EED27257.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           parahaemolyticus 16]
          Length = 318

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 59/352 (16%), Positives = 111/352 (31%), Gaps = 52/352 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA-------RNRIRIAGSSTLFPYSKIIAENFSEYFPE 53
           M+     ++  V+                     +   GS TL   + +  E F + +P 
Sbjct: 1   MKLVLTTILSSVLALSAHAAELSEYTKVPGVTGTLTSVGSDTLAGMTTLWVEEFKQQYPS 60

Query: 54  FKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHD 113
                V++ GSS             T      SR +   E++  ++       E+ +  D
Sbjct: 61  VY-GQVQASGSSTAPPALTE----RTAQFGPMSRPMRNREIEAFERAHGYKPTELRVAID 115

Query: 114 GILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFPEVRIAIYV 171
            I +   RD     L    L    ++ L         P++ W    +   + +  I ++ 
Sbjct: 116 AIGIFVHRDNPIKGLNFSQLDSIFSATLRCGANA---PVETWSELGLDYQWAKRSIQLFG 172

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
            +   GT    +   L  G  +                              ++      
Sbjct: 173 RNSVSGTYGYFKNNALCGGDFK-----------------------------NSVNEQPGS 203

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISRPLLFY 289
              +  +    +  G+ G+ +  +   +L +     D I  S   I+SG YP+SR L  Y
Sbjct: 204 ASVVQSVASAINTIGYSGVGYQVSGVKLLPVAKNGADYIQASQENILSGKYPLSRYLYVY 263

Query: 290 VKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           V +          RE++ F  S +  A    + + G IPIS E  +     +
Sbjct: 264 VNKHPSKPLSPIEREFIRFIFSVQGQA---LVKKDGYIPISAELAEQELKKV 312


>gi|78484889|ref|YP_390814.1| phosphate binding protein [Thiomicrospira crunogena XCL-2]
 gi|78363175|gb|ABB41140.1| ATP-binding cassette (ABC) superfamily phosphate transporter,
           substrate-binding component [Thiomicrospira crunogena
           XCL-2]
          Length = 322

 Score =  157 bits (397), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/360 (14%), Positives = 114/360 (31%), Gaps = 56/360 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN--------------RIRIAGSSTLFPYSKIIAEN 46
           M+   ++ M      V         +               +   GS TL     + AE 
Sbjct: 1   MKRNLLIAMGLAAAVVSNPVFAAGVDSNIPDYKKVSGVSGNLSSVGSDTLANLMTLWAEE 60

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           F   +P        +G S+         + + T +I   SRK+   E    +K       
Sbjct: 61  FKRTYPNVNIQIQAAGSSTA-----PPALTESTSNIGPMSRKMKSKETAMFEKKHGYKPT 115

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
            + +  D + +  ++D     LT+  +    +S      K       +      D+    
Sbjct: 116 AIGVAIDALAVYVNKDNPIKGLTIPQVDAIFSSTRKCGSKEAITTWGQAGLTG-DWKNKS 174

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           + +Y  +   GT    +KK L +G  +S                             ++ 
Sbjct: 175 VQLYGRNSVSGTYGYFKKKALCKGDYKS-----------------------------SVN 205

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG---IVPSMGTIVSGLYPIS 283
                   +  +  + +  G+ G+ +       + L   +G   +  +    ++G YP++
Sbjct: 206 EQPGSASVVQSVSSSLNGIGYSGIGYKTAGVKAVPLTKKEGSPFVEATPDNALTGKYPLA 265

Query: 284 RPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           R L  YV +         ++E+++  +S +       + + G IP+  +  +  R  +  
Sbjct: 266 RVLYVYVNKAPNKPLEPVVKEFLNLVLSQKGQQD---VVKDGYIPLPAKMVEKYRAVVNK 322


>gi|327392938|dbj|BAK10360.1| protein SphX precursor [Pantoea ananatis AJ13355]
          Length = 306

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 52/329 (15%), Positives = 105/329 (31%), Gaps = 40/329 (12%)

Query: 15  EVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRG 74
            +           +  AGS TL     +  ++FS   P      V++ GSS        G
Sbjct: 14  ALVQAQPVMLSGNLSSAGSDTLGYLMTLWGDDFSRQSPGVNV-QVQASGSSTAPTALTAG 72

Query: 75  IGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLY 134
               T+ +   SR +  +E    +         V +  D +++V ++     S+    L 
Sbjct: 73  ----TVQLGAMSRPMQADERQAFEARYGYPPLAVPVAMDALVVVVNQRNPLTSIDPNQLD 128

Query: 135 KALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
              +   +     V          + ++ +  I  Y  +   GT    +++ L +G  R+
Sbjct: 129 ALFSVTRLCGAHQVPERWGDLGLHQAEWQQRSIQRYGRNSASGTWGFFKQQALCQGDFRN 188

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
                                         +         +  +  +    G+    F+ 
Sbjct: 189 D-----------------------------VAEFPGSAAVVQAVAGDPRSIGYASFGFHL 219

Query: 255 NNADVLKLVPIDGI--VPSMGTIVSGLYPISRPLLFYVKR-QHFNSVLGLREYVSFSVSD 311
           +   +L ++   G    P   +I SG YP +RPL  YV +         L  ++   +S 
Sbjct: 220 SGVKLLPVITKRGEAVAPDPESIRSGRYPWARPLYLYVNKVPDKPLPPLLAAFLEQVLSS 279

Query: 312 EMMAPDSQLFQYGLIPISNEERKSVRDSI 340
                   + + G +P+S  +    R S+
Sbjct: 280 AGQQR---VIEAGYLPLSETQMNLARASL 305


>gi|315127523|ref|YP_004069526.1| phosphate ABC transporter [Pseudoalteromonas sp. SM9913]
 gi|315016037|gb|ADT69375.1| phosphate ABC transporter [Pseudoalteromonas sp. SM9913]
          Length = 322

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 54/357 (15%), Positives = 112/357 (31%), Gaps = 55/357 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA--------------RNRIRIAGSSTLFPYSKIIAEN 46
           M+F  +V    V +  +      A                     GS TL       AE 
Sbjct: 1   MKFKNLVAAMGVAVTTFVSAQAVALEDGMPEYQKISGVSGNFSSVGSDTLANMMTFWAEE 60

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           +   +P      +++ GSS        G    T ++   SR +   E++  +K       
Sbjct: 61  YKRIYPNVNI-QIQAAGSSTAPPALTEG----TANLGPMSRAMKSKEIEAFEKRYGYKPT 115

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
           +V +  D + +   +D     L ++ +    +S          N       +  D+    
Sbjct: 116 QVRVAIDALAVFVHKDNPIEGLRIDQIDAIFSSTRKCGAPEQVNRWSD-VGLEGDWAAKD 174

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           + +Y  +   GT    +KK L +G  R                               + 
Sbjct: 175 VQLYGRNSVSGTYGYFKKKALCKGDFR-----------------------------NNVN 205

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISR 284
                   +  I  + +  G+ G+ +  +    + L     + +  ++  +  G YP+SR
Sbjct: 206 EQPGSASVVQSISASLNAIGYSGIGYKTSGVRTVPLSKKGTNFVDATLENVAQGKYPLSR 265

Query: 285 PLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            L  YV +  +        E++   +S E       + + G +P+S +  +     +
Sbjct: 266 FLYVYVNKHPNKPLGPVEAEFLKMVLSQEGQK---IVEKDGYVPLSAKLVEVELKKL 319


>gi|170727787|ref|YP_001761813.1| phosphate-binding protein [Shewanella woodyi ATCC 51908]
 gi|169813134|gb|ACA87718.1| phosphate binding protein [Shewanella woodyi ATCC 51908]
          Length = 323

 Score =  157 bits (396), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 55/359 (15%), Positives = 114/359 (31%), Gaps = 61/359 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +         + A                  +   GS TL     + AE
Sbjct: 1   MKLKQLVGAVSLTAASVFSATSMAAIDQSLPVYEKSSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
            F E +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  EFKEMYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEMEAFEKHYGYQP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFP 163
             + +  D + +   +D     L++E +    ++            +K+W ++     + 
Sbjct: 116 TAIRVAIDALAVFVHKDNPIEGLSIEQIDDIFSATHKCGGS----DVKRWGDVGLTGSWS 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              + +Y  +   GT    +KK L +G  +                              
Sbjct: 172 AKDVQLYGRNSVSGTYGYFKKKALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +       I  +     SG YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVAISKKGTKYIEATAANAASGTYP 262

Query: 282 ISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           +SR L  YV +  + +     RE++ F++S +       + + G +P+           
Sbjct: 263 LSRYLYVYVNKHPNKDLAPMDREFLKFALSKQGQQ---IVEKDGYVPLPRSVTAKDLAK 318


>gi|148550437|ref|YP_001270539.1| phosphate binding protein [Pseudomonas putida F1]
 gi|148514495|gb|ABQ81355.1| phosphate binding protein [Pseudomonas putida F1]
          Length = 332

 Score =  157 bits (396), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/320 (15%), Positives = 99/320 (30%), Gaps = 42/320 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE + + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAEAYKKEYPNVNI-QIQAAGSSTAPPALTEG----TANLGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   EL   ++        + +  D + +   +D     LT+  +    +S  +  
Sbjct: 95  MSRKMKDVELQAFEQKYGYKPTAIPVAVDALAVFVHKDNPIKGLTMAQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K           +  D     I ++  +   GT    +++ L +G  +           
Sbjct: 155 GKAEIKTWGD-VGVTGDLANKPIQLFGRNSVSGTYGYFKEEALCKGDFK----------- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I  + +  G+ G+ +   +   + L  
Sbjct: 203 ------------------PNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVPLAK 244

Query: 265 IDGIVPSMGTIV---SGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQL 320
            DG            +G YP+SR L  YV +           E+V   +S         +
Sbjct: 245 KDGGEFVEDNEANALNGTYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSQAGQQ---VV 301

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G IP+  +        +
Sbjct: 302 VKDGYIPLPAKVVDKTLADL 321


>gi|313501302|gb|ADR62668.1| Phosphate binding protein [Pseudomonas putida BIRD-1]
          Length = 333

 Score =  157 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 49/320 (15%), Positives = 99/320 (30%), Gaps = 42/320 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE + + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAEAYKKEYPNVNI-QIQAAGSSTAPPALTEG----TANLGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   EL   ++        + +  D + +   +D     LT+  +    +S  +  
Sbjct: 95  MSRKMKDVELQAFEQKYGYKPTAIPVAVDALAVFVHKDNPIKGLTMAQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K           +  D     I ++  +   GT    +++ L +G  +           
Sbjct: 155 GKAEIKTWGD-IGVTGDLANKPIQLFGRNSVSGTYGYFKEEALCKGDFK----------- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I  + +  G+ G+ +   +   + L  
Sbjct: 203 ------------------PNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVPLAK 244

Query: 265 IDGIVPSMGTIV---SGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQL 320
            DG            +G YP+SR L  YV +           E+V   +S         +
Sbjct: 245 KDGGEFVEDNEANALNGTYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSQAGQQ---VV 301

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G IP+  +        +
Sbjct: 302 VKDGYIPLPAKVVDKTLADL 321


>gi|218458177|ref|ZP_03498268.1| phosphate ABC transporter, periplasmic binding protein [Rhizobium
           etli Kim 5]
          Length = 261

 Score =  157 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 85/242 (35%), Positives = 131/242 (54%), Gaps = 6/242 (2%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
           R++I+I GSST+FPY++ +AE F+        P VES G+  G K FC G+G D  DI  
Sbjct: 24  RDQIKIVGSSTVFPYTQAVAEEFANK-SGKAAPVVESTGTGGGFKAFCGGVGPDFADITG 82

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMV-SVSLTVEDLYKALASYLIV 143
           +SR I  +E+  C  +GV+DI E  IG+DG+ +   R+     +LT   +++ALA+ L  
Sbjct: 83  ASRAIKDSEVKLCAGNGVTDITEALIGYDGLSIAVSRNNKTEWNLTKAQIFQALAAQLPD 142

Query: 144 D-DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
               +V NP KKWS+I    P+V I  + P    GTR+   + V+  GC ++     ++ 
Sbjct: 143 GKGGLVANPNKKWSDIDKSLPDVNITAFGPPPTSGTRDAFVELVMHPGCEKTAGMDAVK- 201

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
             K + ++ + AC  +RQDG  IE   +    + R+E + +  G  G SF   N D LK 
Sbjct: 202 --KADEKKYTEACARMRQDGPFIEAGENDNLIVQRLESDPNSVGIFGYSFLYENEDKLKD 259

Query: 263 VP 264
           + 
Sbjct: 260 IK 261


>gi|323464357|gb|ADX76510.1| phosphate binding protein [Staphylococcus pseudintermedius ED99]
          Length = 319

 Score =  157 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 69/362 (19%), Positives = 137/362 (37%), Gaps = 69/362 (19%)

Query: 1   MRFFFVV---LMCFVVLEVYCGTGTFAR------------NRIRIAGSSTLFPYSKIIAE 45
           M+ +  +   L+   ++   CG  +                 ++  GSST+ P  + + E
Sbjct: 1   MKRWQTLGGTLIGVSLVLGACGGASQQSSDQGDTKSSNVEGTVKGNGSSTVAPIIEKLNE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
           +FS    +     V S G+  G K+F  G      D  N+SR I   E ++ +  G+   
Sbjct: 61  DFSSSHDKATVENVTS-GTGDGFKQFIAG----KTDFSNASRPIKDEEKEQLEDKGIDYT 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEV 165
           +         + V+  +     +++EDL K           +     KKWS++  D+P+ 
Sbjct: 116 EFKVARDGLTIAVNKDNDFLKEISLEDLKK-----------IYSGEAKKWSDVDSDYPDK 164

Query: 166 RIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI 225
            I  + P   HGT +   ++V+ +  +++                               
Sbjct: 165 PIKAFSPDQSHGTYDFFTEEVMDDVDIQAEK----------------------------- 195

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV-----PSMGTIVSGLY 280
             + +    +  ++ NK+  GF   +FYK N + LK V + G       P+  +I  G Y
Sbjct: 196 --NQNTDVIVKSVQDNKEGIGFFAYNFYKENENSLKAVKVKGDDGKAIGPNQKSIQDGSY 253

Query: 281 PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           P+SRPL  Y   +   S     E++ F++ ++  A +        + +  ++  +    +
Sbjct: 254 PLSRPLFIYANNKKLKSNDVFAEFMKFTLENKGKAAE--AKGVDYVALPEKDYDAQLKKL 311

Query: 341 AV 342
             
Sbjct: 312 EK 313


>gi|319892604|ref|YP_004149479.1| Phosphate ABC transporter, periplasmic phosphate- binding protein
           PstS [Staphylococcus pseudintermedius HKU10-03]
 gi|317162300|gb|ADV05843.1| Phosphate ABC transporter, periplasmic phosphate- binding protein
           PstS [Staphylococcus pseudintermedius HKU10-03]
          Length = 319

 Score =  157 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 70/362 (19%), Positives = 137/362 (37%), Gaps = 69/362 (19%)

Query: 1   MRFFFVV---LMCFVVLEVYCGTGTFAR------------NRIRIAGSSTLFPYSKIIAE 45
           M+ +  +   L+   ++   CG  +                 ++  GSST+ P  + + E
Sbjct: 1   MKRWQTLGGTLIGVSLVLGACGGASQQSSDQGDTKSSNVEGTVKGNGSSTVAPIIEKLNE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
           +FS    +     V S G+  G K+F  G      D  N+SR I   E ++ K  G+   
Sbjct: 61  DFSSSHDKATVENVTS-GTGDGFKQFIAG----KTDFSNASRPIKDEEKEQLKDKGIDYT 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEV 165
           +         + V+  +     +++EDL K           +     KKWS++  D+P+ 
Sbjct: 116 EFKVARDGLTIAVNKDNDFLKEISLEDLKK-----------IYSGEAKKWSDVDSDYPDK 164

Query: 166 RIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI 225
            I  + P   HGT +   ++V+ +  +++                               
Sbjct: 165 PIKAFSPDQSHGTYDFFTEEVMDDVDIQAEK----------------------------- 195

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV-----PSMGTIVSGLY 280
             + +    +  ++ NK+  GF   +FYK N + LK V + G       P+  +I  G Y
Sbjct: 196 --NQNTDVIVKSVQDNKEGIGFFAYNFYKENENSLKAVKVKGDDGKAIGPNQKSIQDGSY 253

Query: 281 PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           P+SRPL  Y   +   S     E++ F++ ++  A +        + +  ++  +    +
Sbjct: 254 PLSRPLFIYANNKKLKSNDVFAEFMKFTLENKGKAAE--AKGVDYVALPEKDYDAQLKKL 311

Query: 341 AV 342
             
Sbjct: 312 EK 313


>gi|119468898|ref|ZP_01611923.1| putative phosphate ABC transporter [Alteromonadales bacterium TW-7]
 gi|119447550|gb|EAW28817.1| putative phosphate ABC transporter [Alteromonadales bacterium TW-7]
          Length = 322

 Score =  157 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 54/357 (15%), Positives = 113/357 (31%), Gaps = 55/357 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNR-------IRIA-------GSSTLFPYSKIIAEN 46
           M+F  +V    V +  +      A ++       I          GS TL       AE 
Sbjct: 1   MKFKNLVAAMGVAVTTFVSAQAVALDQDIPEYQKISGVSGNFSSVGSDTLANMMTFWAEE 60

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           +   +P      +++ GSS        G    T ++   SR +   E++  +K       
Sbjct: 61  YKRIYPNVNI-QIQAAGSSTAPPALTEG----TANLGPMSRAMKSKEIEAFEKRYGYKPT 115

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
            V +  D + +   +D     L ++ +    +S          N       +   +    
Sbjct: 116 AVRVAIDALAVYVHKDNPIEGLRIDQVDAIFSSTRKCGASEQVNRWSD-VGLEGSWAARD 174

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           I +Y  +   GT    +KK L +G  R                               + 
Sbjct: 175 IQLYGRNSVSGTYGYFKKKALCKGDFR-----------------------------NNVN 205

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISR 284
                   +  I  + +  G+ G+ +  +    + L     + +  ++  +  G YP+SR
Sbjct: 206 EQPGSASVVQSISSSLNAIGYSGIGYKTSGVRTVPLSKKGTNFVDATLDNVAQGKYPLSR 265

Query: 285 PLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            L  YV +  +        E++   +S +       + + G +P+S +  +     +
Sbjct: 266 FLYVYVNKHPNKALSPMEAEFLKMILSKDGQQ---IVEKDGYVPLSAKLVEVELKKL 319


>gi|308050507|ref|YP_003914073.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Ferrimonas balearica DSM 9799]
 gi|307632697|gb|ADN76999.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Ferrimonas balearica DSM 9799]
          Length = 323

 Score =  157 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 54/321 (16%), Positives = 107/321 (33%), Gaps = 46/321 (14%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE F + +P    P +++ GSS        G    T     
Sbjct: 40  SGNLSSVGSDTLANMMTLWAEEFRKQYPNIN-PQIQAAGSSTAPPALTEG----TSQFGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+  NE +   K        + +  D + + + +D     LT+E +    +S L   
Sbjct: 95  MSRKMKPNEEEAFVKRYGYKPTAIRVAIDALAVFAHKDNPIQGLTIEQVDGIFSSTLKCG 154

Query: 145 DKVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
                + +++W    +   +    I +Y  +   GT    +KK L +G  +         
Sbjct: 155 G----DAVRRWGDLGLTGSWANRDIQLYGRNSVSGTYGYFKKKALCKGDFK--------- 201

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                 +         +  +  + +  G+ G+ +       + L
Sbjct: 202 --------------------PNVNEQPGSASVVQSVSTSLNAIGYSGIGYKTAGVRAVPL 241

Query: 263 VP--IDGIVPSMGTIVSGLYPISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQ 319
                D +  +     +G YP+SR L  YV +  +      + E+V F +S +       
Sbjct: 242 AKSGSDFVEATAANAANGQYPLSRYLYVYVNKHPNRPLDPMVAEFVKFMLSRQGQ---MV 298

Query: 320 LFQYGLIPISNEERKSVRDSI 340
           + + G +P+           +
Sbjct: 299 VEKDGYVPLPRAVIAKDLAQL 319


>gi|167036362|ref|YP_001671593.1| phosphate binding protein [Pseudomonas putida GB-1]
 gi|166862850|gb|ABZ01258.1| phosphate binding protein [Pseudomonas putida GB-1]
          Length = 332

 Score =  157 bits (395), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 48/320 (15%), Positives = 100/320 (31%), Gaps = 42/320 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE + + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAEAYKKEYPNVNI-QIQAAGSSTAPPALTEG----TANLGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   EL   ++        + +  D + +   +D     LT+  +    +S  +  
Sbjct: 95  MSRKMKDVELQAFEQKYGYKPTAIPVAVDALAVFVHKDNPIKGLTMAQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K           +  D     I ++  +   GT    +++ L +G  +           
Sbjct: 155 GKAEIKTWGD-VGVTGDLANKPIQLFGRNSVSGTYGYFKEEALCKGDFK----------- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I  + +  G+ G+ +   +   + L  
Sbjct: 203 ------------------PNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVALAK 244

Query: 265 IDGIVPSMG---TIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQL 320
            +G           ++G YP+SR L  YV +           E+V   +S         +
Sbjct: 245 KEGGEFVEDNETNALNGSYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSQAGQQ---VV 301

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G IP+  +        +
Sbjct: 302 VKDGYIPLPAKVVDKTLADL 321


>gi|77359553|ref|YP_339128.1| phosphate ABC transporter [Pseudoalteromonas haloplanktis TAC125]
 gi|76874464|emb|CAI85685.1| putative phosphate ABC transporter [Pseudoalteromonas haloplanktis
           TAC125]
          Length = 322

 Score =  156 bits (394), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 56/357 (15%), Positives = 115/357 (32%), Gaps = 55/357 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNR-------IRIA-------GSSTLFPYSKIIAEN 46
           M+F  +V    V +  +      A +        I          GS TL       AE 
Sbjct: 1   MKFKNLVAAMGVAVTTFVSAQAVALDNALPEYQKISGVSGNFSSVGSDTLANMMTFWAEE 60

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           +   +P      +++ GSS        G    T ++   SRK+   E++  +K       
Sbjct: 61  YKRIYPNINI-QIQAAGSSTAPPALTEG----TANLGPMSRKMKSKEVEAFEKRHGYKPT 115

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
           EV +  D + +   +D     L ++++    +S          N       +  ++    
Sbjct: 116 EVRVAIDALAVFVHKDNPIEGLRIDEIDAIFSSTRKCGATQQVNRWSD-VGLTGEWAAKD 174

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           I +Y  +   GT    +KK L +G  R                               + 
Sbjct: 175 IQLYGRNSVSGTYGYFKKKALCKGDFR-----------------------------NNVN 205

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISR 284
                   +  I  + +  G+ G+ +  +    + L       +  ++  +  G YP+SR
Sbjct: 206 EQPGSASVVQSISSSLNAIGYSGIGYKTSGVRTVPLAKKGSHFVDATLENVAQGKYPLSR 265

Query: 285 PLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            L  YV +  +        E++   +S +       + + G +P+S +  +     +
Sbjct: 266 FLYLYVNKHPNKPLAPIEAEFLKMVLSKDGQK---IVEKDGYVPLSAKLAEVELKKL 319


>gi|257485706|ref|ZP_05639747.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 333

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 49/362 (13%), Positives = 111/362 (30%), Gaps = 55/362 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L+          T                    +   GS TL     + AE + 
Sbjct: 4   KRLMAALIWVAASATAANTLAAVDPAIKAYTRTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           L  YV +           E+V   +S +       + + G IP+     +     + +  
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADLGLQG 325

Query: 345 SG 346
           +G
Sbjct: 326 AG 327


>gi|330806792|ref|YP_004351254.1| phosphate ABC transporter periplasmic protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327374900|gb|AEA66250.1| Putative phosphate ABC transporter, periplasmic component
           [Pseudomonas brassicacearum subsp. brassicacearum
           NFM421]
          Length = 333

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 58/366 (15%), Positives = 116/366 (31%), Gaps = 58/366 (15%)

Query: 1   MR-FFFVVLMCFVVLEVYCGTGTFA---------------RNRIRIAGSSTLFPYSKIIA 44
           M+    +  M FV   V   +   A                  +   GS TL     + A
Sbjct: 1   MKLKRLMAAMTFVAAGVATASAVAAGVDPAIPSYTKTTGVSGNLSSVGSDTLANLMTLWA 60

Query: 45  ENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD 104
           EN+ + +P      +++ GSS        G    T ++   SRK+  NEL   +      
Sbjct: 61  ENYKKEYPNVNI-QIQAAGSSTAPPALTEG----TSNLGPMSRKMKDNELQAFETKYGYK 115

Query: 105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPE 164
              + +  D + +   +D     LT+E +    +S  +   K           +  D   
Sbjct: 116 PTAIPVAVDALAVFVHKDNPIQHLTMEQVDAIFSSTRLCGAKADVKTWGD-LGVTGDLAN 174

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
             + ++  +   GT    +++ L +G  +                               
Sbjct: 175 KPVQLFGRNSVSGTYGYFKEEALCKGDYK-----------------------------PN 205

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI---DGIVPSMGTIVSGLYP 281
           +         +  I  + +  G+ G+ +   +   + L      + I  S    ++G YP
Sbjct: 206 VNEQPGSASVVQSISSSLNGVGYSGIGYKTASVKTVALAKKGSTEFIEDSEENALNGKYP 265

Query: 282 ISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +           E+V   +S +       + + G IP+  +        +
Sbjct: 266 LSRFLYVYVNKAPNKPLAPLEAEFVKLVLSKQGQ---EVVVKDGYIPLPAKVAAKALADL 322

Query: 341 AVGKSG 346
            + + G
Sbjct: 323 GLSEGG 328


>gi|289924|gb|AAA50281.1| putative [Ehrlichia ruminantium]
          Length = 277

 Score =  156 bits (394), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 91/264 (34%), Positives = 141/264 (53%), Gaps = 8/264 (3%)

Query: 23  FARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDI 82
                I + GSST FP+   IAE F   F ++ TP +ES GS +G   FC+ + + T DI
Sbjct: 19  SNAEHIHVVGSSTAFPFIAAIAEEFGR-FSDYGTPIIESVGSGMGFSMFCQSVENSTPDI 77

Query: 83  VNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI 142
             SSRKI   E++ CK + V DI E+ IG+DGI++ +  +   +  T +DL+KAL+ Y  
Sbjct: 78  AMSSRKIKDAEVELCKSNDVHDIIEIIIGYDGIVIANSNNSNKLDFTKKDLFKALSKYAT 137

Query: 143 VDD---KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
            ++    +  N  K WSEI   FP + I +Y P    GT  +L ++++Q+ C+  +NF +
Sbjct: 138 SEEYTHSIPVNDFKYWSEINNRFPNIDIEVYGPYKNTGTYNILIEEIMQDSCMNHKNFIE 197

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
           +      ++++   AC+ +R DG  IEV  +    + +I  N   FG    SF   N D 
Sbjct: 198 VY----PDLKKRQHACSMIRNDGKYIEVAANENIIIQKIAKNNAAFGIFSFSFLIQNQDK 253

Query: 260 LKLVPIDGIVPSMGTIVSGLYPIS 283
           +    I G+ P+  TI SG Y +S
Sbjct: 254 IHGNKIAGVEPTYETISSGKYILS 277


>gi|148239564|ref|YP_001224951.1| ABC transporter, substrate binding protein, phosphate
           [Synechococcus sp. WH 7803]
 gi|147848103|emb|CAK23654.1| ABC transporter, substrate binding protein, phosphate
           [Synechococcus sp. WH 7803]
          Length = 339

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 72/347 (20%), Positives = 136/347 (39%), Gaps = 51/347 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFV- 59
           M       +  + L     +   A + + IAGSST++P + +  + F+E           
Sbjct: 1   MGLSRSFFLASLALIAPFISTASAAS-LSIAGSSTVYPVTSLAIKKFNETGQGQNVKISL 59

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
            S GSS G +EFC       I + N+SR I+  E+ +CK++GV+ I+         ++ +
Sbjct: 60  RSTGSSAGFREFCSN----KIPLTNASRPISAQEIKQCKQNGVNFIELPIAFDAITVVAN 115

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
             +    +LT  +L +  +             +  W+++  DFPE  I +  P    GT 
Sbjct: 116 QSNNWLNTLTPSELSRLWSKSS-------QGKVSTWNQVNLDFPEQPIKLCGPGKDSGTF 168

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           ++  K + Q       ++                                D    +  + 
Sbjct: 169 DIFNKAINQSKTNSRTDYK----------------------------SSEDDNVIVNCVA 200

Query: 240 VNKDVFGFVGLSFYKNNADVLKLV-----PIDGIVPSMGTIVSGLY-PISRPLLFYVKRQ 293
            N +  G+ G S+Y+NN  +LK +       + I+PS+  +   +Y P+SRPL  Y+   
Sbjct: 201 KNVNALGYFGFSYYQNNRSLLKAIRIVNPKGNAILPSVTAVQKEIYQPLSRPLFLYINDL 260

Query: 294 HFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
                  LR +++F + +        + Q   IP+ +   + V   +
Sbjct: 261 SLRKKTPLRNFITFYLRNVEQ----LVKQSNYIPLQSATYRLVDSKL 303


>gi|302184685|ref|ZP_07261358.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. syringae 642]
          Length = 329

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 49/356 (13%), Positives = 107/356 (30%), Gaps = 55/356 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L           T                    +   GS TL     + AE + 
Sbjct: 4   KRLMTALTLVAAGVTAANTLAAVDPAIKAYTKTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SRK+   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRKMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV +           E+V   +S +       + + G IP+     +     +
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKALADL 321


>gi|114320272|ref|YP_741955.1| phosphate binding protein [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226666|gb|ABI56465.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 319

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 49/320 (15%), Positives = 103/320 (32%), Gaps = 45/320 (14%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE F+E++P      +E  GSS        G    T     
Sbjct: 39  SGNLSSQGSDTLNNLMTLWAETFNEFYPNVSIE-IEGAGSSTAPVALAEG----TAHFGP 93

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR +  +E+   +     +     +  D + +  +RD     LT+E +    +      
Sbjct: 94  MSRSMRDSEIQAFEDAHGYEPTLARVAIDVLAVYVNRDNPIEGLTIEQVDGIFSETQRCG 153

Query: 145 DKVVFNPLKKWSEI--RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
                  + +W ++    ++      +Y  +   GT     +  L +G  +         
Sbjct: 154 G----GNITRWGQVGLTDEWQNRDFTLYSRNAVSGTYGYFREHALCDGDFK--------- 200

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK- 261
                                +I         +  +  + +  G+ G+ +  +    +  
Sbjct: 201 --------------------DSINEQPGSASVVQGVTESLNGIGYSGIGYQTSGVRPIPL 240

Query: 262 LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGL-REYVSFSVSDEMMAPDSQL 320
               +   PS    V+G YP++R L  YV +     +  + RE++    +      D  +
Sbjct: 241 GRDSELFEPSAENAVTGDYPLARFLYVYVNKHPNEELPPVEREFLRMIYT--QQGQDVTV 298

Query: 321 FQYGLIPISNEERKSVRDSI 340
              G IP+     +   + +
Sbjct: 299 RD-GFIPLPAAAAEREMERL 317


>gi|330986918|gb|EGH85021.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 332

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 48/362 (13%), Positives = 110/362 (30%), Gaps = 55/362 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L+          T                    +   GS TL     + AE + 
Sbjct: 4   KRLMAALIWVAASATAANTLAAVDPAIKAYTRTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +        I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVSGSLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           L  YV +           E+V   +S +       + + G IP+     +     + +  
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADLGLQG 325

Query: 345 SG 346
           +G
Sbjct: 326 AG 327


>gi|289677421|ref|ZP_06498311.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. syringae FF5]
 gi|330898745|gb|EGH30164.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. japonica str. M301072PT]
 gi|330937435|gb|EGH41406.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330976293|gb|EGH76353.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 332

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 50/356 (14%), Positives = 107/356 (30%), Gaps = 55/356 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L           T                    +   GS TL     + AE + 
Sbjct: 4   KRLMTALTLVAAGVTAANTLAAVDPAIQAYTKTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SRK+   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRKMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   K           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGAKADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV +           E+V   +S +       + + G IP+     +     +
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADL 321


>gi|94499909|ref|ZP_01306445.1| ABC-type phosphate transport system, periplasmic component
           [Oceanobacter sp. RED65]
 gi|94428110|gb|EAT13084.1| ABC-type phosphate transport system, periplasmic component
           [Oceanobacter sp. RED65]
          Length = 322

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 51/323 (15%), Positives = 109/323 (33%), Gaps = 41/323 (12%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
            +         GS TL     + AE F   +P      +++ GSS        G    T 
Sbjct: 36  SSGVSGNFSSVGSDTLANMMTLWAEEFKRQYPNVNI-QIQAAGSSTAPPALTEG----TA 90

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
            +   SRK+   E++  +         V +  D + +  ++D     LT+ ++    +S 
Sbjct: 91  HVGPMSRKMKDKEIEAFENKFGYKPTAVPVAIDALAVFVNKDNPVKGLTMAEVDAIFSST 150

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
                   F+       +   +   +I +Y  +   GT    +KK L +G  ++      
Sbjct: 151 RKCGLAKGFDTWGDA-GLTGVWSSKKIELYGRNSVSGTYGYFKKKALCKGDFKNT----- 204

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                                   ++        +  +  + +  G+ G+ +  ++   +
Sbjct: 205 ------------------------VKEQPGSASVVQAVSSSLNGVGYSGMGYTTSSVRAV 240

Query: 261 KLVPIDGI--VPSMGTIVSGLYPISRPLLFYVKRQHFNSV-LGLREYVSFSVSDEMMAPD 317
            L    G     +    V+G YP+SR L  YV ++    +    RE++   +S +     
Sbjct: 241 PLSKKGGQFIEATPENAVTGAYPLSRFLYTYVNKKPNEKLQPLEREFLKLVLSQQGQK-- 298

Query: 318 SQLFQYGLIPISNEERKSVRDSI 340
             + + G IP+  +  +     +
Sbjct: 299 -IVAKDGYIPLPAKVVERTMKQL 320


>gi|59712593|ref|YP_205369.1| phosphate-binding protein [Vibrio fischeri ES114]
 gi|59480694|gb|AAW86481.1| phosphate-binding protein [Vibrio fischeri ES114]
          Length = 329

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 56/357 (15%), Positives = 112/357 (31%), Gaps = 59/357 (16%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFA--------------RNRIRIAGSSTLFPYSKIIAENFS 48
            +F       +L +       A                 +   GS TL     + AE+F 
Sbjct: 10  KWFKGFFPVGLLWLCFANNGLADEGTLAPYERVSGISGNLSSIGSDTLANMMTLWAEDFQ 69

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
             +P        SG S+         + + T      SRK+ Q+E    ++       E+
Sbjct: 70  RIYPRVHIQIQASGSSTAAP-----ALIESTAQFGPMSRKMRQSEKAAFERQFGYPPTEI 124

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSE--IRPDFPEVR 166
            +  D + +   +D     L    L    ++ L          + +W E  I   + + R
Sbjct: 125 RVAIDALGIFVHQDNPIKGLNFSQLDAIFSATLRCG---ALKSISRWQELGIHTSWAKHR 181

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           I ++  +   GT    +   L  G  +                             + + 
Sbjct: 182 IQLFGRNSVSGTYGYFKNNALCNGDFK-----------------------------VNVN 212

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV--PIDGIVPSMGTIVSGLYPISR 284
                   +  I  + +  G+ G+ +  +   +L +     D I P+   I++G YP++R
Sbjct: 213 EQPGSASVVQGISASLNGIGYSGVGYQMSGVKLLPISRTGTDYIEPTTDNIINGQYPLAR 272

Query: 285 PLLFYVKRQHFNSVLGL-REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            L  Y+ +     +  L  E++ + +S E       + Q G I +           +
Sbjct: 273 FLYIYINKPPTAKLPPLDAEFIRYMLSREGQDR---VEQDGYIALPERFVLQELSKL 326


>gi|330890613|gb|EGH23274.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. mori str. 301020]
          Length = 332

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 50/362 (13%), Positives = 113/362 (31%), Gaps = 56/362 (15%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARN--------------RIRIAGSSTLFPYSKIIAENFS 48
              +  +  V   V       A +               +   GS TL     + AE + 
Sbjct: 4   KRLMTALTLVAPGVTAANTLAAVDPAIQAYTRTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           I     +  I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGDVGVIGDLAGK-PIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           L  YV +           E+V   +S +       + + G IP+     +     + +  
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADLGLQG 325

Query: 345 SG 346
           +G
Sbjct: 326 AG 327


>gi|170719332|ref|YP_001747020.1| phosphate binding protein [Pseudomonas putida W619]
 gi|169757335|gb|ACA70651.1| phosphate binding protein [Pseudomonas putida W619]
          Length = 332

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 47/320 (14%), Positives = 99/320 (30%), Gaps = 42/320 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE + + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAEAYKKEYPNVNI-QIQAAGSSTAPPALTEG----TANLGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   EL   ++        + +  D + +   +D     LT+  +    +S  +  
Sbjct: 95  MSRKMKDVELQAFEQKYGYKPTAIPVAVDALAVFVHKDNPIKGLTMAQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K           +  D     + ++  +   GT    +++ L +G  +           
Sbjct: 155 AKADVKTWGD-LGVTGDLANKPVQLFGRNSVSGTYGYFKEEALCKGDFK----------- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I  + +  G+ G+ +   +   + L  
Sbjct: 203 ------------------PNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVGLAK 244

Query: 265 IDGIVPSMGTIV---SGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQL 320
            +G            +G YP+SR L  YV +           E+V   +S         +
Sbjct: 245 KEGGEFIEDNEANALNGTYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSQAGQQ---VV 301

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G IP+  +        +
Sbjct: 302 VKDGYIPLPAKVVDKTLADL 321


>gi|66048265|ref|YP_238106.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. syringae B728a]
 gi|63258972|gb|AAY40068.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. syringae B728a]
          Length = 332

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 49/356 (13%), Positives = 109/356 (30%), Gaps = 55/356 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L+          T                    +   GS TL     + AE + 
Sbjct: 4   KRLMTALILVAAGVTAANTLAAVDPAIKAYTKTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SRK+   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRKMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  +++  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSRNGIGYSGIGYKTSNVRAVALAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV +           E+V   +S +       + + G IP+     +     +
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADL 321


>gi|167624970|ref|YP_001675264.1| phosphate-binding protein [Shewanella halifaxensis HAW-EB4]
 gi|167354992|gb|ABZ77605.1| phosphate binding protein [Shewanella halifaxensis HAW-EB4]
          Length = 323

 Score =  156 bits (393), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 52/360 (14%), Positives = 113/360 (31%), Gaps = 61/360 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---------------RNRIRIAGSSTLFPYSKIIAE 45
           M+   +V            T + A                  +   GS TL     + AE
Sbjct: 1   MKLKQLVGAVSFTAATVFSTASMAEIDQSLPTYEKTSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
           +F + +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  DFKQLYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEVEAFEKHYGYQP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFP 163
             + +  D + +   +D     +++E +    +S            + +W ++     + 
Sbjct: 116 TPIRVAIDALAVFVHKDNPIEGMSIEQIDGIFSSTDKCGG----GDVTRWGQVGLEGSWT 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              I +Y  +   GT    +KK L +G  +                              
Sbjct: 172 ARDIQLYGRNSVSGTYGYFKKKALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +     + I  +     +G YP
Sbjct: 203 NVNEQPGSASVVQAVSQSLNSIGYSGIGYKTAGVKAVAISKKGTNYIPATADNAATGKYP 262

Query: 282 ISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +  +       RE++ + +S +       + + G + +           +
Sbjct: 263 LSRYLYVYVNKHPNKALSPMDREFIRYVLSKQGQQ---IVEKDGYVALPRSVIAKDLAKV 319


>gi|212634122|ref|YP_002310647.1| phosphate-binding protein [Shewanella piezotolerans WP3]
 gi|212555606|gb|ACJ28060.1| Phosphate-binding protein [Shewanella piezotolerans WP3]
          Length = 323

 Score =  156 bits (393), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 53/359 (14%), Positives = 115/359 (32%), Gaps = 61/359 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V    +         + A                  +   GS TL     + AE
Sbjct: 1   MKLKQLVGAVSLTAATVFSAASMAAIDQSLPTYEKTSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
           +F + +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  DFKQLYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEVEAFEKHYGYQP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFP 163
             + +  D + +   +D     +++E +    +S      +     +K+W ++     + 
Sbjct: 116 TAIRVAIDALAVFVHKDNPIKGMSMEQIDGIFSSTNKCGGE----NIKRWGDVGLTGSWN 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              + +Y  +   GT    +KK L +G  +                              
Sbjct: 172 GRDVQLYGRNSVSGTYGYFKKKALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +     + I  S     SG YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVAVSKKGTNYIAASAENAASGKYP 262

Query: 282 ISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           +SR L  YV +  + +     RE++ + +S +       + + G + +           
Sbjct: 263 LSRYLYVYVNKHPNKDLAPMDREFIRYVLSQQGQQ---IVEKDGYVALPRSVIAKDLAK 318


>gi|330961392|gb|EGH61652.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 332

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 49/356 (13%), Positives = 107/356 (30%), Gaps = 55/356 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGT-------------GTFARNRIRIAGSSTLFPYSKIIAENFS 48
           +     L           T                    +   GS TL     + AE + 
Sbjct: 4   KRLMTALTFVAAGVATATTFAAVDPAIKSYSRTAGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SRK+   EL   ++        +
Sbjct: 64  KQYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRKMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVPGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEVNTLNGTYPLSRY 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV +           E+V   +S +       + + G IP+     +     +
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLTDL 321


>gi|289625483|ref|ZP_06458437.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289649738|ref|ZP_06481081.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330870957|gb|EGH05666.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 332

 Score =  155 bits (392), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 48/362 (13%), Positives = 111/362 (30%), Gaps = 55/362 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGT-------------GTFARNRIRIAGSSTLFPYSKIIAENFS 48
           +     L+          T              +     +   GS TL     + AE + 
Sbjct: 4   KRLMAALIWVAASATAANTLAAVDPAIKAYTRASGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +        I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVGGSLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           L  YV +           E+V   +S +       + + G IP+     +     + +  
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADLGLQG 325

Query: 345 SG 346
           +G
Sbjct: 326 AG 327


>gi|57866941|ref|YP_188538.1| phosphate ABC transporter phosphate-binding protein [Staphylococcus
           epidermidis RP62A]
 gi|81674679|sp|Q5HPF2|PSTS_STAEQ RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|57637599|gb|AAW54387.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus epidermidis RP62A]
          Length = 325

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 68/356 (19%), Positives = 129/356 (36%), Gaps = 66/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA----------RNRIRIAGSSTLFPYSKIIAENFSEY 50
           M+ + +V    +   V  G               +   +  GSST+ P  + + E +++ 
Sbjct: 1   MKKWQLVGTTVLGASVLLGACGGNDGGSGDGKDLKGSAKGEGSSTVAPIVEKLNEKWAKD 60

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
             + K    ++ G+  G ++F  G      D  ++SR I   E  + +  G+   +    
Sbjct: 61  HKDAKISSGQA-GTGAGFQKFIAG----ETDFSDASRPIKDEEKKKLEDKGIKYHEFKIA 115

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
                + V+  +     LT   L             +     K W ++   +P+ +I   
Sbjct: 116 QDGVTIAVNKDNDFVKELTKSQLKD-----------IYSGKAKTWKDVNSSWPDKKINAV 164

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
            P+  HGT +  E++V+ +  +++   +                               D
Sbjct: 165 SPNSSHGTYDFFEEEVMDKQDIKAEKNA-------------------------------D 193

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI-----VPSMGTIVSGLYPISRP 285
               ++ +  NK+  G+ G +FY+ N D LK V I         P+  TI +G Y +SRP
Sbjct: 194 TNAIVSSVTKNKEGIGYFGYNFYEQNKDKLKEVKIKDDNGKVTEPTKKTIQNGSYALSRP 253

Query: 286 LLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           L  Y K +       + E++ F + DE  A        G +    +  KS  D + 
Sbjct: 254 LFIYAKDKSLKDNKVMSEFMKFVLEDEGQA----AEDAGYVASPKKTYKSQLDDLK 305


>gi|289550797|ref|YP_003471701.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Staphylococcus lugdunensis HKU09-01]
 gi|315658292|ref|ZP_07911164.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus lugdunensis M23590]
 gi|289180329|gb|ADC87574.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Staphylococcus lugdunensis HKU09-01]
 gi|315496621|gb|EFU84944.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus lugdunensis M23590]
          Length = 326

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 71/353 (20%), Positives = 131/353 (37%), Gaps = 64/353 (18%)

Query: 1   MRFF----FVVLMCFVVLEVYCGTGTFA----RNRIRIAGSSTLFPYSKIIAENFSEYFP 52
           M+ +      VL   V+L    G G+         ++  GSST+ P  + + E F++ +P
Sbjct: 1   MKKWQLVGTTVLGASVLLGACGGNGSGNGKDVSGEVKGDGSSTVGPIVEKLNEKFAKDYP 60

Query: 53  EFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGH 112
           +       SG      ++F  G      D  N+SR I   E  + +   +   +      
Sbjct: 61  DVTVSSGTSGTGGG-FEKFIAG----ETDFSNASRPIKDEEKKKLEDKNIKYKEYKIAQD 115

Query: 113 DGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVP 172
              + V+  +    SL+ + L K           +     K W ++   +P  +I  + P
Sbjct: 116 GVTVTVNKDNDFVDSLSKDQLKK-----------IYSGEAKTWKDVNSSWPNKKIKAFSP 164

Query: 173 SGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYT 232
              HGT +   ++V+ +G +++   +                               D  
Sbjct: 165 DQSHGTYDFFSEEVMDKGDIKAEKNA-------------------------------DTN 193

Query: 233 ETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI-----VPSMGTIVSGLYPISRPLL 287
             +  +E NK+  G+ G +FY+ N D LK V I         P+  TI    Y +SRPL 
Sbjct: 194 VIVQSVEKNKEGIGYFGYNFYQQNKDKLKEVKIKDDKGKDTKPTKKTIQDNSYALSRPLF 253

Query: 288 FYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            Y K +      G +E++ F + DE  +        G + +  ++ K  +  +
Sbjct: 254 IYAKEKSLEENKGFQEFMKFVLKDEGKS----AEDAGYVALPKDDYKKEQKQL 302


>gi|320321742|gb|EFW77840.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331492|gb|EFW87432.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330880938|gb|EGH15087.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 332

 Score =  155 bits (392), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 48/356 (13%), Positives = 108/356 (30%), Gaps = 55/356 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L+          T                    +   GS TL     + AE + 
Sbjct: 4   KRLMAALIWVAASATAANTLAAVDPAIKAYTRTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV +           E+V   +S +       + + G IP+     +     +
Sbjct: 269 LYVYVNKAPNQSLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADL 321


>gi|238752751|ref|ZP_04614220.1| ABC superfamily (Peri_bind) high-affinity phosphate transporter
           [Yersinia rohdei ATCC 43380]
 gi|238709009|gb|EEQ01258.1| ABC superfamily (Peri_bind) high-affinity phosphate transporter
           [Yersinia rohdei ATCC 43380]
          Length = 330

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 54/359 (15%), Positives = 113/359 (31%), Gaps = 57/359 (15%)

Query: 1   MRFFFVVLMCFVV----------LEVYCGTGTFARN------RIRIAGSSTLFPYSKIIA 44
           MR+  + L+  V+          ++V  G    + +       +   GS TL     + A
Sbjct: 6   MRWGKLALLTVVLWFSYSIFAQPVKVLSGGAGQSSDRSILSGNLSSVGSDTLANLMSLWA 65

Query: 45  ENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD 104
           E+F+ ++P      +++ GSS        G       I   SR +   E+    +     
Sbjct: 66  EDFNHHYPGVNL-QIQAAGSSTAPAALVAGA----TQIGPMSRPMKAAEIAAFTQRYGYP 120

Query: 105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPE 164
              V +  D +++   +D     +T   L    +       +           +  D+  
Sbjct: 121 PLAVPVAVDALVVFVHQDNPLDKITFSQLDAIFSQN-PHCGEPHRIVRFGELGLGGDWAA 179

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
             +  Y  +   GT    + +VL +G                                  
Sbjct: 180 RSLQRYSRNSASGTYGFFKHRVLCDGDF-----------------------------INN 210

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPI 282
           +         +  +  + +  G+  + F  +    L L     D ++P+   + +G YP+
Sbjct: 211 VNELPGSASVVQAVAGSLNGIGYASMGFRNSGVKALSLAAKGQDFVLPTAENVKNGHYPL 270

Query: 283 SRPLLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           SR L  Y+ +         +  ++   +S E       + Q G +P+  E     R  +
Sbjct: 271 SRYLYLYINKAPGQPLEPLVAAFLERVLSPEGQER---VTQDGYLPLPPEMLSQTRKEL 326


>gi|330964474|gb|EGH64734.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 332

 Score =  155 bits (391), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 50/356 (14%), Positives = 106/356 (29%), Gaps = 55/356 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L       V   T                    +   GS TL     + AE + 
Sbjct: 4   KRLMTALTFVAAGVVATHTFAAVDPAIKAYTKTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    +   +   K           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSVTRLCGAKADVKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIV---SGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G            +G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDNEANTLNGTYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV +           E+V   +S +       + + G IP+     +     +
Sbjct: 269 LYIYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLTDL 321


>gi|229593412|ref|YP_002875531.1| putative phosphate ABC transporter periplasmic substrate-binding
           protein [Pseudomonas fluorescens SBW25]
 gi|229365278|emb|CAY53610.1| putative phosphate ABC transport system, periplasmic
           substrate-binding protein [Pseudomonas fluorescens
           SBW25]
          Length = 328

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 54/360 (15%), Positives = 111/360 (30%), Gaps = 58/360 (16%)

Query: 1   MR-FFFVVLMCFVVLEVYCGTGTFA---------------RNRIRIAGSSTLFPYSKIIA 44
           M+    +  M FV   V       A                  +   GS TL     + A
Sbjct: 1   MKLKRLMAAMTFVAAGVATANAVAAGVDPAIPAYVKTTGVSGNLSSVGSDTLANLMTLWA 60

Query: 45  ENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD 104
           E + + +P      +++ GS+        G    T ++   SRK+   EL   ++     
Sbjct: 61  EGYKKEYPNVNI-QIQAAGSATAPPALTEG----TSNLGPMSRKMKDTELAAFEQKYGYK 115

Query: 105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPE 164
              + +  D + +   +D     LT+E +    +S  +   K           +  D   
Sbjct: 116 PTAIPVAVDALAVFVHKDNPIQHLTMEQVDAIFSSTRLCGAKADVKTWGD-LGVTGDLAN 174

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
             + ++  +   GT    +++ L +G  +                               
Sbjct: 175 KPVQLFGRNSVSGTYGYFKEEALCKGDYK-----------------------------PN 205

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI---DGIVPSMGTIVSGLYP 281
           +         +  I  + +  G+ G+ +   +   + L      D I  +    ++G YP
Sbjct: 206 VNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVALAKKGSTDFIEDTEENALNGKYP 265

Query: 282 ISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +           E+V   +S +       + + G IP+  +        +
Sbjct: 266 LSRFLYVYVNKAPNKPLAPLEAEFVKLVLSKQGQ---EVVVKDGYIPLPAKVAAKALADL 322


>gi|323499852|ref|ZP_08104811.1| phosphate transport system substrate-binding protein [Vibrio
           sinaloensis DSM 21326]
 gi|323315093|gb|EGA68145.1| phosphate transport system substrate-binding protein [Vibrio
           sinaloensis DSM 21326]
          Length = 319

 Score =  155 bits (391), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 58/320 (18%), Positives = 108/320 (33%), Gaps = 45/320 (14%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             +   GS TL   + +  E F + +P   T  V++ GSS             T      
Sbjct: 34  GTLTSVGSDTLAGMTTLWVEEFKQLYPSV-TGQVQASGSSTAPPALTE----RTAQFGPM 88

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR +   E++  ++       E+ +  D I +   RD     L    L    ++ L    
Sbjct: 89  SRPMRNREIEAFEREHGYKPTELRVAIDAIGIFVHRDNPVKGLNFTQLDSIFSATLRCGG 148

Query: 146 KVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDM 203
               +P++ W    +   + +  I ++  +   GT    +   L  G  +          
Sbjct: 149 ---LDPIETWSELGLDYQWAKRSIQLFGRNSVSGTYGYFKNNALCGGDFK---------- 195

Query: 204 FKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLV 263
                               ++         +  +    +  G+ G+ +  +   +L + 
Sbjct: 196 -------------------NSVNEQPGSASVVQSVASAINTIGYSGVGYKVSGVKLLPIA 236

Query: 264 PI--DGIVPSMGTIVSGLYPISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQL 320
               D + PS   I+SG YP+SR L  YV +          RE++ F  S +  A    +
Sbjct: 237 EYGQDYVQPSQENILSGKYPLSRYLYVYVNKHPSKPLSPIEREFIRFIYSAQGQA---LV 293

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G IPIS +  K     +
Sbjct: 294 EKDGYIPISAQLAKRELAKV 313


>gi|242242667|ref|ZP_04797112.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis W23144]
 gi|242233803|gb|EES36115.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis W23144]
 gi|319401326|gb|EFV89537.1| phosphate binding family protein [Staphylococcus epidermidis
           FRI909]
          Length = 325

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 68/356 (19%), Positives = 129/356 (36%), Gaps = 66/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA----------RNRIRIAGSSTLFPYSKIIAENFSEY 50
           M+ + +V    +   V  G               +   +  GSST+ P  + + E +++ 
Sbjct: 1   MKKWQLVGTTVLGASVLLGACGGNDGGSGDGKDLKGSAKGEGSSTVAPIVEKLNEKWAKD 60

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
             + K    ++ G+  G ++F  G      D  ++SR I   E  + +  G+   +    
Sbjct: 61  HKDAKISSGQA-GTGAGFQKFIAG----ETDFSDASRPIKDEEKKKLEDKGIKYHEFKIA 115

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
                + V+  +     LT   L             +     K W ++   +P+ +I   
Sbjct: 116 QDGVTIAVNKDNDFVKELTKSQLKD-----------IYSGKAKTWKDVNSSWPDKKINAV 164

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
            P+  HGT +  E++V+ +  +++   +                               D
Sbjct: 165 SPNSSHGTYDFFEEEVMDKQDIKAEKNA-------------------------------D 193

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI-----VPSMGTIVSGLYPISRP 285
               ++ +  NK+  G+ G +FY+ N D LK V I         P+  TI +G Y +SRP
Sbjct: 194 TNAIVSSVTKNKEGIGYFGYNFYEQNKDKLKEVKIKDDNGKVTEPTKKTIQNGSYALSRP 253

Query: 286 LLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           L  Y K +       + E++ F + DE  A        G +    +  KS  D + 
Sbjct: 254 LFIYAKDKSLKDNKVMSEFMKFVLEDEGQA----AEDAGYVASPKKTYKSQLDDLK 305


>gi|209695878|ref|YP_002263808.1| hypothetical protein VSAL_I2455 [Aliivibrio salmonicida LFI1238]
 gi|208009831|emb|CAQ80139.1| putative exported protein [Aliivibrio salmonicida LFI1238]
          Length = 329

 Score =  155 bits (391), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 56/358 (15%), Positives = 119/358 (33%), Gaps = 59/358 (16%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA--------------RNRIRIAGSSTLFPYSKIIAENF 47
           R ++ VL    +L +       A                 +   GS TL     + AE+F
Sbjct: 9   RKWYQVLTPVALLWLCVINNGMAYDGQLAHYERVSGVSGNLSSIGSDTLANMMTLWAEDF 68

Query: 48  SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQE 107
              +P      +++ GSS             T      SRK+ Q+E    ++       E
Sbjct: 69  QRIYPRVNI-QIQASGSSTAPPALIE----STAQFGPMSRKMRQSEKAAFERQFGYPPTE 123

Query: 108 VTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSE--IRPDFPEV 165
           + +  D + +   +D     L    L    ++ L         P+ +W +  +   + + 
Sbjct: 124 IRVAIDALGIFVHQDNPIQGLNFTQLDAIFSATLRCG---AVKPINRWQDLGLTTSWAKH 180

Query: 166 RIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI 225
           RI ++  +   GT    +   L +G  +                             + +
Sbjct: 181 RIQLFGRNSVSGTYGYFKINALCDGDFK-----------------------------VNV 211

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPIS 283
                    +  +  + +  G+ G+ +  +   ++ +     D I P+   I++G YP++
Sbjct: 212 NEQPGSGSVVQGVSASLNGIGYSGVGYKMSGVKLIPISRDGTDYINPTTDNIINGQYPLA 271

Query: 284 RPLLFYVKRQHFNSVLGL-REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           R L  Y+ +     +  L  E++ + +S+E       + Q G I +S          +
Sbjct: 272 RFLYLYINKPPTAKLPKLDAEFIRYMLSEEGQLR---VEQDGYIALSERFVLQELSKL 326


>gi|77461836|ref|YP_351343.1| phosphate binding protein [Pseudomonas fluorescens Pf0-1]
 gi|77385839|gb|ABA77352.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Pseudomonas fluorescens Pf0-1]
          Length = 333

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 50/326 (15%), Positives = 107/326 (32%), Gaps = 42/326 (12%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AEN+ + +P      +++ GS+        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAENYKKEYPNVNI-QIQAAGSATAPPALTEG----TSNLGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   EL   ++        + +  D + +   +D     LT+E +    +S  +  
Sbjct: 95  MSRKMKDTELAAFEQKYGYKPTAIPVAVDALAVFVHKDNPIQHLTMEQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K           +  D     + ++  +   GT    +++ L +G  +           
Sbjct: 155 AKADVKTWGD-LGVTGDLANKPVQLFGRNSVSGTYGYFKEEALCKGDYK----------- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I  + +  G+ G+ +   +   + L  
Sbjct: 203 ------------------PNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVALSK 244

Query: 265 I---DGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQL 320
               D I  +    ++G YP+SR L  YV +           E+V   +S +       +
Sbjct: 245 KGSTDFIEDTEENALNGKYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSKQGQ---EVV 301

Query: 321 FQYGLIPISNEERKSVRDSIAVGKSG 346
            + G IP+  +        + + + G
Sbjct: 302 VKDGYIPLPAKVAAKALADLGLQEGG 327


>gi|330970229|gb|EGH70295.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. aceris str.
           M302273PT]
          Length = 332

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/356 (13%), Positives = 108/356 (30%), Gaps = 55/356 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L           T                    +   GS TL     + AE + 
Sbjct: 4   KRLMTALTLVAAGVTAANTLAAVDPAIKAYIKTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SRK+   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRKMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  +++  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSRNGIGYSGIGYKTSNVRAVALAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV +           E+V   +S +       + + G IP+     +     +
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADL 321


>gi|298489427|ref|ZP_07007438.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298156001|gb|EFH97110.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 332

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/362 (13%), Positives = 111/362 (30%), Gaps = 55/362 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L+          T                    +   GS TL     + AE + 
Sbjct: 4   KRLMAALIWVAASATAANTLAAVDPAIKAYTRTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +        I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVSGSLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNSIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           L  YV +  +        E+V   +S +       + + G IP+     +     + +  
Sbjct: 269 LYVYVNKVPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADLGLQG 325

Query: 345 SG 346
           +G
Sbjct: 326 AG 327


>gi|126652197|ref|ZP_01724376.1| phosphate ABC transporter, phosphate-binding protein [Bacillus sp.
           B14905]
 gi|126590929|gb|EAZ85041.1| phosphate ABC transporter, phosphate-binding protein [Bacillus sp.
           B14905]
          Length = 387

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 73/371 (19%), Positives = 133/371 (35%), Gaps = 74/371 (19%)

Query: 1   MRFFFVVLMCFVVLEVY---------------------CGTGTFARN-----RIRIAGSS 34
           M+ +  + M  V+                           +G  A +      +   GSS
Sbjct: 64  MKKWKYLTMTAVMGSALMLGACGSDSAQNGNNTETNAPASSGQEAADEKLQGSVAGDGSS 123

Query: 35  TLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNEL 94
           T+ P  + + E ++   P+ K     SG      ++F  G      D  N+SR I   E 
Sbjct: 124 TVAPIIEAVVEEYAGAQPDVKVSVGVSGTGGG-FEKFIAG----ETDFSNASRNIKDEEK 178

Query: 95  DECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKK 154
            +  + G+   +         ++V+  +  +  LTVE L K           +     KK
Sbjct: 179 AKLGEAGIDYTELALAYDGLSVVVNPENDWAKDLTVEQLQKIW---------IEDGKEKK 229

Query: 155 WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA 214
           WS+I P +P+ +I  Y P    GT +  ++ +L    + S                    
Sbjct: 230 WSDIDPSWPDEKIVYYSPGTDSGTYDYFDEIILDGADLVSSA------------------ 271

Query: 215 CTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGT 274
                       +  D    +  +  +K+  GF G ++Y  N D L +V ++G+ P+  T
Sbjct: 272 -----------TLSEDDNMLVQGVSGDKNAIGFFGYAYYLENKDKLNIVKVNGVEPNNET 320

Query: 275 IVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER 333
           I +G Y P+SRPL  YVK           +++ F++ +            G + +  E+ 
Sbjct: 321 IEAGEYTPLSRPLFTYVKNSAMKDNEAAYDFIKFTLENAG----DMAEAVGYVRLPEEKY 376

Query: 334 KSVRDSIAVGK 344
                ++   K
Sbjct: 377 TEGLKTLEGLK 387


>gi|292492325|ref|YP_003527764.1| phosphate binding protein [Nitrosococcus halophilus Nc4]
 gi|291580920|gb|ADE15377.1| phosphate binding protein [Nitrosococcus halophilus Nc4]
          Length = 326

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 46/363 (12%), Positives = 111/363 (30%), Gaps = 63/363 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRI-----------------RIAGSSTLFPYSKII 43
           M+  +++            + + A  ++                    GS TL     + 
Sbjct: 1   MQIRYIIAALGFASVALFSSHSVAAEQVDPDLKEYSKASGVAGNLSSVGSDTLANLMTLW 60

Query: 44  AENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVS 103
           AE F + +P        +G S+         + + T ++   SRK+   E++  +K    
Sbjct: 61  AEEFKKLYPNVNIQIQAAGSSTA-----PPALTESTANLGPMSRKMKDKEVEAFEKKYGY 115

Query: 104 DIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPD 161
               V +  D + +  ++D     +T+  +    ++            +  W    +  +
Sbjct: 116 KPTPVRVAIDALAVYVNKDNPIEGITIPQVDAVFSATRKCG---YPKDITTWGDLGLGGE 172

Query: 162 FPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQD 221
           +    + ++  +   GT    +K  L +G  ++                           
Sbjct: 173 WTHRSLQLFGRNSVSGTYGYFKKAALCKGDFKNT-------------------------- 206

Query: 222 GIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID---GIVPSMGTIVSG 278
              +         +  +  + +  G+ G+ +  +    + L        +  +    V G
Sbjct: 207 ---VNEQPGSASVVQGVTKSINGIGYSGIGYRTSGVRAVPLATKKDAPYVEATSENAVKG 263

Query: 279 LYPISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
            YP++R L  YV +  +       RE++   +S         + + G IP+         
Sbjct: 264 QYPLARFLYVYVNKHPNKPLPPLEREFIKMVLSKTGQG---VVIKDGYIPLPARVAAKDL 320

Query: 338 DSI 340
             I
Sbjct: 321 AKI 323


>gi|82750981|ref|YP_416722.1| phosphate-binding lipoprotein [Staphylococcus aureus RF122]
 gi|123549144|sp|Q2YXX9|PSTS_STAAB RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|82656512|emb|CAI80934.1| phosphate-binding lipoprotein [Staphylococcus aureus RF122]
          Length = 327

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 64/356 (17%), Positives = 125/356 (35%), Gaps = 65/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---------RNRIRIAGSSTLFPYSKIIAENFSEYF 51
           M+ +  V    +   +  G              +   +  GSST+ P  + + E +++  
Sbjct: 1   MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
            + K    ++ G+  G ++F  G     ID  ++SR I   E  + +   +   +     
Sbjct: 61  SDAKISAGQA-GTGAGFQKFIAG----DIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQ 115

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               + V+  +     L  + L             +     K W ++   +P+ +I    
Sbjct: 116 DGVTVAVNKENDFVDELDKQQLKA-----------IYSGKAKTWKDVNSKWPDKKINAVS 164

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P+  HGT +  E +V+ +  +++   +                               D 
Sbjct: 165 PNSSHGTYDFFENEVMNKEDIKAEKNA-------------------------------DT 193

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLYPISRPL 286
              ++ +  NK+  G+ G +FY  N D LK V I         P+  TI    Y +SRPL
Sbjct: 194 NAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENCKATEPTKKTIQDNSYALSRPL 253

Query: 287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             YV  +       + E++ F + D+  A      + G +    +  KS  D +  
Sbjct: 254 FIYVNEKALKDNKVMSEFIKFVLEDKGKA----AEEAGYVAAPEKTYKSQLDDLKA 305


>gi|312963913|ref|ZP_07778384.1| phosphate transport system substrate-binding protein [Pseudomonas
           fluorescens WH6]
 gi|311281948|gb|EFQ60558.1| phosphate transport system substrate-binding protein [Pseudomonas
           fluorescens WH6]
          Length = 328

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 53/360 (14%), Positives = 111/360 (30%), Gaps = 58/360 (16%)

Query: 1   MR-FFFVVLMCFVVLEVYCGTGTFA---------------RNRIRIAGSSTLFPYSKIIA 44
           M+    +  M FV   V       A                  +   GS TL     + A
Sbjct: 1   MKLKRLMAAMTFVAAGVATANAVAAGVDPAIPAYVKTTGVSGNLSSVGSDTLANLMTLWA 60

Query: 45  ENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD 104
           E + + +P      +++ GS+        G    T ++   SRK+   EL   ++     
Sbjct: 61  EGYKKEYPNVNI-QIQAAGSATAPPALTEG----TSNLGPMSRKMKDTELAAFEQKYGYK 115

Query: 105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPE 164
              + +  D + +   +D     LT+E +    +S  +   K           +  D   
Sbjct: 116 PTAIPVAVDALAVFVHKDNPIQHLTMEQVDAIFSSTRLCGGKADVKTWGD-LGVTGDLAN 174

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
             + ++  +   GT    +++ L +G  +                               
Sbjct: 175 KPVQLFGRNSVSGTYGYFKEEALCKGDYK-----------------------------PN 205

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI---DGIVPSMGTIVSGLYP 281
           +         +  I  + +  G+ G+ +   +   + L      + +  S    ++G YP
Sbjct: 206 VNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVALAKKGSTEFVEDSEENALNGKYP 265

Query: 282 ISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +           E+V   +S +       + + G IP+  +        +
Sbjct: 266 LSRFLYVYVNKAPNKPLAPLEAEFVKLVLSKQGQ---EVVVKDGYIPLPAKVAAKALADL 322


>gi|325275128|ref|ZP_08141102.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas sp. TJI-51]
 gi|324099736|gb|EGB97608.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas sp. TJI-51]
          Length = 332

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 48/320 (15%), Positives = 102/320 (31%), Gaps = 42/320 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE + + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAEAYKKEYPNVNI-QIQAAGSSTAPPALTEG----TANLGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   EL   ++        + +  D + +   +D     LT+  +    +S  +  
Sbjct: 95  MSRKMKDVELQAFEQKYGYKPTAIPVAVDALAVFVHKDNPIKGLTMAQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K           +  D     I ++  +   GT    +++ L +G  +           
Sbjct: 155 GKAEVKTWGD-VGVTGDLANKPIQLFGRNSVSGTYGYFKEEALCKGDFK----------- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I  + +  G+ G+ +   +   + L  
Sbjct: 203 ------------------PNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVALAK 244

Query: 265 IDG---IVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQL 320
            +G   +  +    ++G YP+SR L  YV +           E+V   +S         +
Sbjct: 245 KEGSAFVEDNEANALNGTYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSQAGQQ---VV 301

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G IP+  +        +
Sbjct: 302 VKDGYIPLPAKVVDKTLADL 321


>gi|145298256|ref|YP_001141097.1| phosphate-binding protein [Aeromonas salmonicida subsp. salmonicida
           A449]
 gi|142851028|gb|ABO89349.1| phosphate-binding protein [Aeromonas salmonicida subsp. salmonicida
           A449]
          Length = 324

 Score =  155 bits (390), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 47/359 (13%), Positives = 109/359 (30%), Gaps = 57/359 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------------RIRIAGSSTLFPYSKIIA 44
           M+   +  +              A                   +   GS TL     + A
Sbjct: 1   MKLNKLAGVIGFTAATLFSVSALAAGVDKDLLDYTPTSGISGNLSSVGSDTLANMMTLWA 60

Query: 45  ENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD 104
           E F   +P      +++ GSS        G+          SR +   E +  +K     
Sbjct: 61  EEFKRMYPNVNV-QIQAAGSSTAPTALTEGV----AQFGPMSRGMKSGEEEAFEKRYGYK 115

Query: 105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPE 164
              + +  D + +  ++D     LT++ +    +S L   +            +  ++  
Sbjct: 116 PTAIRVAVDALAVFVNKDNPIKGLTMQQVDAVFSSTLKCGEAKAATKWSD-LGLDGNWSS 174

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
             + ++  +   GT    ++  L +G  +S                              
Sbjct: 175 KDLQLFGRNSVSGTYGYFKEHALCDGDFKSG----------------------------- 205

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPI 282
           +         +  +  + +  G+ G+ +  +    + L       I  +    ++G YP+
Sbjct: 206 VNEQPGSASVVQSVSASLNGIGYSGIGYVTSGVRAVPLSKDGKTFIEATADNAITGKYPL 265

Query: 283 SRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           SR L  YV +  +       +E+V   +S       S + + G +P+  +  ++    +
Sbjct: 266 SRFLYVYVNKHPNKPLAPMEQEFVKMMLSKAGQ---SIVAKDGYVPVPAKVVEADLKKL 321


>gi|307298068|ref|ZP_07577872.1| phosphate binding protein [Thermotogales bacterium mesG1.Ag.4.2]
 gi|306916154|gb|EFN46537.1| phosphate binding protein [Thermotogales bacterium mesG1.Ag.4.2]
          Length = 274

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 62/326 (19%), Positives = 133/326 (40%), Gaps = 58/326 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ F V+++  ++     G+       + I GS+T++P +++ AE F    P+ +   +E
Sbjct: 1   MKNFGVLIVILLLAGTMLGS------TLVIKGSNTVYPVAQLWAEGFKAMNPDVEIS-IE 53

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GSS G+K    G      DI NSSR I  +E+++             + +DGI ++ +
Sbjct: 54  GAGSSTGIKALFNG----QTDIANSSRWIKASEIEQMNSD-GKYFIPYVVAYDGIAIIVN 108

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           + +   ++T++ L+            +    +  W++I    P+ RI         GT E
Sbjct: 109 KSLGISNITIQQLFD-----------IYSGKITSWNQIDSSLPKARIVPLSRDNASGTFE 157

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
              + V++                                    ++        + ++  
Sbjct: 158 YFVEHVMKGEKF-----------------------------APQVQQLASTRAEVEQVMQ 188

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N+   G++G+ +       +K + ++G+ P++  + +G YPISRPL  +V   +      
Sbjct: 189 NQYAIGYIGMGYITE---EVKALTVEGVEPTVANVNAGSYPISRPLFMFVDATNGLPTGV 245

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLI 326
           + E++ +++S E  A    +   G +
Sbjct: 246 IGEFLRYALSPEGQAA---VLSVGYV 268


>gi|70733402|ref|YP_263177.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas fluorescens Pf-5]
 gi|68347701|gb|AAY95307.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pseudomonas fluorescens Pf-5]
          Length = 327

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 49/320 (15%), Positives = 105/320 (32%), Gaps = 42/320 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AEN+ + +P      +++ GS+        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAENYKKEYPNVNI-QIQAAGSATAPPALTEG----TSNLGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   EL   ++        + +  D + +   +D     LT+E +    +S  +  
Sbjct: 95  MSRKMKDTELAAFEQKYGYKPTAIPVAVDALAVFVHKDNPIQHLTMEQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K           ++ D     + ++  +   GT    +++ L +G  +           
Sbjct: 155 AKEEVKTWGD-LGVKGDLANKPVQLFGRNSVSGTYGYFKEEALCKGDYK----------- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I  + +  G+ G+ +   +   + L  
Sbjct: 203 ------------------PNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVALAK 244

Query: 265 I---DGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQL 320
               D I  +    ++G YP+SR L  YV +           E+V   +S +       +
Sbjct: 245 KGSTDFIEDTEENALNGKYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSKQGQ---EVV 301

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G IP+  +        +
Sbjct: 302 VKDGYIPLPAKVAAKALADL 321


>gi|323490092|ref|ZP_08095313.1| protein sphX [Planococcus donghaensis MPA1U2]
 gi|323396388|gb|EGA89213.1| protein sphX [Planococcus donghaensis MPA1U2]
          Length = 314

 Score =  154 bits (389), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 73/357 (20%), Positives = 131/357 (36%), Gaps = 61/357 (17%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARNR-------------IRIAGSSTLFPYSKIIAENFS 48
           +F     +    L +     T  +               +   GSST+ P  + I E ++
Sbjct: 5   KFAMASTILGSALILGACGSTDTQETSSETAGEAVVEGTVSGDGSSTVAPIMEGIVEEYA 64

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
              P+ +     SG      ++F +G      D  N+SR I + E    ++ G+   +  
Sbjct: 65  GAQPDVQVTVGTSGTGGG-FEKFIQG----ETDFSNASRPIKEEEAASLEEAGIEYTEFQ 119

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
                  ++VS  +     LTVEDL K                 KKWS+I P++P+  + 
Sbjct: 120 LAYDGLSVVVSQENDWVEDLTVEDLKKLWVED---------GSTKKWSDINPEWPDEEVV 170

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
            Y P    GT +   + +L++  + S                                + 
Sbjct: 171 FYAPGTDSGTFDYFNEVILEDEDLVSSA-----------------------------TLS 201

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLY-PISRPLL 287
            D    +  I+ + +  GF G ++Y  N D LK+V IDG+ P+  TI SG Y P+SRPL 
Sbjct: 202 EDDNTLVQGIQADPNAIGFFGYAYYVANQDTLKVVSIDGVEPNNETIESGEYAPLSRPLF 261

Query: 288 FYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
            Y             +++++++ +      +     G + +  E+       +   K
Sbjct: 262 TYANNASLTDNEAAYDFMTYAIENAG----AMAEAVGYVALPQEDYDKDLADLETLK 314


>gi|331011991|gb|EGH92047.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 333

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/362 (13%), Positives = 112/362 (30%), Gaps = 55/362 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L+          T                    +   GS+TL     + AE + 
Sbjct: 4   KRLMAALIWVAASATAANTLAAVDPAIKAYTRTSGVSGNLSSVGSATLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAVGK 344
           L  YV +           E+V   +S +       + + G IP+     +     + +  
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADLGLQG 325

Query: 345 SG 346
           +G
Sbjct: 326 AG 327


>gi|104784369|ref|YP_610867.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas entomophila L48]
 gi|95113356|emb|CAK18084.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pseudomonas entomophila L48]
          Length = 332

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/320 (15%), Positives = 102/320 (31%), Gaps = 42/320 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE + + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAEAYKKEYPNVNI-QIQAAGSSTAPPALTEG----TANLGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   EL   ++        + +  D + +   +D     LT+  +    +S  +  
Sbjct: 95  MSRKMKDVELQAFEQKYGYKPTAIPVAVDALAVFVHKDNPIKGLTMAQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            K           +  D     I ++  +   GT    +++ L +G  +           
Sbjct: 155 GKSEIKTWGD-VGVTGDLANKPIQLFGRNSVSGTYGYFKEEALCKGDFK----------- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I  + +  G+ G+ +   +   + L  
Sbjct: 203 ------------------PNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVALAK 244

Query: 265 IDG---IVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQL 320
            +G   +  +    ++G YP+SR L  YV +           E+V   +S         +
Sbjct: 245 KEGGAFVEDNEANALNGTYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSQAGQQ---VV 301

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G IP+  +        +
Sbjct: 302 VKDGYIPLPAKVVDKTLADL 321


>gi|86608555|ref|YP_477317.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557097|gb|ABD02054.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 358

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 54/364 (14%), Positives = 116/364 (31%), Gaps = 42/364 (11%)

Query: 2   RFFFVVLMCFVVLEVYCGTG----TFARNRIRI--AGSSTLFPYSKIIAENFSEYFPEFK 55
           R  F+  +   V             FAR  I I  AG++   P  +  A+ F +  P  +
Sbjct: 9   RRSFLKFLSATVAGFAASQTNWQRVFARQTITINGAGATFPAPIYQTWAQEFGKKNPNIQ 68

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDE--CKKHGVSDIQEVTIGHD 113
               +S GS  G ++F       T+D   S       E+++   + +    +  V +   
Sbjct: 69  V-NYQSVGSGAGRRQFVA----RTVDFGASDSVPRPEEINQIENEANPPKGMVSVPMVGG 123

Query: 114 GILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW-------SEIRPDFPEVR 166
            ++   +   V            +    +    +    +K W          +  FP + 
Sbjct: 124 ALVAAYNIPGVGPE---------IRLSRLALANIFLGKIKNWNDPLLAGLNPQVTFPNLP 174

Query: 167 IAIYVPSGKHGTREVLE---KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
           I +   S   GT ++       +  E   +    S +        +        ++Q   
Sbjct: 175 ITVVHRSDGSGTTDIFTTHLNAISPEWKQKVGRGSSVNWPTGVGARGNEGVSEQIKQIPG 234

Query: 224 AIEVDGDYTETLARIEVN--KDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSG--L 279
           +I         L  + +   ++  G       +     L  + +D  +  +    SG   
Sbjct: 235 SIGYVEFGFAKLNNLNIARLENRAGKFVTPNVETEKAALARIQLDERLLGVDPDPSGEDS 294

Query: 280 YPISRPLLF--YVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVR 337
           YPI+       Y       +   +RE++ + +++      +   Q G +P+  E R+   
Sbjct: 295 YPIAGYTWILAYKVYPKAETSKAVREFLRYGLTEGQ----AFAEQLGYVPLPEETRQKAL 350

Query: 338 DSIA 341
            ++ 
Sbjct: 351 AALE 354


>gi|83643636|ref|YP_432071.1| phosphate ABC transporter periplasmic protein [Hahella chejuensis
           KCTC 2396]
 gi|83631679|gb|ABC27646.1| ABC-type phosphate transport system, periplasmic component [Hahella
           chejuensis KCTC 2396]
          Length = 323

 Score =  154 bits (389), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 46/329 (13%), Positives = 106/329 (32%), Gaps = 46/329 (13%)

Query: 19  GTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD 78
              +     +   GS TL     + AE F   +P      +++ GSS        G    
Sbjct: 34  SKASGVSGNLSSVGSDTLANLMTLWAEEFKRNYPNVNI-QIQAAGSSTAPPALTEG---- 88

Query: 79  TIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALA 138
           T ++   SRK+   EL+  +K        + +  D + +   +D     +T+  +    +
Sbjct: 89  TSNMGPMSRKMKDKELEAFEKKFGYKPTAIPVAIDALAVFVHKDNPIKGMTMAQIDAVFS 148

Query: 139 SYLIVDDKVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRN 196
           S            +  W    +        + ++  +   GT    ++  L +G  +   
Sbjct: 149 STRKCG---YSKDVTTWGDLGLTGSMANRSVQLFGRNSVSGTYGYFKEHALCKGDFK--- 202

Query: 197 FSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNN 256
                                       +         +  +  + +  G+ G+ +   +
Sbjct: 203 --------------------------NNVNEQPGSASVVQGVSESVNGIGYSGIGYKTAS 236

Query: 257 ADVLKLVPIDGI---VPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDE 312
             ++ L   +G      S  T ++G YP+SR L  YV +    +    + E++   +S +
Sbjct: 237 VRLVPLAKKEGDKFVEASPATAITGEYPLSRFLYVYVNKAPNKDLDPIVGEFIKMIMSKQ 296

Query: 313 MMAPDSQLFQYGLIPISNEERKSVRDSIA 341
                  + + G +P+ +         ++
Sbjct: 297 GQ---EVVVKDGYVPLPSSVTSKYLKELS 322


>gi|330878117|gb|EGH12266.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 332

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 49/356 (13%), Positives = 105/356 (29%), Gaps = 55/356 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L           T                    +   GS TL     + AE + 
Sbjct: 4   KRLMTALTFVAAGVAATHTFAAVDPAIKAYTKTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    +   +   K           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSVTRLCGAKADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIV---SGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G            +G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDNEANTLNGTYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV +           E+V   +S +       + + G IP+     +     +
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLTDL 321


>gi|71734045|ref|YP_277200.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71554598|gb|AAZ33809.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 332

 Score =  154 bits (388), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 48/356 (13%), Positives = 108/356 (30%), Gaps = 55/356 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L+          T                    +   GS TL     + AE + 
Sbjct: 4   KRLMAALIWGAASATAAITLAAVDPAIKAYTRTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    ++  +   +           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSATRLCGARADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMG---TIVSGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L   +G           ++G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKEGGEFVEDSEANTLNGSYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV +           E+V   +S +       + + G IP+     +     +
Sbjct: 269 LYVYVNKAPNQSLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLADL 321


>gi|152998412|ref|YP_001343247.1| phosphate-binding protein [Marinomonas sp. MWYL1]
 gi|150839336|gb|ABR73312.1| phosphate binding protein [Marinomonas sp. MWYL1]
          Length = 322

 Score =  154 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 50/359 (13%), Positives = 110/359 (30%), Gaps = 59/359 (16%)

Query: 1   MRFFFVVLMCFVVLEVYC-------------GTGTFARNRIRIAGSSTLFPYSKIIAENF 47
           M+     L     + V                  +     I   GS TL     + AE+F
Sbjct: 1   MKKLVAGLAMTAAVSVSVNAFADVDSNLMSYSKASGVSGNISSVGSDTLANLMTLWAEDF 60

Query: 48  SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQE 107
              +P      +++ GSS        G    T +    SR +   E+   +K        
Sbjct: 61  KRLYPNVNI-QIQAAGSSTAPPALTEG----TSNFGPMSRTMKDKEIAAFEKKYGYKPTA 115

Query: 108 VTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFPEV 165
           + +  D + +   +D     L++ ++    +S            +  W +      + + 
Sbjct: 116 IPVAIDALAVFVHKDNPIKGLSLPEVDAIFSSTRKGG---HSEDITTWGKAGLDGAWAKR 172

Query: 166 RIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI 225
            I ++  +   GT    ++  L +G  +                              ++
Sbjct: 173 DIQLFGRNSVSGTYGYFKEHALFKGDFK-----------------------------NSV 203

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG---IVPSMGTIVSGLYPI 282
                    +  +  + +  G+ G+ +  ++   + L   +G   +  ++    SG YP+
Sbjct: 204 NEQPGSASVVQSVSTSLNGIGYSGIGYKTSSVRAVPLTKKEGGAFVDATVENAASGKYPL 263

Query: 283 SRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           SR L  YV +          RE+V   +S         + + G +P+  +        +
Sbjct: 264 SRFLYVYVNKAPNKPLEPLQREFVKMVLSKMGQ---EVVVKDGYVPLPAKVASKYLKDL 319


>gi|302333002|gb|ADL23195.1| ABC-type phosphate transport system, periplasmic component
           [Staphylococcus aureus subsp. aureus JKD6159]
          Length = 327

 Score =  154 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 64/356 (17%), Positives = 125/356 (35%), Gaps = 65/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---------RNRIRIAGSSTLFPYSKIIAENFSEYF 51
           M+ +  V    +   +  G              +   +  GSST+ P  + + E +++  
Sbjct: 1   MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIIEKLNEKWAQDH 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
            + K    ++ G+  G ++F  G     ID  ++SR I   E  + +   +   +     
Sbjct: 61  SDAKISAGQA-GTGAGFQKFIAG----DIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQ 115

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               + V+  +     L  + L             +     K W ++   +P+ +I    
Sbjct: 116 DGVTVAVNKENDFVDELDKQQLKA-----------IYSGKAKTWKDVNSKWPDKKINAVS 164

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P+  HGT +  E +V+ +  +++   +                               D 
Sbjct: 165 PNSSHGTYDFFENEVMNKEDIKAEKNA-------------------------------DT 193

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLYPISRPL 286
              ++ +  NK+  G+ G +FY  N D LK V I         P+  TI    Y +SRPL
Sbjct: 194 NAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKKTIQDNSYALSRPL 253

Query: 287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             YV  +       + E++ F + D+  A      + G +    +  KS  D +  
Sbjct: 254 FIYVNEKALKDNKVMSEFIKFVLEDKGKA----AEEAGYVAAPEKTYKSQLDDLKA 305


>gi|289208142|ref|YP_003460208.1| phosphate binding protein [Thioalkalivibrio sp. K90mix]
 gi|288943773|gb|ADC71472.1| phosphate binding protein [Thioalkalivibrio sp. K90mix]
          Length = 324

 Score =  154 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 54/321 (16%), Positives = 105/321 (32%), Gaps = 45/321 (14%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE F  ++P      ++  G+S        G    T D   
Sbjct: 41  SGNLSSIGSDTLNNLMTLWAEEFQNFYPNVNV-QIQGAGTSTAPPALTEG----TADFGP 95

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR    +E  E ++    ++  V +  D I +  +RD     LT+E +    +S     
Sbjct: 96  MSRMPRDSEHAEFEQRHGYEMTAVPVAIDTIAVYVNRDNPIEGLTIEQVDAIFSSTRRCG 155

Query: 145 DKVVFNPLKKWSEI--RPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
                  + +W ++     +    I +Y  +   GT     +  L +G  +         
Sbjct: 156 GA---EDITRWGQVGLDGSWENRDITLYSRNAVSGTYGFFRQHALCDGDFK--------- 203

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                AI         +  +  + +  G+ G+ +  +    + L
Sbjct: 204 --------------------DAINEQPGSASVVQGVSESLNGIGYSGIGYMTSGVRAVPL 243

Query: 263 VPIDG--IVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQ 319
              +G    P+     SG YP++R L   V +           E++   +S E       
Sbjct: 244 GENEGEYYEPTADNASSGDYPLARFLYVMVNKHPEDGLTPRAAEFLRMVLSKEGQ---EV 300

Query: 320 LFQYGLIPISNEERKSVRDSI 340
           + + G IP+     +  R ++
Sbjct: 301 VVRDGFIPLPAAVAERERKNL 321


>gi|89092202|ref|ZP_01165156.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanospirillum sp. MED92]
 gi|89083290|gb|EAR62508.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Oceanospirillum sp. MED92]
          Length = 323

 Score =  154 bits (387), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 52/356 (14%), Positives = 109/356 (30%), Gaps = 54/356 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGT------------GTFARNRIRIAGSSTLFPYSKIIAENFS 48
           M+  F  +           +             +     +   GS TL     + AE F 
Sbjct: 4   MKKLFAAVAISATCVAANASDLLDKNLPVYTKASGVSGNLSSVGSDTLANLMTLWAEEFK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
             +P      +++ GSS        G    T +I   SRK+   E++  +K        V
Sbjct: 64  RSYPNVNI-QIQAAGSSTAPPALTEG----TSNIGPMSRKMKDKEIEAFEKKFGYKPTPV 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + + + +D     LT+  +    +S                  +     +  I 
Sbjct: 119 AVAIDALAVFAHKDNPVKGLTIAQVDAIFSSTRKCGAAADAKTWGD-VGVSGALADKSIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +KK L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKKKGLCKGDFK-----------------------------NNVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI---VPSMGTIVSGLYPISRP 285
                 +  +  + +  G+ G+ +   +   L L   +G      +    ++G YP++R 
Sbjct: 209 PGSASVVQSVSTSLNAIGYSGIGYKTASVRALPLTKKEGTAFVEATPANALNGKYPLARS 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV ++         +E++   +S         + + G IP+     K    ++
Sbjct: 269 LYVYVNKKPGQPLAPLEKEFLKMVMSKVGQ---EVVVKDGYIPLPAAVVKKQMAAL 321


>gi|282916656|ref|ZP_06324414.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           D139]
 gi|283770461|ref|ZP_06343353.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           H19]
 gi|282319143|gb|EFB49495.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           D139]
 gi|283460608|gb|EFC07698.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           H19]
          Length = 327

 Score =  154 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/356 (17%), Positives = 125/356 (35%), Gaps = 65/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---------RNRIRIAGSSTLFPYSKIIAENFSEYF 51
           M+ +  V    +   +  G              +   +  GSST+ P  + + E +++  
Sbjct: 1   MKKWQFVGTTALGATLLLGACGGGNSGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
            + K    ++ G+  G ++F  G     ID  ++SR I   E  + +   +   +     
Sbjct: 61  SDAKISAGQA-GTGAGFQKFIAG----DIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQ 115

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               + V+  +     L  + L             +     K W ++   +P+ +I    
Sbjct: 116 DGVTVAVNKENDFVDELDKQQLKA-----------IYSGKAKTWKDVNSKWPDKKINAVS 164

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P+  HGT +  E +V+ +  +++   +                               D 
Sbjct: 165 PNSSHGTYDFFENEVMNKEDIKAEKNA-------------------------------DT 193

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLYPISRPL 286
              ++ +  NK+  G+ G +FY  N D LK V I         P+  TI    Y +SRPL
Sbjct: 194 NAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKKTIQDNSYALSRPL 253

Query: 287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             YV  +       + E++ F + D+  A      + G +    +  KS  D +  
Sbjct: 254 FIYVNEKALKDNKVMSEFIKFVLEDKGKA----AEEAGYVAAPEKTYKSQLDDLKA 305


>gi|148981001|ref|ZP_01816250.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Vibrionales bacterium SWAT-3]
 gi|145961041|gb|EDK26363.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Vibrionales bacterium SWAT-3]
          Length = 318

 Score =  154 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 56/354 (15%), Positives = 111/354 (31%), Gaps = 52/354 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR-----------NRIRIAGSSTLFPYSKIIAENFSE 49
           MR     L+  V+        +                +   GS TL   + +  E F  
Sbjct: 1   MRLPIGSLLAMVLACPSFAEQSVESLPDYSKVPGISGSLLSVGSDTLAGMTTLWVEEFKS 60

Query: 50  YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVT 109
           Y+P      V++ GSS        G    T  +   SR +   E++  ++        + 
Sbjct: 61  YYPNVN-AQVQASGSSTAPPALTEG----TAHLGPMSRPMRLREVEAFEREHGYKPTALR 115

Query: 110 IGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI 169
           +  D I L   RD     L    +    +  L        N  +    I   + + R  +
Sbjct: 116 VAIDAIGLFVHRDNPIEGLNFRQIDGIFSETLRCGATRPLNNWQD-LGIDQPWAKHRFQL 174

Query: 170 YVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDG 229
           +  +   GT    ++  L  G  ++R                             +    
Sbjct: 175 FGRNSVSGTYGYFKQNALCGGDFKNR-----------------------------VNEQP 205

Query: 230 DYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISRPLL 287
                +  +  +    G+ G+ +      ++ +     + + P+   I+SG YP+SR L 
Sbjct: 206 GSASVVQSVASSISGIGYSGIGYRVAGVKLIPIAEHGSNYVEPTRENILSGDYPLSRFLY 265

Query: 288 FYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            YV +          RE+++F  S +       + + G + I +E  +     +
Sbjct: 266 VYVNKHPDKPLSPVEREFLTFVFSKQGQ---ELVEKDGYLAIPSEFAEQELAKV 316


>gi|15924379|ref|NP_371913.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu50]
 gi|15926969|ref|NP_374502.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus N315]
 gi|21283006|ref|NP_646094.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus MW2]
 gi|49486231|ref|YP_043452.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57651889|ref|YP_186276.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus COL]
 gi|87161503|ref|YP_493980.1| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|88195116|ref|YP_499916.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|148267877|ref|YP_001246820.1| phosphate binding protein [Staphylococcus aureus subsp. aureus JH9]
 gi|150393941|ref|YP_001316616.1| phosphate binding protein [Staphylococcus aureus subsp. aureus JH1]
 gi|151221512|ref|YP_001332334.1| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus str. Newman]
 gi|156979708|ref|YP_001441967.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu3]
 gi|161509556|ref|YP_001575215.1| phosphate ABC transporter ATP-binding protein [Staphylococcus
           aureus subsp. aureus USA300_TCH1516]
 gi|221140586|ref|ZP_03565079.1| phosphate ABC transporter ATP-binding protein [Staphylococcus
           aureus subsp. aureus str. JKD6009]
 gi|253317017|ref|ZP_04840230.1| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus str. CF-Marseille]
 gi|253732024|ref|ZP_04866189.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|255006178|ref|ZP_05144779.2| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus Mu50-omega]
 gi|257795556|ref|ZP_05644535.1| thioredoxine reductase [Staphylococcus aureus A9781]
 gi|258413364|ref|ZP_05681640.1| thioredoxine reductase [Staphylococcus aureus A9763]
 gi|258420529|ref|ZP_05683471.1| thioredoxine reductase [Staphylococcus aureus A9719]
 gi|258423653|ref|ZP_05686541.1| thioredoxine reductase [Staphylococcus aureus A9635]
 gi|258434699|ref|ZP_05688773.1| phosphate-binding protein pstS [Staphylococcus aureus A9299]
 gi|258444725|ref|ZP_05693054.1| thioredoxine reductase [Staphylococcus aureus A8115]
 gi|258447440|ref|ZP_05695584.1| thioredoxine reductase [Staphylococcus aureus A6300]
 gi|258449281|ref|ZP_05697384.1| thioredoxine reductase [Staphylococcus aureus A6224]
 gi|258451786|ref|ZP_05699810.1| thioredoxine reductase [Staphylococcus aureus A5948]
 gi|258454661|ref|ZP_05702625.1| thioredoxine reductase [Staphylococcus aureus A5937]
 gi|262049858|ref|ZP_06022721.1| thioredoxine reductase [Staphylococcus aureus D30]
 gi|269203011|ref|YP_003282280.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus ED98]
 gi|282892881|ref|ZP_06301116.1| phosphate-binding protein pstS [Staphylococcus aureus A8117]
 gi|282926211|ref|ZP_06333845.1| phosphate-binding protein pstS [Staphylococcus aureus A9765]
 gi|282928949|ref|ZP_06336538.1| phosphate-binding protein pstS [Staphylococcus aureus A10102]
 gi|284024390|ref|ZP_06378788.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus 132]
 gi|294848395|ref|ZP_06789142.1| phosphate-binding protein pstS [Staphylococcus aureus A9754]
 gi|295406335|ref|ZP_06816142.1| phosphate-binding protein pstS [Staphylococcus aureus A8819]
 gi|296276661|ref|ZP_06859168.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus MR1]
 gi|297207957|ref|ZP_06924388.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297244564|ref|ZP_06928447.1| phosphate-binding protein pstS [Staphylococcus aureus A8796]
 gi|300912041|ref|ZP_07129484.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|81649338|sp|Q6G9H1|PSTS_STAAS RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|81694529|sp|Q5HG31|PSTS_STAAC RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|81704436|sp|Q7A0X7|PSTS_STAAW RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|81704844|sp|Q7A2S1|PSTS_STAAM RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|81705716|sp|Q7A5Q2|PSTS_STAAN RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|122539596|sp|Q2FYP6|PSTS_STAA8 RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|123485982|sp|Q2FH48|PSTS_STAA3 RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|6434037|emb|CAB60743.1| thioredoxine reductase [Staphylococcus aureus]
 gi|13701186|dbj|BAB42481.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus N315]
 gi|14247160|dbj|BAB57551.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu50]
 gi|21204445|dbj|BAB95142.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus MW2]
 gi|49244674|emb|CAG43106.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           MSSA476]
 gi|57286075|gb|AAW38169.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus COL]
 gi|87127477|gb|ABD21991.1| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus USA300_FPR3757]
 gi|87202674|gb|ABD30484.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Staphylococcus aureus subsp. aureus NCTC 8325]
 gi|147740946|gb|ABQ49244.1| phosphate binding protein [Staphylococcus aureus subsp. aureus JH9]
 gi|149946393|gb|ABR52329.1| phosphate binding protein [Staphylococcus aureus subsp. aureus JH1]
 gi|150374312|dbj|BAF67572.1| phosphate ABC transporter, phosphate-binding protein PstS
           [Staphylococcus aureus subsp. aureus str. Newman]
 gi|156721843|dbj|BAF78260.1| thioredoxine reductase [Staphylococcus aureus subsp. aureus Mu3]
 gi|160368365|gb|ABX29336.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus
           USA300_TCH1516]
 gi|253724265|gb|EES92994.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus
           USA300_TCH959]
 gi|257789528|gb|EEV27868.1| thioredoxine reductase [Staphylococcus aureus A9781]
 gi|257839928|gb|EEV64396.1| thioredoxine reductase [Staphylococcus aureus A9763]
 gi|257843477|gb|EEV67884.1| thioredoxine reductase [Staphylococcus aureus A9719]
 gi|257846151|gb|EEV70177.1| thioredoxine reductase [Staphylococcus aureus A9635]
 gi|257849060|gb|EEV73042.1| phosphate-binding protein pstS [Staphylococcus aureus A9299]
 gi|257850218|gb|EEV74171.1| thioredoxine reductase [Staphylococcus aureus A8115]
 gi|257853631|gb|EEV76590.1| thioredoxine reductase [Staphylococcus aureus A6300]
 gi|257857269|gb|EEV80167.1| thioredoxine reductase [Staphylococcus aureus A6224]
 gi|257860617|gb|EEV83441.1| thioredoxine reductase [Staphylococcus aureus A5948]
 gi|257863044|gb|EEV85808.1| thioredoxine reductase [Staphylococcus aureus A5937]
 gi|259162082|gb|EEW46661.1| thioredoxine reductase [Staphylococcus aureus D30]
 gi|262075301|gb|ACY11274.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus ED98]
 gi|269940885|emb|CBI49267.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           TW20]
 gi|282589458|gb|EFB94548.1| phosphate-binding protein pstS [Staphylococcus aureus A10102]
 gi|282592275|gb|EFB97293.1| phosphate-binding protein pstS [Staphylococcus aureus A9765]
 gi|282764878|gb|EFC05003.1| phosphate-binding protein pstS [Staphylococcus aureus A8117]
 gi|285817067|gb|ADC37554.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Staphylococcus aureus 04-02981]
 gi|294825195|gb|EFG41617.1| phosphate-binding protein pstS [Staphylococcus aureus A9754]
 gi|294968923|gb|EFG44945.1| phosphate-binding protein pstS [Staphylococcus aureus A8819]
 gi|296887200|gb|EFH26102.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus ATCC 51811]
 gi|297178594|gb|EFH37840.1| phosphate-binding protein pstS [Staphylococcus aureus A8796]
 gi|300886287|gb|EFK81489.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus TCH70]
 gi|302751219|gb|ADL65396.1| ABC-type phosphate transport system, periplasmic component
           [Staphylococcus aureus subsp. aureus str. JKD6008]
 gi|312829784|emb|CBX34626.1| phosphate binding family protein [Staphylococcus aureus subsp.
           aureus ECT-R 2]
 gi|315131196|gb|EFT87180.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus CGS03]
 gi|315196350|gb|EFU26702.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus CGS01]
 gi|320140280|gb|EFW32138.1| phosphate binding protein [Staphylococcus aureus subsp. aureus
           MRSA131]
 gi|320143948|gb|EFW35720.1| phosphate binding protein [Staphylococcus aureus subsp. aureus
           MRSA177]
 gi|323441174|gb|EGA98881.1| phosphate-binding lipoprotein [Staphylococcus aureus O11]
 gi|323444043|gb|EGB01654.1| phosphate-binding lipoprotein [Staphylococcus aureus O46]
 gi|329314065|gb|AEB88478.1| Phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           T0131]
 gi|329727527|gb|EGG63983.1| phosphate binding protein [Staphylococcus aureus subsp. aureus
           21172]
 gi|329728913|gb|EGG65331.1| phosphate binding protein [Staphylococcus aureus subsp. aureus
           21193]
          Length = 327

 Score =  154 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/356 (17%), Positives = 125/356 (35%), Gaps = 65/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---------RNRIRIAGSSTLFPYSKIIAENFSEYF 51
           M+ +  V    +   +  G              +   +  GSST+ P  + + E +++  
Sbjct: 1   MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
            + K    ++ G+  G ++F  G     ID  ++SR I   E  + +   +   +     
Sbjct: 61  SDAKISAGQA-GTGAGFQKFIAG----DIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQ 115

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               + V+  +     L  + L             +     K W ++   +P+ +I    
Sbjct: 116 DGVTVAVNKENDFVDELDKQQLKA-----------IYSGKAKTWKDVNSKWPDKKINAVS 164

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P+  HGT +  E +V+ +  +++   +                               D 
Sbjct: 165 PNSSHGTYDFFENEVMNKEDIKAEKNA-------------------------------DT 193

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLYPISRPL 286
              ++ +  NK+  G+ G +FY  N D LK V I         P+  TI    Y +SRPL
Sbjct: 194 NAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKKTIQDNSYALSRPL 253

Query: 287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             YV  +       + E++ F + D+  A      + G +    +  KS  D +  
Sbjct: 254 FIYVNEKALKDNKVMSEFIKFVLEDKGKA----AEEAGYVAAPEKTYKSQLDDLKA 305


>gi|70726523|ref|YP_253437.1| thioredoxine reductase [Staphylococcus haemolyticus JCSC1435]
 gi|123660170|sp|Q4L694|PSTS_STAHJ RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|68447247|dbj|BAE04831.1| thioredoxine reductase [Staphylococcus haemolyticus JCSC1435]
          Length = 316

 Score =  154 bits (387), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 67/352 (19%), Positives = 129/352 (36%), Gaps = 69/352 (19%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENF 47
           M+ + +V    +   V  G                  +   +  GSST+ P  + + E +
Sbjct: 1   MKKWQLVGTTVLGASVLLGACGGGDSSGSGSGDGKDLKGEAKGEGSSTVAPIVEKLNEKW 60

Query: 48  SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQE 107
           ++  P       ++ G+  G ++F  G      D   +SR I   E  + +   +   + 
Sbjct: 61  AKDHPNATISSGQA-GTGAGFEKFIAG----ETDFSQASRPIKDEEKQKLEDKDIKYKEF 115

Query: 108 VTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRI 167
                   + V+  +     L+ + L K           +     K W ++   +P+ +I
Sbjct: 116 KIAQDGVTVAVNKDNDFVKELSKDQLKK-----------IYNGEAKTWKDVNSSWPDKKI 164

Query: 168 AIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEV 227
             + P+  HGT +  E++V+ +  +++                                 
Sbjct: 165 KAFSPNSSHGTYDFFEEEVMDKEDIKAEK------------------------------- 193

Query: 228 DGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI-----VPSMGTIVSGLYPI 282
           +GD    +  +E NK+  G+ G +FY+ N D LK V I         P+  TI  G Y +
Sbjct: 194 NGDTNVIVQSVEKNKEGIGYFGYNFYEQNKDKLKEVKIKDDKGKTTEPTKKTIKDGSYAL 253

Query: 283 SRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERK 334
           SRPL  YVK +       +RE++ F++ D+  +        G +    +  K
Sbjct: 254 SRPLFLYVKEKSLKDNDVMREFIKFTLEDKGKS----AEDAGYVASPEKTYK 301


>gi|253733363|ref|ZP_04867528.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus TCH130]
 gi|253728631|gb|EES97360.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus TCH130]
          Length = 327

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 64/356 (17%), Positives = 125/356 (35%), Gaps = 65/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---------RNRIRIAGSSTLFPYSKIIAENFSEYF 51
           M+ +  V    +   +  G              +   +  GSST+ P  + + E +++  
Sbjct: 1   MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
            + K    ++ G+  G ++F  G     ID  ++SR I   E  + +   +   +     
Sbjct: 61  SDAKISAGQA-GTGAGFQKFIAG----DIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQ 115

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               + V+  +     L  + L             +     K W ++   +P+ +I    
Sbjct: 116 DGVTVAVNKENDFVDELDKQQLKA-----------IYSGKAKTWKDVNSKWPDKKINAVS 164

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P+  HGT +  E +V+ +  +++   +                               D 
Sbjct: 165 PNSSHGTYDFFENEVMNKEDIKAEKNA-------------------------------DT 193

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLYPISRPL 286
              ++ +  NK+  G+ G +FY  N D LK V I         P+  TI    Y +SRPL
Sbjct: 194 NAIVSSVTKNKEGIGYFGYNFYIQNKDKLKEVKIKDENGKATEPTKKTIQDNSYALSRPL 253

Query: 287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             YV  +       + E++ F + D+  A      + G +    +  KS  D +  
Sbjct: 254 FIYVNEKALKDNKVMSEFIKFVLEDKGKA----AEEAGYVAAPEKTYKSQLDDLKA 305


>gi|307825827|ref|ZP_07656043.1| phosphate binding protein [Methylobacter tundripaludum SV96]
 gi|307733135|gb|EFO03996.1| phosphate binding protein [Methylobacter tundripaludum SV96]
          Length = 328

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 46/326 (14%), Positives = 110/326 (33%), Gaps = 45/326 (13%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
            +     +   GS TL     + AE F+  +P      +++ GSS        G    T 
Sbjct: 43  ASGISGNLSSVGSDTLANLMTLWAEEFNRAYPNVNI-QIQAAGSSTAPPALTEG----TS 97

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           ++   SR++  +EL+  +         + +  D + ++ ++D     LT+E +    +S 
Sbjct: 98  NLGPMSREMKDDELEAFEDKYGYKPTAIPVAVDALAVLVNKDNPVKGLTMEQVDSIFSST 157

Query: 141 LIVDDKVVFNPLKKWSEIRP-DFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
                +     ++ W +     +    I +Y  +   GT    ++  L +G  +      
Sbjct: 158 NKCGGE---KSIESWGDAGVAAWGSKSIQLYGRNSVSGTYGYFKEHALCKGDFK------ 208

Query: 200 MRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADV 259
                                    +         +  +  + +  G+ G+ +  +   +
Sbjct: 209 -----------------------NNVNEQPGSASVVQSVTSSVNGIGYSGMGYTTSGVKM 245

Query: 260 LKLVPID---GIVPSMGTIVSGLYPISRPLLFYVKRQHFN-SVLGLREYVSFSVSDEMMA 315
           + L        +  +    ++G YP++R L  YV ++          E++   +S     
Sbjct: 246 VPLAKKGSKTFVEATPENAIAGTYPLTRYLYIYVNKKPNQPLAPLDNEFIKMVLSKTGQQ 305

Query: 316 PDSQLFQYGLIPISNEERKSVRDSIA 341
               + + G IP+  +    V  ++ 
Sbjct: 306 ---VVIKDGYIPLPAKVVDKVLATLK 328


>gi|228476002|ref|ZP_04060710.1| protein SphX [Staphylococcus hominis SK119]
 gi|314936465|ref|ZP_07843812.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus hominis subsp. hominis C80]
 gi|228269825|gb|EEK11305.1| protein SphX [Staphylococcus hominis SK119]
 gi|313655084|gb|EFS18829.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus hominis subsp. hominis C80]
          Length = 316

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 67/321 (20%), Positives = 124/321 (38%), Gaps = 56/321 (17%)

Query: 29  RIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRK 88
           +  GSST+ P  + + E +++  P       ++ G+  G ++F  G      D   +SR 
Sbjct: 42  KGEGSSTVAPIVEKLNEKWAKDHPSATISSGQA-GTGAGFEKFIAG----ETDFSQASRP 96

Query: 89  ITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVV 148
           I   E  + +   +   +         + V+  +     L+ + L K           + 
Sbjct: 97  IKDEEKQKLEDKNIKYKEFKIAQDGVTVAVNKDNDFVKELSKDQLKK-----------IY 145

Query: 149 FNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNV 208
               K W ++   +P   I  + P+  HGT +  E++V+ +  +++              
Sbjct: 146 SGEAKTWKDVDSSWPNKEIKAFSPNSSHGTYDFWEEEVMDKQDIKA-------------- 191

Query: 209 QQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI 268
                            + +GD    +  +E NK+  G+ G +FYK N D LK V I G 
Sbjct: 192 -----------------QKNGDTNVIVQSVEKNKESIGYFGYNFYKQNKDKLKEVKIKGD 234

Query: 269 -----VPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQY 323
                 P+  TI  G YP+SRPL  YVK +       +RE++ F++ D+  +        
Sbjct: 235 DGKSVEPTKKTIQDGSYPLSRPLFLYVKEKSLEDNDVMREFLKFTLDDKGKS----AEDA 290

Query: 324 GLIPISNEERKSVRDSIAVGK 344
           G +   ++  K     +   K
Sbjct: 291 GYVASPSKVYKDEIKELDKYK 311


>gi|27467988|ref|NP_764625.1| thioredoxine reductase [Staphylococcus epidermidis ATCC 12228]
 gi|251810818|ref|ZP_04825291.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis BCM-HMP0060]
 gi|282876174|ref|ZP_06285041.1| phosphate binding protein [Staphylococcus epidermidis SK135]
 gi|293366647|ref|ZP_06613324.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|81842853|sp|Q8CP98|PSTS_STAES RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|27315533|gb|AAO04667.1|AE016747_164 thioredoxine reductase [Staphylococcus epidermidis ATCC 12228]
 gi|251805653|gb|EES58310.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis BCM-HMP0060]
 gi|281295199|gb|EFA87726.1| phosphate binding protein [Staphylococcus epidermidis SK135]
 gi|291319416|gb|EFE59785.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis M23864:W2(grey)]
 gi|329732932|gb|EGG69277.1| phosphate binding protein [Staphylococcus epidermidis VCU028]
 gi|329736947|gb|EGG73205.1| phosphate binding protein [Staphylococcus epidermidis VCU045]
          Length = 325

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 68/356 (19%), Positives = 129/356 (36%), Gaps = 66/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA----------RNRIRIAGSSTLFPYSKIIAENFSEY 50
           M+ + +V    +   V  G               +   +  GSST+ P  + + E +++ 
Sbjct: 1   MKKWQLVGTTVLGASVLLGACGGNDGGSGDGKDLKGSAKGEGSSTVAPIVEKLNEKWAKD 60

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
             + K    ++ G+  G ++F  G      D  ++SR I   E  + +  G+   +    
Sbjct: 61  HKDAKISSGQA-GTGAGFQKFIAG----ETDFSDASRPIKDEEKKKLEDKGIKYHEFKIA 115

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
                + V+  +     LT   L             +     K W ++   +P+ +I   
Sbjct: 116 QDGVTIAVNKDNDFVKELTKSQLKD-----------IYSGKAKTWKDVNSSWPDKKINAV 164

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
            P+  HGT +  E++V+ +  +++   +                               D
Sbjct: 165 SPNSSHGTYDFFEEEVMDKQDIKAEKNA-------------------------------D 193

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI-----VPSMGTIVSGLYPISRP 285
               ++ +  NK+  G+ G +FY+ N D LK V I         P+  TI +G Y +SRP
Sbjct: 194 TNAIVSSVTKNKEGIGYFGYNFYEQNKDKLKEVKIKDDNGKVTEPTKKTIQNGSYALSRP 253

Query: 286 LLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           L  Y K +       + E++ F + DE  A        G +    +  KS  D + 
Sbjct: 254 LFIYAKDKSLKDNKVMSEFMKFVLEDEGKA----AEDAGYVASPKKTYKSQLDDLK 305


>gi|329729388|gb|EGG65794.1| phosphate binding protein [Staphylococcus epidermidis VCU144]
          Length = 325

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 68/356 (19%), Positives = 129/356 (36%), Gaps = 66/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA----------RNRIRIAGSSTLFPYSKIIAENFSEY 50
           M+ + +V    +   V  G               +   +  GSST+ P  + + E +++ 
Sbjct: 1   MKKWQLVGTTVLGASVLLGACGGNDGGSGDGKDLKGSAKGEGSSTVAPIVEKLNEKWAKD 60

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
             + K    ++ G+  G ++F  G      D  ++SR I   E  + +  G+   +    
Sbjct: 61  HKDAKISSGQA-GTGAGFQKFIAG----ETDFSDASRPIKDEEKKKLEDKGIKYHEFKIA 115

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
                + V+  +     LT   L             +     K W ++   +P+ +I   
Sbjct: 116 QDGVTIAVNKDNDFVKELTKSQLKD-----------IYSGKAKTWKDVNSSWPDKKINAV 164

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
            P+  HGT +  E++V+ +  +++   +                               D
Sbjct: 165 SPNSIHGTYDFFEEEVMDKQDIKAEKNA-------------------------------D 193

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI-----VPSMGTIVSGLYPISRP 285
               ++ +  NK+  G+ G +FY+ N D LK V I         P+  TI +G Y +SRP
Sbjct: 194 TNAIVSSVTKNKEGIGYFGYNFYEQNKDKLKEVKIKDDNGKVTEPTKKTIQNGSYALSRP 253

Query: 286 LLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           L  Y K +       + E++ F + DE  A        G +    +  KS  D + 
Sbjct: 254 LFIYAKDKSLKDNKVMSEFMKFVLEDEGKA----AEDAGYVASPKKTYKSQLDDLK 305


>gi|87121059|ref|ZP_01076950.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Marinomonas sp. MED121]
 gi|86163551|gb|EAQ64825.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Marinomonas sp. MED121]
          Length = 334

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 51/360 (14%), Positives = 107/360 (29%), Gaps = 60/360 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN--------------RIRIAGSSTLFPYSKIIAEN 46
           M    V  +          +   A +               I   GS TL     + AE+
Sbjct: 12  MMKNLVAGLALTAAASLSVSAVAAVDPMLPSYNKASGVSGNISSVGSDTLANLMTLWAED 71

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           F   +P      +++ GSS        G    T +    SR +   E+   +K       
Sbjct: 72  FKRLYPNVNI-QIQAAGSSTAPPALTEG----TSNFGPMSRTMKDKEVAAFEKKFGYKPT 126

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFPE 164
            V +  D + +   +D     L++  +    +S            +  W        +  
Sbjct: 127 AVPVAIDALAVFVHKDNPIKGLSLPQIDAIFSSTRKGG---HSENISNWGATGLTGAWAN 183

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
             + ++  +   GT    + K L +G  +                              +
Sbjct: 184 RDVQLFGRNSVSGTYGYFKSKALFKGDYK-----------------------------NS 214

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG---IVPSMGTIVSGLYP 281
           +         +  +  + +  G+ G+ +  ++   + L   +G   I  +     +G YP
Sbjct: 215 VNEQPGSASVVQSVSTSLNGIGYSGIGYKTSSVRAIPLAKKEGGKFIDATPANAATGAYP 274

Query: 282 ISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +SR L  YV +          RE+V   +S         + + G +P+ ++        +
Sbjct: 275 LSRFLYVYVNKAPNKPLDPLQREFVKMVLSQLGQ---EVVVKDGYVPLPSKVVNKYLSDL 331


>gi|308185869|ref|YP_003930000.1| phosphate-binding protein pstS precursor (PBP) [Pantoea vagans
           C9-1]
 gi|308056379|gb|ADO08551.1| Phosphate-binding protein pstS precursor (PBP) [Pantoea vagans
           C9-1]
          Length = 317

 Score =  153 bits (386), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 52/330 (15%), Positives = 100/330 (30%), Gaps = 40/330 (12%)

Query: 15  EVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRG 74
            +           +   GS TL     +  E+FS   P      V++ GSS        G
Sbjct: 25  GLALAQPGALSGNLSSVGSDTLGYLMTLWGEDFSRQAPGVNV-QVQASGSSTAPTALAAG 83

Query: 75  IGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLY 134
                      SR +  +E    +         V +  D +++V ++      +    L 
Sbjct: 84  AAQLGP----MSRPMQADERQAFEARYGYPPLAVPVAMDALVVVVNQRNPLQQIEPRQLD 139

Query: 135 KALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
              +   +     V             + E  I  Y  +   GT    +++VL +G  RS
Sbjct: 140 AIFSITRLCGAHSVPLRWGDLGLTGDQWRERPIQRYGRNSASGTWGFFKQQVLCKGDFRS 199

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
                                         +         +  +  N    G+    F+ 
Sbjct: 200 D-----------------------------VAEFPGSAAVVQAVAGNSRSIGYASFGFHL 230

Query: 255 NNADVLKLVPIDGI--VPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSD 311
           +   +L ++   G    P    I SG YP +RPL  YV +         +  ++   +S 
Sbjct: 231 SGVKMLAVMNDQGQAIAPDADAIRSGRYPWARPLYLYVNKAPGKPLPPLVAAFLQQVLSV 290

Query: 312 EMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           +       + + G +P+S+ +    R ++ 
Sbjct: 291 QGQRR---VSEAGYLPLSDSQMAQARAALQ 317


>gi|330830654|ref|YP_004393606.1| phosphate ABC transporter periplasmic protein [Aeromonas veronii
           B565]
 gi|328805790|gb|AEB50989.1| ABC-type phosphate transport system, periplasmic component
           [Aeromonas veronii B565]
          Length = 324

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 46/359 (12%), Positives = 107/359 (29%), Gaps = 57/359 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------------RIRIAGSSTLFPYSKIIA 44
           M+   +  +              A                   +   GS TL     + A
Sbjct: 1   MKLNKLAGVIGFTAATLFSVSALAAGVDKDLPDYTPTSGISGNLSSVGSDTLANMMTLWA 60

Query: 45  ENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD 104
           E F   +P      +++ GSS        G+          SR +   E +  +K     
Sbjct: 61  EEFKRLYPNVNV-QIQAAGSSTAPTALTEGV----AQFGPMSRAMKAGEEEAFEKRYGYK 115

Query: 105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPE 164
              + +  D + +  ++D     LT+  +    +S L   +            +  ++  
Sbjct: 116 PTAIRVAVDALAVFVNKDNPIKGLTMPQIDAIFSSTLKCGEAKAATKWSD-LGLDGNWSS 174

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
             + ++  +   GT    ++  L  G  +S                              
Sbjct: 175 KDLQLFGRNSVSGTYGYFKEHALCNGDFKSG----------------------------- 205

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPI 282
           +         +  +  + +  G+ G+ +  +    + L       I  +    ++G YP+
Sbjct: 206 VNEQPGSASVVQSVSASLNGIGYSGIGYVTSGVRAVPLSKDGKTFIEATSDNAITGKYPL 265

Query: 283 SRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           SR L  YV +  +       +E+V   +S       + + + G +P+  +  ++    +
Sbjct: 266 SRFLYVYVNKHPNKPLSPMEQEFVKMMLSKAGQ---NIVAKDGYVPVPAKVVQADLKKL 321


>gi|271499557|ref|YP_003332582.1| phosphate-binding protein [Dickeya dadantii Ech586]
 gi|270343112|gb|ACZ75877.1| phosphate binding protein [Dickeya dadantii Ech586]
          Length = 324

 Score =  153 bits (386), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 57/348 (16%), Positives = 114/348 (32%), Gaps = 48/348 (13%)

Query: 1   MR--FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPF 58
           M+   +   L+  +  ++           +  AGS TL       A +FS++ P      
Sbjct: 1   MKPVRYLFALLLCLSGQLAAAPQAMLAGNLSSAGSDTLANLMTFWAADFSQHHPGVNLQV 60

Query: 59  VESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLV 118
             +G SS                    SR +  +E++  ++H       V +  D ++++
Sbjct: 61  QAAGSSSAPTALAAGAAQLGP-----MSRPMKSSEIEAFEQHYGYAPTAVPVALDALVVL 115

Query: 119 SDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSE--IRPDFPEVRIAIYVPSGKH 176
            ++D     LTV  L    +             +++W E  +   + +  +  Y  +   
Sbjct: 116 VNQDNPLTGLTVRQLDAIFSITRRCG---AGKTVQRWQELGLNGVWQQRSLLRYGRNSAS 172

Query: 177 GTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236
           GT    +++ L  G                                  +         + 
Sbjct: 173 GTYGFFKQQALCGGDF-----------------------------LPQVNELPGSASVVQ 203

Query: 237 RIEVNKDVFGFVGLSFYKNNADVLKLV---PIDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
            +  + +  G+  + F  +   VL L      D ++P+  TI SG YP +R L  YV + 
Sbjct: 204 AVAASVNAIGYASIGFRASGVRVLALAISDKDDYVLPTADTIRSGRYPYTRYLYIYVNKT 263

Query: 294 HFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
                      ++   +S    A    + Q G +P+    R+  R S+
Sbjct: 264 PGQPLEPLTAAFLDRVLSVSGQA---LVSQDGYLPLPEMVREQTRRSL 308


>gi|302390899|ref|YP_003826719.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Acetohalobium arabaticum DSM 5501]
 gi|302202976|gb|ADL11654.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Acetohalobium arabaticum DSM 5501]
          Length = 274

 Score =  153 bits (385), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 62/326 (19%), Positives = 122/326 (37%), Gaps = 57/326 (17%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
              V+L   +++ +       A + + + GSST+ P ++  AE + +  P      V  G
Sbjct: 5   RNLVILSVLLMVCMMSVGVASASDTLSVQGSSTVLPIAQRAAEVYMDQNPGVNI-TVRGG 63

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           GS  G+     G     +D+ ++SR I   EL + + +G+       +  DGI  V    
Sbjct: 64  GSGNGIAALVDGA----VDVADASRFIKPGELKQAEDNGIYP-VPHRVAMDGIAAVVHPS 118

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
                LT++++             +    +  W E+     + RI +       GT EV 
Sbjct: 119 NSVDELTLDEIKA-----------IYTGEITNWKEL--GGNDERIVVVSRDSSSGTFEVF 165

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
            +  L+                               +   +  +        + +  N+
Sbjct: 166 GEIALEG-----------------------------ERVTPSALMQASNGAVASVVADNE 196

Query: 243 DVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLR 302
           +  G+VGL +  +N   LK V ++G+ P+  T+ SG +PI+RPL  +             
Sbjct: 197 NAIGYVGLGYLSDN---LKAVKVNGVKPTNATVASGKFPIARPLFMFTDGWPEGLT---A 250

Query: 303 EYVSFSVSDEMMAPDSQLFQYGLIPI 328
           ++++F +S +           G +P+
Sbjct: 251 KFINFVLSSKGQ---EIAENQGYVPL 273


>gi|253687405|ref|YP_003016595.1| phosphate binding protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251753983|gb|ACT12059.1| phosphate binding protein [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 312

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 59/343 (17%), Positives = 115/343 (33%), Gaps = 45/343 (13%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
                 +    +             +  AGS TL       A +F++++P      +++ 
Sbjct: 6   RIAGAFLLLFSVFCAAQPRQMLAGNLSSAGSDTLANLMAFWAADFNQHYPNVNL-QIQAA 64

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
           GSS        G       +   SR +  +E++   +H       V +  D ++++ ++D
Sbjct: 65  GSSSAPTSLASGA----AQLGPMSRAMKASEIEAFVQHYGYPPLAVPVAMDALVVLVNQD 120

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTRE 180
                L +  L    +      +     P+K+W    ++  + +  +  Y  +   GT  
Sbjct: 121 NPLPGLNLSQLDAIFSITQRCGNH---QPIKQWGDLGLQGSWEKRTLLRYGRNSASGTYG 177

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             ++K L  G                                  +         +  +  
Sbjct: 178 FFKQKALCRGDF-----------------------------LPQVNELPGSASVVQAVAA 208

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSV 298
           + D  G+  + F  +   +L L     D I PS   I SGLYP +R L  YV +     +
Sbjct: 209 STDAIGYASVGFRTSGVRMLPLAAQGTDYIYPSTENIRSGLYPYTRYLYIYVNKAPSQPL 268

Query: 299 LGL-REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
             L   ++   +S+      S + Q G +P+  E R+  R  I
Sbjct: 269 EALTAAFLDRVLSETGQ---SLVNQDGYLPLPEETRRQARQQI 308


>gi|304381035|ref|ZP_07363689.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
 gi|304340344|gb|EFM06284.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus ATCC
           BAA-39]
          Length = 327

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 64/356 (17%), Positives = 125/356 (35%), Gaps = 65/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---------RNRIRIAGSSTLFPYSKIIAENFSEYF 51
           M+ +  V    +   +  G              +   +  GSST+ P  + + E +++  
Sbjct: 1   MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
            + K    ++ G+  G ++F  G     ID  ++SR I   E  + +   +   +     
Sbjct: 61  SDAKISAGQA-GTGAGFQKFIAG----DIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQ 115

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               + V+  +     L  + L             +     K W ++   +P+ +I    
Sbjct: 116 DGVTVAVNKENDFVDELDKQQLKA-----------IYSGKAKTWKDVNSKWPDKKINAVS 164

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P+  HGT +  E +V+ +  +++   +                               D 
Sbjct: 165 PNSSHGTYDFFENEVMNKEDIKAEKNA-------------------------------DT 193

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLYPISRPL 286
              ++ +  NK+  G+ G +FY  N D LK V I         P+  TI    Y +SRPL
Sbjct: 194 NAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATAPTKKTIQDNSYALSRPL 253

Query: 287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             YV  +       + E++ F + D+  A      + G +    +  KS  D +  
Sbjct: 254 FIYVNEKALKDNKVMSEFIKFVLEDKGKA----AEEAGYVAAPEKTYKSQLDDLKA 305


>gi|157962785|ref|YP_001502819.1| phosphate-binding protein [Shewanella pealeana ATCC 700345]
 gi|157847785|gb|ABV88284.1| phosphate binding protein [Shewanella pealeana ATCC 700345]
          Length = 323

 Score =  153 bits (385), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 51/359 (14%), Positives = 112/359 (31%), Gaps = 61/359 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR---------------NRIRIAGSSTLFPYSKIIAE 45
           M+   +V              + A                  +   GS TL     + AE
Sbjct: 1   MKLKQLVGAVSFTAATVFSAASMAAIDQSLPTYEKTSGVSGNLSSVGSDTLANMMTLWAE 60

Query: 46  NFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDI 105
           +F + +P      +++ GSS        G    T      SRK+  NE++  +KH     
Sbjct: 61  DFKQLYPNVNI-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKPNEVEAFEKHYGYQP 115

Query: 106 QEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFP 163
             + +  D + +   +D     +++E +    +S            + +W ++     + 
Sbjct: 116 TAIRVAIDALAVFVHKDNPIEGMSIEQIDGIFSSTDKCGG----GDVTRWGQVGLDGGWA 171

Query: 164 EVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGI 223
              I +Y  +   GT    +KK L +G  +                              
Sbjct: 172 ARDIQLYGRNSVSGTYGYFKKKALCKGDFK-----------------------------A 202

Query: 224 AIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYP 281
            +         +  +  + +  G+ G+ +       + +     + I  +     +G YP
Sbjct: 203 NVNEQPGSASVVQSVSQSLNAIGYSGIGYKTAGVKAVAISKKGTNYIAATADNAATGKYP 262

Query: 282 ISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           +SR L  YV +  + +     RE++ + +S +       + + G + +           
Sbjct: 263 LSRYLYVYVNKHPNKDLSPMDREFIRYVLSQQGQQ---IVEKDGYVALPRSVIAKDLAK 318


>gi|317047134|ref|YP_004114782.1| phosphate-binding protein [Pantoea sp. At-9b]
 gi|316948751|gb|ADU68226.1| phosphate binding protein [Pantoea sp. At-9b]
          Length = 308

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 55/331 (16%), Positives = 105/331 (31%), Gaps = 40/331 (12%)

Query: 16  VYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGI 75
           +  G  T     +   GS TL     +  E+FS   P      V++ GSS        G 
Sbjct: 15  LAQGQQTMLAGNLSSVGSDTLGYLMTLWGEDFSRQSPGVNV-QVQAAGSSTAPTALAAGA 73

Query: 76  GDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYK 135
                     SR +  +E              V +  D +++V ++D     +  + L  
Sbjct: 74  AQLGP----MSRPMQVDERQLFIARYGYPPLAVPVAMDALVVVVNQDNPLTQIAPQQLDA 129

Query: 136 ALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSR 195
             +   +     V           P +    I  Y  +   GT    +++VL +G  R+ 
Sbjct: 130 LFSVTRLCGAHQVPQRWGDVGLTDPHWATRSIQRYGRNSASGTWGFFKQQVLCKGDFRAD 189

Query: 196 NFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKN 255
                                        +         +  +    +  G+    F+ +
Sbjct: 190 -----------------------------VAEFPGSAAVVQAVAATPNSIGYASFGFHLS 220

Query: 256 NADVLKLVPIDGI--VPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDE 312
               L +V  +G   +P   +I SG YP SRPL  Y+ +         +  ++   +S +
Sbjct: 221 GVKTLPVVTHNGESVMPDAESIRSGRYPWSRPLYLYINKAPGKPLPPLVSAFLHQVLSPQ 280

Query: 313 MMAPDSQLFQYGLIPISNEERKSVRDSIAVG 343
                  + + G +P+S+ +    R +I   
Sbjct: 281 GQRR---VSEAGYLPLSDSQMAQARAAIEEN 308


>gi|330446708|ref|ZP_08310360.1| phosphate binding family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328490899|dbj|GAA04857.1| phosphate binding family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 317

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 48/325 (14%), Positives = 101/325 (31%), Gaps = 45/325 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL       AE F   +P        +G S+         + + T  I  
Sbjct: 32  SGNLSSVGSDTLANLMTYWAEEFKRRYPNVNIQIQTAGSSTA-----PTALVEATAQIGP 86

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR +   E++  ++        + +  D + +    D     +  E L    +  L   
Sbjct: 87  MSRMMKTKEVEAFEQEYGYKPTAIKVAVDALAVFVHEDNPLKGINFEQLDAIYSRTLRCG 146

Query: 145 DKVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
                 P+ +W    +   +    I ++  +   GT    +K+ L  G  R         
Sbjct: 147 G---LEPINQWGQLGLTGSWQNRGIQLFGRNSVSGTYGYFKKRALCRGDFR--------- 194

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                 +         +  +  + +  G+ G+ +       + +
Sbjct: 195 --------------------NNVNEQPGSASVVQSVSTSLNAIGYSGIGYKTTGIKAIPV 234

Query: 263 V--PIDGIVPSMGTIVSGLYPISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQ 319
                D +  ++   V+G YP+SR L  YV +  +        E++ F +S +       
Sbjct: 235 AREGDDYVEATIENSVNGRYPLSRFLYVYVNKHPNKPLAPMEGEFLRFILSSDGQK---I 291

Query: 320 LFQYGLIPISNEERKSVRDSIAVGK 344
           + + G IP+     +     + + K
Sbjct: 292 VQKDGYIPLPVAVVEQNLAKLGLLK 316


>gi|242373684|ref|ZP_04819258.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis M23864:W1]
 gi|242348652|gb|EES40254.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus epidermidis M23864:W1]
          Length = 331

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 66/357 (18%), Positives = 129/357 (36%), Gaps = 66/357 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA----------RNRIRIAGSSTLFPYSKIIAENFSEY 50
           M+ + +V    +      G               +   +  GSST+ P  + + E +++ 
Sbjct: 1   MKKWQLVGTTVLGASFLLGACGGNNGGSGSGSDLKGSAKGEGSSTVAPIVEKLNEKWAKD 60

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
             + K    ++ G+  G ++F  G      D  ++SR I   E  + +  G+   +    
Sbjct: 61  HKDAKISSGQA-GTGAGFQKFIAG----ETDFSDASRPIKDEEKKKLEDKGIKYHEFKIA 115

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
                + V+  +     LT   L            ++     K W ++   +P+ +I   
Sbjct: 116 QDGVTIAVNKDNDFVKELTKSQLK-----------EIYSGKAKTWKDVNSKWPDKKINAV 164

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
            P+  HGT +  E++V+ +  +++   +                               D
Sbjct: 165 SPNSSHGTYDFFEEEVMDKQDIKAEKNA-------------------------------D 193

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI-----VPSMGTIVSGLYPISRP 285
               ++ +  NK+  G+ G +FY+ N D LK V I         P+  TI +G Y +SRP
Sbjct: 194 TNAIVSSVTKNKEGIGYFGYNFYEQNKDKLKEVKIKDDNGKLTEPTKKTIKNGSYALSRP 253

Query: 286 LLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           L  YVK +       + E++ F + DE  +        G +    +  KS    +  
Sbjct: 254 LFIYVKDKSLKDNKVMSEFMKFVLKDEGKS----AEDAGYVASPKKTYKSELKELNK 306


>gi|28872592|ref|NP_795211.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213968535|ref|ZP_03396678.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. tomato T1]
 gi|301384350|ref|ZP_07232768.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. tomato Max13]
 gi|302062557|ref|ZP_07254098.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. tomato K40]
 gi|302130224|ref|ZP_07256214.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28855848|gb|AAO58906.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213926823|gb|EEB60375.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. tomato T1]
 gi|331017818|gb|EGH97874.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 332

 Score =  152 bits (384), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 49/356 (13%), Positives = 104/356 (29%), Gaps = 55/356 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFA-------------RNRIRIAGSSTLFPYSKIIAENFS 48
           +     L           T                    +   GS TL     + AE + 
Sbjct: 4   KRLMTALTFVAAGVAATHTFAAVDPAIKAYTKTSGVSGNLSSVGSDTLANLMTLWAEAYK 63

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P      +++ GSS        G    T ++   SR++   EL   ++        +
Sbjct: 64  KEYPSVNI-QIQAAGSSTAPPALTEG----TANLGPMSRRMKDGELSAFEQKHGYKPTAI 118

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D + +   +D     LT++ +    +   +   K           +  D     I 
Sbjct: 119 PVAVDALAVFVHKDNPIKGLTLQQVDAIFSVTRLCGAKADAKTWGD-VGVTGDLAGKPIQ 177

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +++ L +G  +                               +   
Sbjct: 178 LFGRNSVSGTYGYFKEEALCKGDFK-----------------------------ANVNEQ 208

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIV---SGLYPISRP 285
                 ++ I  + +  G+ G+ +  +N   + L    G            +G YP+SR 
Sbjct: 209 PGSASVVSAISNSLNGIGYSGIGYKTSNVRTVPLAKKAGGEFVEDNEANTLNGTYPLSRF 268

Query: 286 LLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           L  YV +           E+V   +S +       + + G IP+     +     +
Sbjct: 269 LYVYVNKAPNQPLAPLEAEFVKLVLSRQGQ---EVVMKDGYIPLPARVVEKTLTDL 321


>gi|222100283|ref|YP_002534851.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermotoga neapolitana DSM 4359]
 gi|221572673|gb|ACM23485.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermotoga neapolitana DSM 4359]
          Length = 277

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 73/329 (22%), Positives = 132/329 (40%), Gaps = 61/329 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+  FV+L   V + +           + I GS+T+FP +++  E F +  P+ +   +E
Sbjct: 4   MKRLFVLLFAMVSVFLVA-------KTLVIKGSNTVFPIAQLWIEEFKKVHPDVQV-TLE 55

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GSS G+     G    T DI NSSR +   E++   K          +G DGI +V +
Sbjct: 56  GAGSSTGIAALFNG----TADIANSSRWLKPEEIERMNK-EGKYFIPFLVGFDGIAIVVN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           + +    +++E L K           +    ++ WS++ P+ P  RI +Y  +   GT E
Sbjct: 111 KKLGIDDISIETLKK-----------IYTGEIQYWSQVNPNLPRKRIVVYSRNTASGTYE 159

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E KVL                                +    + +       +  +  
Sbjct: 160 TFENKVLGGA-----------------------------RMAPYVRMVESTQIEIENVAR 190

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQH--FNSV 298
           N     +VG+ +     D +K++ ++GI P+   I+ G YP++RPL  +V   +      
Sbjct: 191 NPYAIAYVGVGYVT---DDVKVLKVNGIYPTKENILKGKYPLARPLFMFVDATNGFPEMG 247

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIP 327
             + EY+ F+ S +       L + G + 
Sbjct: 248 SLVFEYIMFAFSKKGQ---ELLEKAGYVA 273


>gi|49083814|gb|AAT51149.1| PA5369 [synthetic construct]
          Length = 324

 Score =  152 bits (384), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 46/327 (14%), Positives = 108/327 (33%), Gaps = 42/327 (12%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
            +     +   GS TL     + AE +   +P      +++ GSS        G    T 
Sbjct: 36  ASGVSGNLSSVGSDTLANLMTMWAEEYKRLYPNVNI-QIQAAGSSTAPPALTEG----TA 90

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           ++   SRK+   EL   ++        V +  D + +   +D     LT++ +    ++ 
Sbjct: 91  NLGPMSRKMKDVELQAFEQKYGYKPTAVPVAVDALAIFVHKDNPIKGLTMQQVDAIFSAT 150

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
            +   K           +  D+ +  + ++  +   GT    +++ L +G  R       
Sbjct: 151 RLCGSKQDVKTWGD-LGLTGDWAKKPVQLFGRNSVSGTYGYFKEEALCKGDFR------- 202

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                                   +         +  +  + +  G+ G+ +   +   +
Sbjct: 203 ----------------------PNVNEQPGSASVVQSVSQSLNGIGYSGIGYKTASVKTV 240

Query: 261 KLVPIDG---IVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAP 316
            L   +G   +  +    ++G YP+SR L  YV +           +++   +S      
Sbjct: 241 ALAKKEGAAFVEDNEQNALNGTYPLSRFLYVYVNKAPNKPLDPLEAQFLKLVLSKTGQQ- 299

Query: 317 DSQLFQYGLIPISNEERKSVRDSIAVG 343
              + + G IP+  +  +     + +G
Sbjct: 300 --VVVKDGYIPLPAKVAEKAIKELGLG 324


>gi|49483580|ref|YP_040804.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257425454|ref|ZP_05601879.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257428114|ref|ZP_05604512.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257430745|ref|ZP_05607127.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257433505|ref|ZP_05609863.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257436346|ref|ZP_05612393.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           M876]
 gi|282903970|ref|ZP_06311858.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus C160]
 gi|282905735|ref|ZP_06313590.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282908706|ref|ZP_06316524.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282910970|ref|ZP_06318772.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282914178|ref|ZP_06321965.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus M899]
 gi|282919100|ref|ZP_06326835.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           C427]
 gi|282924283|ref|ZP_06331957.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           C101]
 gi|293501205|ref|ZP_06667056.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           58-424]
 gi|293510166|ref|ZP_06668874.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           M809]
 gi|293526758|ref|ZP_06671443.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus M1015]
 gi|295427903|ref|ZP_06820535.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297591136|ref|ZP_06949774.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus MN8]
 gi|81651164|sp|Q6GH18|PSTS_STAAR RecName: Full=Phosphate-binding protein pstS; Short=PBP; Flags:
           Precursor
 gi|49241709|emb|CAG40399.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           MRSA252]
 gi|257271911|gb|EEV04049.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           55/2053]
 gi|257274955|gb|EEV06442.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           65-1322]
 gi|257278873|gb|EEV09492.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           68-397]
 gi|257281598|gb|EEV11735.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           E1410]
 gi|257284628|gb|EEV14748.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           M876]
 gi|282313670|gb|EFB44063.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           C101]
 gi|282316910|gb|EFB47284.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           C427]
 gi|282322246|gb|EFB52570.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus M899]
 gi|282324665|gb|EFB54975.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           WBG10049]
 gi|282326970|gb|EFB57265.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           WW2703/97]
 gi|282331027|gb|EFB60541.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           Btn1260]
 gi|282595588|gb|EFC00552.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus C160]
 gi|290920830|gb|EFD97893.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus M1015]
 gi|291096210|gb|EFE26471.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           58-424]
 gi|291467110|gb|EFF09628.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           M809]
 gi|295128261|gb|EFG57895.1| phosphate-binding protein pstS [Staphylococcus aureus subsp. aureus
           EMRSA16]
 gi|297576022|gb|EFH94738.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus MN8]
 gi|312438210|gb|ADQ77281.1| phosphate ABC superfamily ATP binding cassette transporter, binding
           protein [Staphylococcus aureus subsp. aureus TCH60]
 gi|315195282|gb|EFU25669.1| phosphate-binding lipoprotein [Staphylococcus aureus subsp. aureus
           CGS00]
          Length = 327

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 64/356 (17%), Positives = 125/356 (35%), Gaps = 65/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---------RNRIRIAGSSTLFPYSKIIAENFSEYF 51
           M+ +  V    +   +  G              +   +  GSST+ P  + + E +++  
Sbjct: 1   MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
            + K    ++ G+  G ++F  G     ID  ++SR I   E  + +   +   +     
Sbjct: 61  SDAKISAGQA-GTGAGFQKFIAG----DIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQ 115

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               + V+  +     L  + L             +     K W ++   +P+ +I    
Sbjct: 116 DGVTVAVNKENDFVDELDKQQLKA-----------IYSGKAKTWKDVNSKWPDKKINAVS 164

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P+  HGT +  E +V+ +  +++   +                               D 
Sbjct: 165 PNSSHGTYDFFENEVMNKEDIKAEKNA-------------------------------DT 193

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLYPISRPL 286
              ++ +  NK+  G+ G +FY  N D LK V I         P+  TI    Y +SRPL
Sbjct: 194 NAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKKTIQDNSYALSRPL 253

Query: 287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             YV  +       + E++ F + D+  A      + G +    +  KS  D +  
Sbjct: 254 FIYVNEKALKDNKVMSEFIKFVLEDKGKA----AEEGGYVAAPEKTYKSQLDDLKA 305


>gi|299537690|ref|ZP_07050979.1| protein sphX precursor [Lysinibacillus fusiformis ZC1]
 gi|298726669|gb|EFI67255.1| protein sphX precursor [Lysinibacillus fusiformis ZC1]
          Length = 324

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 73/371 (19%), Positives = 133/371 (35%), Gaps = 74/371 (19%)

Query: 1   MRFFFVVLMCFVVLEVY---------------------CGTGTFARN-----RIRIAGSS 34
           M+ +  + M  V+                           +G  A +      +   GSS
Sbjct: 1   MKKWKYLTMTAVMGSALMLGACGSDSAQNGNNTETNAPASSGQEAADEKLQGSVAGDGSS 60

Query: 35  TLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNEL 94
           T+ P  + + E ++   P+ K     SG      ++F  G      D  N+SR I   E 
Sbjct: 61  TVAPIIEAVVEEYAGTQPDVKVSVGVSGTGGG-FEKFIAG----ETDFSNASRNIKDEEK 115

Query: 95  DECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKK 154
            + ++ G+   +         ++V+  +  +  LTVE L K           +     KK
Sbjct: 116 AKLEEAGIDFTELALAYDGLSVVVNPENDWAKDLTVEQLQKIW---------IEDGTEKK 166

Query: 155 WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA 214
           WS+I P +P+ +I  Y P    GT +  ++ +L    + S                    
Sbjct: 167 WSDIDPSWPDEKIVYYSPGTDSGTYDYFDEVILDGADLVSSA------------------ 208

Query: 215 CTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGT 274
                       +  D    +  +  +K+  GF G ++Y  N D L +V ++G+ P+  T
Sbjct: 209 -----------TLSEDDNMLVQGVAGDKNAIGFFGYAYYLENKDKLNIVKVNGVEPTNET 257

Query: 275 IVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER 333
           I  G Y P+SRPL  YVK           +++ F++ +            G + +  E+ 
Sbjct: 258 IEGGEYTPLSRPLFTYVKNSAMKDNEAAYDFIKFTLENAG----DMAEAVGYVRLPEEKY 313

Query: 334 KSVRDSIAVGK 344
                ++   K
Sbjct: 314 TEGLKTLEGLK 324


>gi|58697202|ref|ZP_00372609.1| PERIPLASMIC PHOSPHATE BINDING PROTEIN [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58536476|gb|EAL59872.1| PERIPLASMIC PHOSPHATE BINDING PROTEIN [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 239

 Score =  152 bits (383), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 78/240 (32%), Positives = 130/240 (54%), Gaps = 2/240 (0%)

Query: 60  ESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVS 119
           ES GS  G K FC GIG+DT DI  SSR + + E + CK++ ++++ E+ IG+DGI++ +
Sbjct: 2   ESIGSGSGFKMFCSGIGEDTPDITTSSRPMKEVERELCKRNKINEVIEIIIGYDGIVIAN 61

Query: 120 DRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTR 179
                    T +DL++ L++Y   +DK+V N  K WS++    P+  I IY P    GT 
Sbjct: 62  SNQSHRFDFTKKDLFETLSAYSQENDKLVKNNKKFWSDVNQALPKTEIEIYGPHQNTGTY 121

Query: 180 EVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIE 239
           E L   ++ +      +  ++      + ++   AC ++R DG  IEV  +    + +++
Sbjct: 122 ETLVNSIMLDQYSCMNS--RIFKENYKDQEERKQACGNIRDDGRYIEVGINENIIIQKLK 179

Query: 240 VNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVL 299
            NK+  G    SF   N D ++   I GI P+   I SG Y ++RPL  Y+K++H ++V 
Sbjct: 180 SNKNALGIFSFSFLMRNQDKIQGSTIAGIEPTYENISSGKYILARPLYLYIKKEHLDTVD 239


>gi|15600562|ref|NP_254056.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           PstS [Pseudomonas aeruginosa PAO1]
 gi|107104471|ref|ZP_01368389.1| hypothetical protein PaerPA_01005548 [Pseudomonas aeruginosa PACS2]
 gi|116053516|ref|YP_793843.1| hypothetical protein PA14_70860 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218894472|ref|YP_002443342.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           PstS [Pseudomonas aeruginosa LESB58]
 gi|254237943|ref|ZP_04931266.1| hypothetical protein PACG_04049 [Pseudomonas aeruginosa C3719]
 gi|254243746|ref|ZP_04937068.1| hypothetical protein PA2G_04572 [Pseudomonas aeruginosa 2192]
 gi|296392229|ref|ZP_06881704.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           PstS [Pseudomonas aeruginosa PAb1]
 gi|313106796|ref|ZP_07793011.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Pseudomonas aeruginosa 39016]
 gi|9951691|gb|AAG08754.1|AE004949_1 phosphate ABC transporter, periplasmic phosphate-binding protein,
           PstS [Pseudomonas aeruginosa PAO1]
 gi|4519580|dbj|BAA75661.1| phosphate binding protein [Pseudomonas aeruginosa]
 gi|115588737|gb|ABJ14752.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169874|gb|EAZ55385.1| hypothetical protein PACG_04049 [Pseudomonas aeruginosa C3719]
 gi|126197124|gb|EAZ61187.1| hypothetical protein PA2G_04572 [Pseudomonas aeruginosa 2192]
 gi|156707992|gb|ABU93256.1| PstS [Pseudomonas aeruginosa]
 gi|156707994|gb|ABU93257.1| PstS [Pseudomonas aeruginosa]
 gi|156707996|gb|ABU93258.1| PstS [Pseudomonas aeruginosa]
 gi|218774701|emb|CAW30518.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           PstS [Pseudomonas aeruginosa LESB58]
 gi|310879513|gb|EFQ38107.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Pseudomonas aeruginosa 39016]
          Length = 323

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 45/324 (13%), Positives = 106/324 (32%), Gaps = 42/324 (12%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
            +     +   GS TL     + AE +   +P      +++ GSS        G    T 
Sbjct: 36  ASGVSGNLSSVGSDTLANLMTMWAEEYKRLYPNVNI-QIQAAGSSTAPPALTEG----TA 90

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           ++   SRK+   EL   ++        V +  D + +   +D     LT++ +    ++ 
Sbjct: 91  NLGPMSRKMKDVELQAFEQKYGYKPTAVPVAVDALAIFVHKDNPIKGLTMQQVDAIFSAT 150

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
            +   K           +  D+ +  + ++  +   GT    +++ L +G  R       
Sbjct: 151 RLCGSKQDVKTWGD-LGLTGDWAKKPVQLFGRNSVSGTYGYFKEEALCKGDFR------- 202

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                                   +         +  +  + +  G+ G+ +   +   +
Sbjct: 203 ----------------------PNVNEQPGSASVVQSVSQSLNGIGYSGIGYKTASVKTV 240

Query: 261 KLVPIDG---IVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAP 316
            L   +G   +  +    ++G YP+SR L  YV +           +++   +S      
Sbjct: 241 ALAKKEGAAFVEDNEQNALNGTYPLSRFLYVYVNKAPNKPLDPLEAQFLKLVLSKTGQQ- 299

Query: 317 DSQLFQYGLIPISNEERKSVRDSI 340
              + + G IP+  +  +     +
Sbjct: 300 --VVVKDGYIPLPAKVAEKAIKEL 321


>gi|218708604|ref|YP_002416225.1| ABC transporter substrate-binding protein [Vibrio splendidus LGP32]
 gi|218321623|emb|CAV17575.1| ABC transporter: substrate binding protein precursor [Vibrio
           splendidus LGP32]
          Length = 325

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 58/354 (16%), Positives = 114/354 (32%), Gaps = 52/354 (14%)

Query: 1   MRFFFVVLMCFVVLE-VYCGTGTFA----------RNRIRIAGSSTLFPYSKIIAENFSE 49
           MRF    L+   ++  V+      +             +   GS TL   + +  E F  
Sbjct: 8   MRFPISSLLALALVTPVHAEQSVDSLPDYSKVPGISGSLLSVGSDTLAGMTTLWVEEFKS 67

Query: 50  YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVT 109
           Y+P      V++ GSS        G    T  +   SR +   E++  ++        + 
Sbjct: 68  YYPNVN-AQVQASGSSTAPPALTEG----TAHLGPMSRPMRLREVEAFEREHGYKPTALR 122

Query: 110 IGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI 169
           +  D I L   RD     L   ++    +  L        N  +    I   + + R  +
Sbjct: 123 VAIDAIGLFVHRDNPIEGLNFREIDSIFSETLRCGATKPLNNWQD-LGISQPWAKHRFQL 181

Query: 170 YVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDG 229
           +  +   GT    ++  L  G  ++R                             +    
Sbjct: 182 FGRNSVSGTYGYFKQNALCSGDFKNR-----------------------------VNEQP 212

Query: 230 DYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISRPLL 287
                +  +  +    G+ G+ +      ++ +     D + P+   I+SG YP+SR L 
Sbjct: 213 GSASVVQSVASSISGIGYSGIGYRVAGVKLIPIAEHGSDYVEPTRANILSGDYPLSRFLY 272

Query: 288 FYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            YV +          RE+++F  S +       + + G + I  E  +     +
Sbjct: 273 VYVNKHPDKPLSPVEREFLTFVFSKQGQ---ELVEKDGYLAIPPEFAEQELAKV 323


>gi|146309091|ref|YP_001189556.1| phosphate binding protein [Pseudomonas mendocina ymp]
 gi|145577292|gb|ABP86824.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Pseudomonas mendocina ymp]
          Length = 313

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 68/347 (19%), Positives = 132/347 (38%), Gaps = 51/347 (14%)

Query: 3   FFFVVLMCFVVLEVY--CGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
              +  +   +L           A   +RI GSST+FP ++  A  F       +   V+
Sbjct: 9   KTLLGGLAVSLLSACDEAPPLASAAADLRIDGSSTVFPLTREAARRFERTAGGSRIA-VD 67

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             G++ G + FC G      DI N+SR+I   EL +C+ +G+             ++V+ 
Sbjct: 68  FSGTAAGFRRFCAG----ETDISNASREINAEELAQCQANGIDFRVVPLAMDAIAVVVNP 123

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            +    +++VE+L K  +             L  W ++RPD+P+  I ++      GT +
Sbjct: 124 ANTWVDAISVEELKKLWSP-------AAEKKLNSWRDLRPDWPDEPIVLFGRGQDSGTYD 176

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V  + ++       +++                                D       I  
Sbjct: 177 VFTQAIVGTTHSSRQDYQA----------------------------SEDEEFLAKSIAA 208

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIV----PSMGTIVSGLY-PISRPLLFYVKRQHF 295
             +  GF G+  Y  + D LKLV +D       P++ T+    Y P++RPL  YV ++  
Sbjct: 209 EPNALGFFGIGAYHRHWDELKLVAVDAGNGAVFPTLETVAQNRYQPLTRPLFLYVSQRSL 268

Query: 296 NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
                L  ++   +          +   G +P++ +  +S  ++++ 
Sbjct: 269 ADKPLLDSFLRHYLD----GLPGWIHFTGYMPLTRDSYRSSLEALSK 311


>gi|308273633|emb|CBX30235.1| hypothetical protein N47_D30440 [uncultured Desulfobacterium sp.]
          Length = 276

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 62/329 (18%), Positives = 128/329 (38%), Gaps = 57/329 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   +V+   ++  ++     FA   I I GS+T+ P ++ +AE F +  P+ K     
Sbjct: 5   MKRSKLVMGAVLLAAIFTSGIAFA-GNISINGSTTVLPIAQKVAEAFMKEHPDVKISVSG 63

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
            G          + + D + DI ++SR +   E++   K   ++  E  + +D I+ V  
Sbjct: 64  GG-----SGNGIKALIDGSTDIADASRAMKDKEVEM-AKGKGANPVEFIVAYDCIVPVVH 117

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            D    ++TV+ L             +    +K W E      +  I +       GT E
Sbjct: 118 PDNPIKNITVDQLKA-----------IYKGEVKNWKE--FGGLDKPIVVISRDTSSGTYE 164

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V E+KV+++  V                                  +       +  +  
Sbjct: 165 VWEEKVMKKERVYPGAL-----------------------------LTASNGAIVQTVSK 195

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N +  G++G+ +  ++   L +  I G   S  T ++  +PISRPL  Y + Q       
Sbjct: 196 NINAIGYIGVGYADSSVKALTVNSIKG---SKETTLNKTFPISRPLYMYTRIQPAGD--- 249

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPIS 329
           ++ ++ + ++ +     + + + G IP++
Sbjct: 250 IKAFMDYVLNKK--KGQNLVEESGFIPLT 276


>gi|170289337|ref|YP_001739575.1| phosphate binding protein [Thermotoga sp. RQ2]
 gi|170176840|gb|ACB09892.1| phosphate binding protein [Thermotoga sp. RQ2]
          Length = 274

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 75/329 (22%), Positives = 134/329 (40%), Gaps = 61/329 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+ FFV+L   V + +           + I GS+T+FP +++  E F +  P+ +   +E
Sbjct: 1   MKRFFVLLFAMVSVFLVA-------KTLVIKGSNTVFPIAQLWIEEFKKVHPDVQV-TLE 52

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GSS G+     G    T DI NSSR +   E++   K          +G DGI +V +
Sbjct: 53  GAGSSTGIAALFNG----TADIANSSRWLKPEEIERMNK-EGKYFIPFLVGFDGIAIVVN 107

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           + +    +++E L K           +    ++ WS++ P+ P  RIA+Y  +   GT E
Sbjct: 108 KKLGIDDISIETLKK-----------IYTGEIQYWSQVNPNLPRKRIAVYSRNTASGTYE 156

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E KVL                                +    + +       +  +  
Sbjct: 157 TFENKVLGGA-----------------------------RMAPYVRMVESTQIEIENVAR 187

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQH--FNSV 298
           N     +VG+ +     D +K++ ++GI P+   I+ G YP++RPL  +V   +      
Sbjct: 188 NPYAIAYVGVGYVT---DDVKVLKVNGIYPTKENILKGKYPLARPLFMFVDATNGFPEMG 244

Query: 299 LGLREYVSFSVSDEMMAPDSQLFQYGLIP 327
             + EY+ F+ S +       L + G + 
Sbjct: 245 SLVFEYIMFAFSKKGQ---ELLEKAGYVA 270


>gi|254228692|ref|ZP_04922116.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           sp. Ex25]
 gi|262395152|ref|YP_003287006.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Vibrio sp. Ex25]
 gi|151938871|gb|EDN57705.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           sp. Ex25]
 gi|262338746|gb|ACY52541.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Vibrio sp. Ex25]
          Length = 319

 Score =  152 bits (383), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 52/353 (14%), Positives = 110/353 (31%), Gaps = 55/353 (15%)

Query: 5   FVVLMCFVVLEVYCGTGTFARN--------------RIRIAGSSTLFPYSKIIAENFSEY 50
             V   F +L + C     A++               +   GS TL   + +  E F   
Sbjct: 3   LRVAKVFSLLALACSGMAVAQDKPLPNYHKTTGIVGNLLSVGSDTLAGMTTLWVEEFKSI 62

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
           +P        SG S+         + + T      SR +   E++  ++        + +
Sbjct: 63  YPNINAQVQASGSSTA-----PPALTEQTAQFGPMSRPMRLREVEAFEREHGYKPTALRV 117

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
             D I +   +D     L    L    ++ L   +       ++   +   + +  + ++
Sbjct: 118 AIDAIGIFVHQDNPIQGLNFSQLDALFSATLRCGESQFVTNWQQ-LGLESQWAKRNVQLF 176

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
             +   GT    +   L  G  ++R                             +     
Sbjct: 177 GRNSVSGTYGYFKSNALCGGDFKTR-----------------------------VNEQPG 207

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPISRPLLF 288
               +  +       G+ G+ +      ++ +     D + P+   IVSG YP+SR L  
Sbjct: 208 SASVVQAVASTISGIGYSGVGYRVAGVRLVPVAKTGNDYVTPTREHIVSGKYPLSRYLYV 267

Query: 289 YVKRQHF-NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           YV +           E++ F  S +  A    + + G +PI+ +  +     +
Sbjct: 268 YVNKHPDYPLTPIEAEFIRFIFSAQGQA---LVEKDGYVPITADFAEEELQKV 317


>gi|318604582|emb|CBY26080.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 330

 Score =  152 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 49/341 (14%), Positives = 101/341 (29%), Gaps = 45/341 (13%)

Query: 7   VLMCFVVLEVYCGTGTFARNRIRI----AGSSTLFPYSKIIAENFSEYFPEFKTPFVESG 62
           VL   V +           + +       GS TL     + A++F+ ++P        +G
Sbjct: 24  VLALPVAVSPATVVDAPKPDTLSGNLSSVGSDTLANLMSLWADDFNHHYPGVNLQIQAAG 83

Query: 63  GSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRD 122
            S+         +      +   SR +   E+    +        V +  D +++   +D
Sbjct: 84  SST-----APAALAAGAAQLGPMSRPMKAAEITAFTERYGYPPLAVPVAVDALVVFVHQD 138

Query: 123 MVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVL 182
                LT+  L    +      +        +   ++  + E  I  Y  +   GT    
Sbjct: 139 NPLDKLTLSQLDAVFSQNRRCGESHRIQRFGE-LGLKEHWAERSIQRYSRNSASGTYGFF 197

Query: 183 EKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNK 242
           ++ VL  G                                  I         +  +  + 
Sbjct: 198 KQLVLCGGDFS-----------------------------NNINELPGSASVVQAVAGSL 228

Query: 243 DVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVL 299
           +  G+  + F  +    L L     D ++P+   +  G YP+SR L  Y+ +        
Sbjct: 229 NGMGYASIGFRNSGVKPLSLSANGQDYVMPTAENVKDGRYPLSRYLYIYINKAPGKPLEP 288

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
               ++   +S E       +   G +P+  E     R  +
Sbjct: 289 LTAAFLERVLSPEGQKR---VTHDGYLPLPPEILNHTRKEL 326


>gi|91225174|ref|ZP_01260396.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Vibrio alginolyticus 12G01]
 gi|91190117|gb|EAS76388.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Vibrio alginolyticus 12G01]
          Length = 319

 Score =  152 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 50/355 (14%), Positives = 106/355 (29%), Gaps = 53/355 (14%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFAR------------NRIRIAGSSTLFPYSKIIAENFS 48
           M            L   C      +              +   GS TL   + +  E F 
Sbjct: 1   MALRLAKTFSLFALVCSCMAAAQDKPLPTYHKTTGIVGNLLSVGSDTLAGMTTLWVEEFK 60

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
             +P        SG S+         + + T      SR +   E++  ++        +
Sbjct: 61  SIYPNINAQVQASGSSTA-----PPALTEQTAQFGPMSRPMRLREVEAFEREHGYKPTAL 115

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
            +  D I +   +D     L    L    ++ L   +       ++   +   + +  + 
Sbjct: 116 RVAIDAIGIFVHQDNPIQGLNFSQLDALFSATLRCGESQFVTNWQQ-LGLESQWAKRNVQ 174

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +   L  G  ++R                             +   
Sbjct: 175 LFGRNSVSGTYGYFKSNALCGGDFKTR-----------------------------VNEQ 205

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISRPL 286
                 +  +       G+ G+ +      ++ +  +  D + P+   IVSG YP+SR L
Sbjct: 206 PGSASVVQAVASTISGIGYSGVGYRVAGVRLVPVAKMGNDYVTPTREHIVSGKYPLSRYL 265

Query: 287 LFYVKRQHF-NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
             YV +           E++ F  S +  A    + + G +PI+ +  +     +
Sbjct: 266 YVYVNKHPDYPLTPIEAEFIRFIFSAQGQA---LVEKDGYVPITADFAEEELKKV 317


>gi|152988610|ref|YP_001351464.1| hypothetical protein PSPA7_6148 [Pseudomonas aeruginosa PA7]
 gi|150963768|gb|ABR85793.1| hypothetical protein PSPA7_6148 [Pseudomonas aeruginosa PA7]
          Length = 323

 Score =  152 bits (382), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 45/324 (13%), Positives = 106/324 (32%), Gaps = 42/324 (12%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
            +     +   GS TL     + AE +   +P      +++ GSS        G    T 
Sbjct: 36  ASGVSGNLSSVGSDTLANLMTMWAEEYKRLYPNVNI-QIQAAGSSTAPPALTEG----TS 90

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           ++   SRK+   EL   ++        V +  D + +   +D     LT++ +    ++ 
Sbjct: 91  NLGPMSRKMKDVELQAFEQKYGYKPTAVPVAVDALAIFVHKDNPIKGLTMQQVDAIFSAT 150

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
            +   K           +  D+ +  + ++  +   GT    +++ L +G  R       
Sbjct: 151 RLCGSKQDVKTWGD-LGLTGDWAKKPVQLFGRNSVSGTYGYFKEEALCKGDFR------- 202

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                                   +         +  +  + +  G+ G+ +   +   +
Sbjct: 203 ----------------------PNVNEQPGSASVVQSVSQSLNGIGYSGIGYKTASVKTV 240

Query: 261 KLVPIDG---IVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAP 316
            L   +G   +  +    ++G YP+SR L  YV +           +++   +S      
Sbjct: 241 ALAKKEGAAFVEDNEQNALNGTYPLSRFLYVYVNKAPNKPLDPLEAQFLKLVLSKTGQQ- 299

Query: 317 DSQLFQYGLIPISNEERKSVRDSI 340
              + + G IP+  +  +     +
Sbjct: 300 --VVVKDGYIPLPAKVAEKAIKEL 321


>gi|300113427|ref|YP_003760002.1| phosphate-binding protein [Nitrosococcus watsonii C-113]
 gi|299539364|gb|ADJ27681.1| phosphate binding protein [Nitrosococcus watsonii C-113]
          Length = 332

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 50/332 (15%), Positives = 110/332 (33%), Gaps = 46/332 (13%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
            +     +   GS TL     + AE F + +P        +G S+         + ++T 
Sbjct: 38  ASGVAGTLSSVGSDTLANLMTLWAEEFKKLYPSVNIQVQAAGSSTA-----PPALTENTA 92

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           +I   SRK+  NE++  +         + +  D + +  ++D     +T+  +    ++ 
Sbjct: 93  NIGPMSRKMKGNEVEAFENKYGYKPTPIRVAIDALAVYVNKDNPIEKITLPQVDAIFSAT 152

Query: 141 LIVDDKVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
                      +K W    +  ++   RI ++  +   GT    +K  L +G  ++    
Sbjct: 153 RKCG---YPEDIKVWGDLGLGGEWLHRRIQLFGRNSVSGTYGYFKKAALCKGDFKNT--- 206

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
                                     +         +  +  + +  G+ G+ +  +   
Sbjct: 207 --------------------------VNEQPGSASVVQGVTKSINGIGYSGIGYQTSGVR 240

Query: 259 VLKLVPIDG---IVPSMGTIVSGLYPISRPLLFYVKRQHFN-SVLGLREYVSFSVSDEMM 314
            L L    G   +  +    V G YP++R L  YV +      +   +E++   +S    
Sbjct: 241 ALPLATKTGAPSVEATAENAVKGQYPLTRFLYVYVNKHPNEPLLPLEQEFIKMVLSKVGQ 300

Query: 315 APDSQLFQYGLIPISNEERKSVRDSIAVGKSG 346
                + + G IP++          I V   G
Sbjct: 301 ---RVVIKDGYIPLTAPIAAKDLAKIGVKGLG 329


>gi|117620637|ref|YP_855796.1| phosphate-binding protein [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
 gi|117562044|gb|ABK38992.1| phosphate-binding protein [Aeromonas hydrophila subsp. hydrophila
           ATCC 7966]
          Length = 324

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 47/359 (13%), Positives = 108/359 (30%), Gaps = 57/359 (15%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------------RIRIAGSSTLFPYSKIIA 44
           M+   +  +            T A                   +   GS TL     + A
Sbjct: 1   MKLNKLAGVIGFTAATLFSVSTLAAGVDKNLPDYTPTSGISGNLSSVGSDTLANMMTLWA 60

Query: 45  ENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD 104
           E F   +P      +++ GSS        G+          SR +   E +  +K     
Sbjct: 61  EEFKRMYPNVNV-QIQAAGSSTAPTALTEGV----AQFGPMSRAMKSGEEEAFEKRYGYK 115

Query: 105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPE 164
              + +  D + +  ++D     LT+  L    +S L   +            +  ++  
Sbjct: 116 PTAIRVAVDALAVFVNKDNPIKGLTMPQLDAIFSSTLKCGEAKAATKWAD-LGLDGNWSS 174

Query: 165 VRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIA 224
             + ++  +   GT    ++  L  G  +S                              
Sbjct: 175 KDLQLFGRNSVSGTYGYFKEHALCNGDFKSG----------------------------- 205

Query: 225 IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPI 282
           +         +  +  + +  G+ G+ +  +    + L       I  +    ++G YP+
Sbjct: 206 VNEQPGSASVVQSVSSSLNGIGYSGIGYVTSGVRAVPLSKDGKTFIEATSDNAITGKYPL 265

Query: 283 SRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           SR L  YV +  +       +E++   +S       + + + G +P+  +  ++    +
Sbjct: 266 SRFLYVYVNKHPNKPLSPMEQEFLKMVLSKAGQ---NIVAKDGYVPVPAKVVEADLKKL 321


>gi|283958152|ref|ZP_06375603.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus A017934/97]
 gi|283790301|gb|EFC29118.1| phosphate ABC transporter, phosphate-binding protein
           [Staphylococcus aureus subsp. aureus A017934/97]
          Length = 327

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 64/356 (17%), Positives = 125/356 (35%), Gaps = 65/356 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA---------RNRIRIAGSSTLFPYSKIIAENFSEYF 51
           M+ +  V    +   +  G              +   +  GSST+ P  + + E +++  
Sbjct: 1   MKKWQFVGTTALGATLLLGACGGGNGGSGNSDLKGEAKGDGSSTVAPIVEKLNEKWAQDH 60

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
            + K    ++ G+  G ++F  G     ID  ++SR I   E  + +   +   +     
Sbjct: 61  SDAKISAGQA-GTGAGFQKFIAG----DIDFADASRPIKDEEKQKLQDKNIKYKEFKIAQ 115

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
               + V+  +     L  + L             +     K W ++   +P+ +I    
Sbjct: 116 DGVTVAVNKGNDFVDELDKQQLKA-----------IYSGKAKTWKDVNSKWPDKKINAVS 164

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
           P+  HGT +  E +V+ +  +++   +                               D 
Sbjct: 165 PNSSHGTYDFFENEVMNKEDIKAEKNA-------------------------------DT 193

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID-----GIVPSMGTIVSGLYPISRPL 286
              ++ +  NK+  G+ G +FY  N D LK V I         P+  TI    Y +SRPL
Sbjct: 194 NAIVSSVTKNKEGIGYFGYNFYVQNKDKLKEVKIKDENGKATEPTKKTIQDNSYALSRPL 253

Query: 287 LFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
             YV  +       + E++ F + D+  A      + G +    +  KS  D +  
Sbjct: 254 FIYVNEKALKDNKVMSEFIKFVLEDKGKA----AEEGGYVAAPEKTYKSQLDDLKA 305


>gi|169829094|ref|YP_001699252.1| protein sphX [Lysinibacillus sphaericus C3-41]
 gi|168993582|gb|ACA41122.1| Protein sphX precursor [Lysinibacillus sphaericus C3-41]
          Length = 330

 Score =  152 bits (382), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 73/371 (19%), Positives = 133/371 (35%), Gaps = 74/371 (19%)

Query: 1   MRFFFVVLMCFVVLEVY---------------------CGTGTFARN-----RIRIAGSS 34
           M+ +  + M  V+                           +G  A +      +   GSS
Sbjct: 7   MKKWKYLTMTAVMGSALMLGACGSDSAQNGNNTETNAPASSGQEAADEKLQGSVAGDGSS 66

Query: 35  TLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNEL 94
           T+ P  + + E ++   P+ K     SG      ++F  G      D  N+SR I   E 
Sbjct: 67  TVAPIIEAVVEEYAGAQPDVKVSVGVSGTGGG-FEKFIAG----ETDFSNASRNIKDEEK 121

Query: 95  DECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKK 154
            +  + G+   +         ++V+  +  +  LTVE L K           +     KK
Sbjct: 122 AKLGEAGIDYTELALAYDGLSVVVNPENDWAKDLTVEQLQKIW---------IEDGKEKK 172

Query: 155 WSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVA 214
           WS+I P +P+ +I  Y P    GT +  ++ +L    + S                    
Sbjct: 173 WSDIDPSWPDEKIVYYSPGTDSGTYDYFDEIILDGADLVSSA------------------ 214

Query: 215 CTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGT 274
                       +  D    +  +  +K+  GF G ++Y  N D L +V ++G+ P+  T
Sbjct: 215 -----------TLSEDDNMLVQGVSGDKNAIGFFGYAYYLENKDKLNIVKVNGVEPNNET 263

Query: 275 IVSGLY-PISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEER 333
           I +G Y P+SRPL  YVK           +++ F++ +            G + +  E+ 
Sbjct: 264 IEAGEYTPLSRPLFTYVKNSAMKDNEAAYDFIKFTLENAG----DMAEAVGYVRLPEEKY 319

Query: 334 KSVRDSIAVGK 344
                ++   K
Sbjct: 320 TEGLKTLEGLK 330


>gi|269103309|ref|ZP_06156006.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Photobacterium damselae subsp. damselae CIP
           102761]
 gi|268163207|gb|EEZ41703.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           PstS [Photobacterium damselae subsp. damselae CIP
           102761]
          Length = 362

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 45/324 (13%), Positives = 102/324 (31%), Gaps = 45/324 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +  +GS TL       AE F   +P        +G S+         + + T  +  
Sbjct: 73  SGNLSSSGSDTLANLMTYWAEEFKRRYPNVHIQIQTAGSSTA-----PTALTEATAQLGP 127

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR++   E++  +        E+ +  D + +    D     L  + L    +      
Sbjct: 128 MSRQMKTKEIEAFEHEYGYPPTEIRVAIDTLAVFVHEDNPLKGLNFKQLDAIYSRTYQCG 187

Query: 145 DKVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
                  + +W    +   +    I ++  +   GT    +K+ L  G  RS        
Sbjct: 188 ---AVETITRWGQLGLTGSWQHRPIQLFGRNSVSGTYGYFKKRALCRGDFRS-------- 236

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                 +            +  + +  G+ G+ +       + +
Sbjct: 237 ---------------------NVNEQPGSASVAQSVSTSLNGIGYSGIGYKTTGIRAIPI 275

Query: 263 V--PIDGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQ 319
                + +  ++   VSG YP++R L  YV ++        ++E+  F +S +       
Sbjct: 276 AREGNEYVEATIDNSVSGHYPLARYLYVYVNKKPNKPLAPIVQEFFRFVLSQDGQQ---I 332

Query: 320 LFQYGLIPISNEERKSVRDSIAVG 343
           + + G +P+     +     + +G
Sbjct: 333 VQKDGYVPVPQSVVEQDLIKLGLG 356


>gi|330501106|ref|YP_004377975.1| phosphate binding protein [Pseudomonas mendocina NK-01]
 gi|328915392|gb|AEB56223.1| phosphate binding protein [Pseudomonas mendocina NK-01]
          Length = 322

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 107/319 (33%), Gaps = 41/319 (12%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS +L     + AE F + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDSLANLMTLWAEEFKKNYPNVNI-QIQAAGSSTAPPALTEG----TANMGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR +  +E+   ++        V +  D + +   +D    SLT++ +    +S  +  
Sbjct: 95  MSRPMKDSEIQAFEEKYGYKPTAVPVAIDALAVFVHKDNPIKSLTMQQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
           +            +  ++    I ++  +   GT    +++ L +G  +S          
Sbjct: 155 EDKDLKTWGD-VGLTGEWASKPIQLFGRNSVSGTYGYFKEEALCKGDFKS---------- 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I    +  G+ G+ +  ++   + LV 
Sbjct: 204 -------------------NVNEQPGSASVVQSISSTLNAIGYSGIGYKTSSVRAVPLVD 244

Query: 265 IDGI--VPSMGTIVSGLYPISRPLLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLF 321
             G     +    +SG YP++R    Y+ +           E+V   +S +       + 
Sbjct: 245 KSGQVEEANETNALSGKYPLARFFYVYLNKAPNQPLSPLDAEFVKLVLSKQGQ---EVVV 301

Query: 322 QYGLIPISNEERKSVRDSI 340
           + G IP+ ++  +     +
Sbjct: 302 KDGYIPLPSKVVEKTMKEL 320


>gi|326797376|ref|YP_004315196.1| phosphate binding protein [Marinomonas mediterranea MMB-1]
 gi|326548140|gb|ADZ93360.1| phosphate binding protein [Marinomonas mediterranea MMB-1]
          Length = 322

 Score =  151 bits (381), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 54/359 (15%), Positives = 111/359 (30%), Gaps = 59/359 (16%)

Query: 1   MRFFFVVLMCFVVLEVYC-------------GTGTFARNRIRIAGSSTLFPYSKIIAENF 47
           M+     L    +  V                  +     I   GS TL     + AE+F
Sbjct: 1   MKKLVAGLAVATLAGVSVNAVADVDAGLHSYSKASGVSGNISSVGSDTLANLMTLWAEDF 60

Query: 48  SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQE 107
              +P      +++ GSS        G    T +    SR +   E+   +K        
Sbjct: 61  KRLYPNVNI-QIQAAGSSTAPPALTEG----TSNFGPMSRTMKDKEVAAFEKKYGYKPTA 115

Query: 108 VTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFPEV 165
           + +  D + +   +D     L++ ++    +S            + KW     +  +   
Sbjct: 116 IPVAIDALAVFVHKDNPIKGLSLPEVDAIFSSTRKGG---HSEDITKWGAAGLKGAWANR 172

Query: 166 RIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI 225
            I I+  +   GT    +KK L +G  +                              ++
Sbjct: 173 DIQIFGRNSVSGTYGYFKKKALFKGDYK-----------------------------NSV 203

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG---IVPSMGTIVSGLYPI 282
                    +  +  + +  G+ G+ +  ++   + L   +G   I  +     +G YP+
Sbjct: 204 NEQPGSASVVQSVSTSLNGIGYSGIGYKTSSVRAIPLTKKEGGELIEATPLNAATGKYPL 263

Query: 283 SRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           SR L  YV +          RE+V   +S         + + G +P+  +      + +
Sbjct: 264 SRFLYVYVNKAPNKPLAPLQREFVKMVLSKMGQ---EVVVKDGYVPLPAKVANKYLNDL 319


>gi|229916295|ref|YP_002884941.1| phosphate binding protein [Exiguobacterium sp. AT1b]
 gi|229467724|gb|ACQ69496.1| phosphate binding protein [Exiguobacterium sp. AT1b]
          Length = 312

 Score =  151 bits (380), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 71/351 (20%), Positives = 130/351 (37%), Gaps = 59/351 (16%)

Query: 1   MRF--FFVVLMCFVVLEVYCG---------TGTFARNRIRIAGSSTLFPYSKIIAENFSE 49
           M+       +    ++   CG          G     ++ + GSST+FP  + +AE +S 
Sbjct: 4   MKKSALLASITSVALVGAACGNNEEGGAAEGGDALSGKVVMDGSSTVFPIMEAVAEEYSA 63

Query: 50  YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVT 109
             PE +     SG      K F  G      D  N+SR+I + E  E +K+GV   Q   
Sbjct: 64  EQPEVEVTVGVSGTGGG-FKRFVTG----ETDFSNASREIKEEEAAEAEKNGVEFTQLSV 118

Query: 110 IGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI 169
                 L+V+  +  +  +T+E+L K                +K W ++R D+P+  I+ 
Sbjct: 119 ALDGLSLVVNPANDWAQDITIEELNKMWTDTS----------IKTWKDVRSDWPDEEISF 168

Query: 170 YVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDG 229
           + P    GT +   + VL +                            +R+D    ++  
Sbjct: 169 FAPGKDSGTFDFFNEAVLDDTD--------------------------IREDA---QLSE 199

Query: 230 DYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFY 289
           D    +  +   +   GF G ++Y  N D L+ + ++G+ P+  TI    YP+SR +  Y
Sbjct: 200 DDNVLVTGVAGTEGAIGFFGYAYYIENQDTLRAMAVEGVEPTPETINDLSYPLSREIYTY 259

Query: 290 VKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           V          + ++  F   +      +   + G + +           I
Sbjct: 260 VNNASLKDKEQVADFARFMNENAG----ALAEEVGYVGMEQARYDENMKMI 306


>gi|304395461|ref|ZP_07377344.1| phosphate binding protein [Pantoea sp. aB]
 gi|304356755|gb|EFM21119.1| phosphate binding protein [Pantoea sp. aB]
          Length = 306

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 51/329 (15%), Positives = 99/329 (30%), Gaps = 40/329 (12%)

Query: 15  EVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRG 74
            +           +   GS TL     +  E+FS   P      V++ GSS        G
Sbjct: 14  GLALAQHGTLSGNLSSVGSDTLGYLMTLWGEDFSRQAPGVNV-QVQASGSSTAPTALAAG 72

Query: 75  IGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLY 134
                      SR +  +E    +         V +  D +++V ++      +    L 
Sbjct: 73  AAQLGP----MSRPMQADERQAFEARYGYPPLAVPVAMDALVVVVNQRNPLQQIEPRQLD 128

Query: 135 KALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRS 194
              +   +     V             + +  I  Y  +   GT    +++VL +G  RS
Sbjct: 129 AIFSVTRLCGAHSVPLRWGDLGLTGAQWNKRPIQRYGRNSASGTWGFFKQQVLCKGDFRS 188

Query: 195 RNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYK 254
                                         +         +  +  N    G+    F+ 
Sbjct: 189 D-----------------------------VAEFPGSAAVVQAVAGNSRSIGYASFGFHL 219

Query: 255 NNADVLKLVPIDGI--VPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSD 311
           +   +L +    G    P    I SG YP +RPL  YV +         +  ++   +S 
Sbjct: 220 SGVKMLAVTNDQGQAIAPDADAIRSGRYPWARPLYLYVNKAPGKPLPPLVAAFLQQVLSP 279

Query: 312 EMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +       + + G +P+S+ +    R ++
Sbjct: 280 QGQRR---VSEAGYLPLSDSQMAEARAAL 305


>gi|238795583|ref|ZP_04639098.1| ABC superfamily (Peri_bind) high-affinity phosphate transporter
           [Yersinia mollaretii ATCC 43969]
 gi|238720702|gb|EEQ12503.1| ABC superfamily (Peri_bind) high-affinity phosphate transporter
           [Yersinia mollaretii ATCC 43969]
          Length = 334

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 42/330 (12%), Positives = 94/330 (28%), Gaps = 41/330 (12%)

Query: 14  LEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCR 73
                 T       +   GS TL     + A++F+ ++P        +G S+        
Sbjct: 39  SSSSVSTAHTLSGNLSSVGSDTLANLISLWADDFNHHYPGVNLQIQAAGSST-----APA 93

Query: 74  GIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDL 133
            +      +   SR +   E+    +        V +  D +++   +D     L +  L
Sbjct: 94  ALAAGAAQLGPMSRPMKNGEISAFIQRYGYPPLAVPVAVDALVVFVHQDNPLNKLNLSQL 153

Query: 134 YKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVR 193
               +        +          +  D+    +  Y  +   GT    + +VL +G   
Sbjct: 154 DAIFSQNRRC-GALRPVQRFGELGLEGDWAARALQRYSRNSASGTYGYFKHRVLCDGDF- 211

Query: 194 SRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFY 253
                                          +         +  +  + +  G+  + F 
Sbjct: 212 ----------------------------INNVNELPGSASVVQAVAESLNGIGYASIGFR 243

Query: 254 KNNADVLK--LVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFN-SVLGLREYVSFSVS 310
            +    L       D ++P+   +  G YP+SR L  Y+ +            ++   +S
Sbjct: 244 NSGVKPLALAASGQDFVLPTPENVKDGRYPLSRYLYIYINKAPGQPLEPLTAAFLERVLS 303

Query: 311 DEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            E           G +P+  +     R ++
Sbjct: 304 PEGQKQ---AAHDGYLPLPPDVLMRTRKAL 330


>gi|90414590|ref|ZP_01222563.1| putative phosphate-binding protein [Photobacterium profundum 3TCK]
 gi|90324306|gb|EAS40875.1| putative phosphate-binding protein [Photobacterium profundum 3TCK]
          Length = 320

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 45/353 (12%), Positives = 107/353 (30%), Gaps = 53/353 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFAR--------NRIRIAGSSTLFPYSKIIAENFSEYFPE 53
           R    +++ F +   +      A+          +   GS TL        E F   +P 
Sbjct: 5   RRILPMILAFSMHNAWALDADLAKYQKISGVSGNLSSVGSDTLANLMTYWGEEFKRKYPN 64

Query: 54  FKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHD 113
                  +G S+         + + T  +   SRK+   E++  +         + +  D
Sbjct: 65  VNIQIQTAGSSTA-----PTALTEATAQLGPMSRKMKTKEIEAFEHEYGYKPTAIRVAID 119

Query: 114 GILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFPEVRIAIYV 171
            + +    D     +  E L    +            P+ +W    +   + +  I  + 
Sbjct: 120 ALAVFVHEDNPLKGINFEQLDAVYSRTYRCG---ATQPITRWGQLGLTGRWADRDIQRFG 176

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
            +   GT    +++ L +G                                  +      
Sbjct: 177 RNSVSGTYGYFKQRALCKGDF-----------------------------LNNVNEQPGS 207

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPISRPLLFY 289
              +  +  + +  G+ G+ +       + +     + +  ++   ++G YP++R L  Y
Sbjct: 208 ASVVQSVSTSLNAIGYSGIGYKTTGIRAIPVAKEGDNYVDATIENSINGSYPLARYLYVY 267

Query: 290 VKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           V +  +      L E+  F +S       S + + G IP+     ++    + 
Sbjct: 268 VNKHPNKPLDPILTEFFKFVLSHNGQ---SVVEKDGYIPLPKSVVEADLALLK 317


>gi|157364553|ref|YP_001471320.1| phosphate binding protein [Thermotoga lettingae TMO]
 gi|157315157|gb|ABV34256.1| phosphate binding protein [Thermotoga lettingae TMO]
          Length = 278

 Score =  151 bits (380), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 74/331 (22%), Positives = 137/331 (41%), Gaps = 63/331 (19%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+   V L+  V + +           + I GS+T++P +++  E F + +P+     +E
Sbjct: 1   MKKISVFLLVLVAIAILG-------ETLVIKGSNTIYPIAQLWIEEFQKMYPDV-VATLE 52

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GSS G+K       + T DI N+SR +  +E++   +        + IG+DGI ++ +
Sbjct: 53  GAGSSTGIKAL----MNQTADIANASRFLKSSEIEAMHEQK-KYFVPLVIGYDGIAVIVN 107

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
            D+   S++++ LYK           +    + +WS+I    P+  I  Y  +   GT E
Sbjct: 108 PDLGIDSISIDTLYK-----------IYTGQITEWSQIDSKLPKKTIVAYSRNTASGTFE 156

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
           V  +KVL+   +  R                             I++       +  +  
Sbjct: 157 VWLEKVLKGDKLSPR-----------------------------IQMVESTQAEIESVAR 187

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVK----RQHFN 296
           N     + G+ +     D +K + IDGI PS+  +++G YP+SRPL  +         + 
Sbjct: 188 NPYAIAYTGMGYVT---DQVKALKIDGIEPSVQNVLAGKYPLSRPLFVFFDLSRFGNAWP 244

Query: 297 SVLGLREYVSFSVSDEMMAPDSQLFQYGLIP 327
               +  Y+ F +S E       + + G IP
Sbjct: 245 EKGIVASYIRFILSPEGQK---IVEKAGYIP 272


>gi|224476521|ref|YP_002634127.1| putative phosphate transport system substrate-binding protein
           [Staphylococcus carnosus subsp. carnosus TM300]
 gi|222421128|emb|CAL27942.1| putative phosphate transport system substrate-binding protein
           [Staphylococcus carnosus subsp. carnosus TM300]
          Length = 311

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 65/358 (18%), Positives = 127/358 (35%), Gaps = 68/358 (18%)

Query: 1   MRFFFVVLMCFVVLEVYC------------GTGTFARNRIRIAGSSTLFPYSKIIAENFS 48
           M+ + V+    +   +                 + A+  ++  GSST+ P  +++ E F+
Sbjct: 1   MKKWQVLGTTVIGASLLLGACGSGGNGGGDSKESDAKGEVKGDGSSTVGPIVEVLNEKFN 60

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           + +P        + G+  G ++F  G      D  N+SR I   E  +     V      
Sbjct: 61  KKYPNITVS-SATSGTGGGFEKFIAG----ESDFSNASRPIKPEEKKKLDDKKVKFSDFK 115

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
                  + V+  +     LT++DL K           +     K W ++ P +P  +I 
Sbjct: 116 IAQDGVTIAVNKDNDFVKELTIDDLKK-----------IYSGQAKTWKDVNPKYPAKQIK 164

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
            + P   HGT +  E++V+ +  +++   +                              
Sbjct: 165 AFSPDQSHGTYDFFEEEVMNKEDIKAEKNA------------------------------ 194

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV-----PSMGTIVSGLYPIS 283
            D    +  +  NK+  G+ G +FY+ N D LK V I G       P+  TI    Y +S
Sbjct: 195 -DTNVIVQSVTNNKEGIGYFGYNFYEQNKDKLKEVKIKGKDGKAIAPTKKTIQDSSYALS 253

Query: 284 RPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           RPL  Y   +          ++ F + D+  +      + G + +  ++       + 
Sbjct: 254 RPLFIYTNDKKLKDNKAFGTFMKFVLEDKGKS----AEKAGYVALPKKDYDDQLKKLK 307


>gi|150021695|ref|YP_001307049.1| phosphate binding protein [Thermosipho melanesiensis BI429]
 gi|149794216|gb|ABR31664.1| phosphate binding protein [Thermosipho melanesiensis BI429]
          Length = 273

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 74/327 (22%), Positives = 142/327 (43%), Gaps = 60/327 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+      +  + + ++          + I GS+T+FP +++  E   E  PE +   +E
Sbjct: 1   MKKVLGFSILLLTVLLF-------SETLVIKGSNTVFPIAQLWIERLKEISPELEI-TLE 52

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GSS G+      + + T DI NSSR + ++EL++           + IG+DGI ++ +
Sbjct: 53  GAGSSTGI----AALFNKTADIANSSRWLKESELEKMHS-MGRYFIPIVIGYDGIAVIVN 107

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           R +   ++T+E L K           +    ++ W++I P+ P+ +I IY  +   GT E
Sbjct: 108 RKIDLENITLEMLKK-----------IYTGKIRYWNQIDPNLPKKQIQIYSRNTASGTFE 156

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             EK VL+   +                                + +       +  +E 
Sbjct: 157 TFEKIVLKNEKM-----------------------------APWVRMVESTRFEVESVEK 187

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHF-NSVL 299
           N     ++G+ +     D +K++ ++GI+P+  TI+ G YPISRPL  +V   +      
Sbjct: 188 NPYAIAYIGIGYVT---DEVKVLKVEGILPTKETILDGTYPISRPLFMFVDATNGYPEAG 244

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLI 326
            +++Y++F +S E       + + G I
Sbjct: 245 AIKKYITFGLSKEGQ---DLVEKAGYI 268


>gi|27363933|ref|NP_759461.1| phosphate ABC transporter periplasmic phosphate-binding protein
           pstS [Vibrio vulnificus CMCP6]
 gi|37678909|ref|NP_933518.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           vulnificus YJ016]
 gi|320157315|ref|YP_004189694.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Vibrio vulnificus MO6-24/O]
 gi|27360050|gb|AAO08988.1| Phosphate ABC transporter, periplasmic phosphate-binding protein
           pstS [Vibrio vulnificus CMCP6]
 gi|37197650|dbj|BAC93489.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           vulnificus YJ016]
 gi|319932627|gb|ADV87491.1| phosphate ABC transporter periplasmic phosphate-binding protein
           PstS [Vibrio vulnificus MO6-24/O]
          Length = 317

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 53/357 (14%), Positives = 110/357 (30%), Gaps = 59/357 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNR--------------IRIAGSSTLFPYSKIIAEN 46
           M+ +++ L+    L         A +               +   GS TL   + +  E 
Sbjct: 1   MKRWWLSLL----LMGGISASAQALDTPLQPYKKIPGVSGNLLSVGSDTLAGMTTLWVEE 56

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           F   +P        SG S+         + + T      SR +   E++  ++       
Sbjct: 57  FKALYPNINAQVQASGSSTA-----PPALTEQTAQFGPMSRPMRLREVEAFERTHGYKPT 111

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
            + +  D I +   +D     L    L    ++ L    +   +   +   I  ++ +  
Sbjct: 112 ALRVAIDAIGIFVHQDNPVQGLNFPQLDAIFSATLRCGAEDFVSTWAQ-LGIDAEWAKRN 170

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
             ++  +   GT    +K  L  G  +S                              + 
Sbjct: 171 FQLFGRNSVSGTYGYFKKHALCGGDFKS-----------------------------QVN 201

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPISR 284
                   +  +       G+ G+ +      +L +     + + PS   I++G YP+SR
Sbjct: 202 EQPGSASVVQSVASTLSGIGYSGVGYRVAGVRLLPIAKQGNEFVYPSRENILTGDYPLSR 261

Query: 285 PLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            L  YV +           E++ F  S +  A    + + G + I+ E  K     +
Sbjct: 262 YLYVYVNKHPSKALSPIEAEFIKFIYSAQGQA---LVEKDGYVSITEEFAKQELAKV 315


>gi|313673536|ref|YP_004051647.1| phosphate abc transporter substrate-binding protein, phot family
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940292|gb|ADR19484.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 322

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 52/359 (14%), Positives = 123/359 (34%), Gaps = 59/359 (16%)

Query: 1   MRFFF--VVLMCFVVLEVYCGTGTFAR-----------NRIRIAGSSTLFPYSKIIAENF 47
           M+     + ++    + ++  +   ++             ++  GS T+     + AE +
Sbjct: 1   MKKLILSIAIVSITAVNLFASSMVDSKLPSYKKVKGVSGNLKSVGSDTMNNLMTLWAEKY 60

Query: 48  SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQE 107
             Y+P  K   +E  GSS        G    T      SR++   E+D+ +K        
Sbjct: 61  MSYYPNVKIE-IEGKGSSTAPAALISG----TAHFGPMSREMKAKEMDDFEKKYGYKPTG 115

Query: 108 VTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFPEV 165
           +    D + +  ++D     L++E++    +             +  W    +  ++   
Sbjct: 116 LRTSIDMLAVYVNKDNPIQCLSLEEVDAIFSKTRKRG---YQKDIVTWGDLGLTGEWANK 172

Query: 166 RIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAI 225
            I++Y  +   GT    ++ V + G  +                               +
Sbjct: 173 PISLYGRNSASGTYGYFKEHVFKNGDYKDT-----------------------------V 203

Query: 226 EVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG---IVPSMGTIVSGLYPI 282
           +     +  +  +  +K   G+ G+ +       + L    G   + P      +G YP+
Sbjct: 204 KEQPGSSSVVQGVTSDKYAIGYSGIGYKTAGVKAVALTEKKGGKCVEPDAAHAYTGEYPL 263

Query: 283 SRPLLFYVKRQHFNSVLGLR-EYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +R L  YV  +  +++  LR E++    S +       + + G  PI+N+  ++    +
Sbjct: 264 ARFLYVYVNYKPGSTLDPLRAEFLKLVFSKQGQ---EVVVKDGYFPITNKVAEAELAKV 319


>gi|294495555|ref|YP_003542048.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanohalophilus mahii DSM 5219]
 gi|292666554|gb|ADE36403.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanohalophilus mahii DSM 5219]
          Length = 295

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 64/303 (21%), Positives = 114/303 (37%), Gaps = 55/303 (18%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
             I I GS+T+FP ++  AE + E  PE     V SGGS+ G+K F  G     +DI  +
Sbjct: 46  EDIDIEGSTTVFPLAQAAAEIYMENHPEKSINVV-SGGSTTGIKAFIDG----DVDIAMA 100

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SRK+  +E++E + +G+ D  E  I  DG+ +V +       LT E +            
Sbjct: 101 SRKLKDSEIEEAEANGI-DPVEHIIAWDGLTVVVNPANPVNQLTYEQIK----------- 148

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
            +    +  W        +  + I       GT    + ++L E   R            
Sbjct: 149 GIYNGSISNW--ANVGGEDEEMVIQNRDPSSGTYGYFKDELLGEEEFR------------ 194

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                              +         +  +       G++G ++  ++  V+ +   
Sbjct: 195 -----------------PDLVSRDSNGAIVQAVTQEDAAIGYIGFAYLDDSVKVVDIDAG 237

Query: 266 DGI-VPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYG 324
           +G+  P+   I+ G YP++RPL FY   Q          ++ + +S+E       +   G
Sbjct: 238 NGMVAPTSENILPGEYPLARPLHFYTDGQPTGFAAN---FIEYILSEEGT---IIISDVG 291

Query: 325 LIP 327
             P
Sbjct: 292 YFP 294


>gi|4519569|dbj|BAA75654.1| phosphate-binding protein [Pseudomonas putida]
          Length = 334

 Score =  150 bits (379), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 48/322 (14%), Positives = 101/322 (31%), Gaps = 44/322 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE + + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAEAYKKEYPNVNI-QIQAAGSSTAPPALTEG----TANLGP 94

Query: 85  SSRKITQNELDECKKHG--VSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLI 142
            SRK+   EL   +             +  D + +   +D     LT+E +    +S  +
Sbjct: 95  MSRKMKDVELQAFEARRYGYKPNPPSPVAVDALAVFVHKDNPIKGLTMEQVDAVFSSTRL 154

Query: 143 VDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
              K           +  D     + ++  +   GT    +++ L +G  +         
Sbjct: 155 CGGKADVKTWGD-LGVTGDLANKPVQLFGRNSVSGTYGYFKEEALCKGDFK--------- 204

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                 +         +  I  + +  G+ G+ +   +   + L
Sbjct: 205 --------------------PNVNEQPGSASVVQSISSSLNGIGYSGIGYKTASVKTVPL 244

Query: 263 VPI---DGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDS 318
                 + I  +    ++G YP+SR L  YV +           E+V   +S        
Sbjct: 245 AKKGSTEYIEDNEENALNGKYPLSRFLYVYVNKAPNKPLAPLEAEFVKLVLSQAGQQ--- 301

Query: 319 QLFQYGLIPISNEERKSVRDSI 340
            + + G IP+ ++        +
Sbjct: 302 VVVKDGYIPLPSKVVDKTLADL 323


>gi|269965137|ref|ZP_06179271.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Vibrio alginolyticus 40B]
 gi|269830123|gb|EEZ84350.1| phosphate ABC transporter, periplasmic phosphate-binding protein,
           putative [Vibrio alginolyticus 40B]
          Length = 319

 Score =  150 bits (378), Expect = 2e-34,   Method: Composition-based stats.
 Identities = 50/353 (14%), Positives = 110/353 (31%), Gaps = 55/353 (15%)

Query: 5   FVVLMCFVVLEVYCGTGTFARN--------------RIRIAGSSTLFPYSKIIAENFSEY 50
             +   F +  + C     A++               +   GS TL   + +  E F   
Sbjct: 3   LRLAKTFSLFALVCSFIAAAQDKPLPTYHKTTGIVGNLLSVGSDTLAGMTTLWVEEFKSI 62

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
           +P        SG S+         + + T      SR +   E++  ++        + +
Sbjct: 63  YPNINAQVQASGSSTA-----PPALTEQTAQFGPMSRPMRLREVEAFEREHGYKPTALRV 117

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
             D I +   +D     L    L    ++ L   +       ++   +   + +  + ++
Sbjct: 118 AIDAIGIFVHQDNPIQGLNFSQLDALFSATLRCGESQFVTNWQQ-LGLESQWAKRNVQLF 176

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
             +   GT    +   L  G  ++R                             +     
Sbjct: 177 GRNSVSGTYGYFKSNALCGGDFKTR-----------------------------VNEQPG 207

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISRPLLF 288
               +  +       G+ G+ +      ++ +  +  D + P+   IVSG YP+SR L  
Sbjct: 208 SASVVQAVASTISGIGYSGVGYRVAGVRLVPVAKMGNDYVTPTREHIVSGKYPLSRYLYV 267

Query: 289 YVKRQHF-NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           YV +           E++ F  S +  A    + + G +PI+ +  +     +
Sbjct: 268 YVNKHPDYPLTPIEAEFIRFIFSAQGQA---LVEKDGYVPITADFAEEELKKV 317


>gi|54307918|ref|YP_128938.1| putative phosphate-binding protein [Photobacterium profundum SS9]
 gi|46912344|emb|CAG19136.1| putative phosphate-binding protein [Photobacterium profundum SS9]
          Length = 320

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 45/353 (12%), Positives = 106/353 (30%), Gaps = 53/353 (15%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFAR--------NRIRIAGSSTLFPYSKIIAENFSEYFPE 53
           R    +++ F +   +      A+          +   GS TL        E F   +P 
Sbjct: 5   RRILPMILAFSMHNAWALEADLAKYQKISGVSGNLSSVGSDTLANLMTYWGEEFKRKYPN 64

Query: 54  FKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHD 113
                  +G S+         + + T  +   SRK+   E++  +         + +  D
Sbjct: 65  VNIQIQTAGSSTA-----PTALTEATAQLGPMSRKMKAKEIEAFEHEYGYKPTAIRVAID 119

Query: 114 GILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFPEVRIAIYV 171
            + +    D     +  E L    +            P+ +W    +   + +  I  + 
Sbjct: 120 ALAVFVHEDNPLKGINFEQLDAVYSRTYRCG---ATQPITRWGQLGLTGRWADRDIQRFG 176

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
            +   GT    + + L +G                                  +      
Sbjct: 177 RNSVSGTYGYFKLRALCKGDF-----------------------------LNNVNEQPGS 207

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLV--PIDGIVPSMGTIVSGLYPISRPLLFY 289
              +  +  + +  G+ G+ +       + +     + +  ++   ++G YP++R L  Y
Sbjct: 208 ASVVQSVSTSLNAIGYSGIGYKTTGIRAIPVAREGDNYVDATIENSINGSYPLARYLYVY 267

Query: 290 VKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           V +  +      L E+  F +S       S + + G IP+     ++    + 
Sbjct: 268 VNKHPNKPLDPILTEFFKFVLSHNGQ---SIVEKDGYIPLPKSVVEADLALLK 317


>gi|254490313|ref|ZP_05103502.1| phosphate binding protein [Methylophaga thiooxidans DMS010]
 gi|224464446|gb|EEF80706.1| phosphate binding protein [Methylophaga thiooxydans DMS010]
          Length = 317

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 50/357 (14%), Positives = 112/357 (31%), Gaps = 61/357 (17%)

Query: 3   FFFVVLMCFVVLEVYCGTGTFA---------------RNRIRIAGSSTLFPYSKIIAENF 47
           F   + +    + +     TFA                  +   GS TL     + AE F
Sbjct: 2   FKKNLALLGAAMTMAFSPVTFADVDADLPDYEKVSGISGSLSSVGSDTLANLMTLWAEEF 61

Query: 48  SEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQE 107
           +  +P      +++ GSS        G    T +    SR++   E+   ++        
Sbjct: 62  NREYPNVSI-QIQAAGSSTAPPALTEG----TSNFGPMSRQMKDKEIAAFEEKYGYKATP 116

Query: 108 VTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRI 167
           + +  D + + + +D     +++  +    ++            +  WS++  D     I
Sbjct: 117 IRVAIDALAVYTHKDNPIEGMSIPQVDAVFSATRSCG---YSEDITNWSQLGLDLGN--I 171

Query: 168 AIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEV 227
            +Y  +   GT    +K  L +G  +                              ++  
Sbjct: 172 QLYGRNSVSGTYGYFKKVSLCKGDFK-----------------------------NSVNE 202

Query: 228 DGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIV---PSMGTIVSGLYPISR 284
                  +  +  + +  G+ G+ +  +    + L   DG      +     +G YP+SR
Sbjct: 203 QPGSASVVQGVTKSLNGIGYSGIGYKTSGVKAVALSKEDGGEFIAATKANAANGTYPLSR 262

Query: 285 PLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            L  YV +          RE++   +S         + + G +P+     +   + +
Sbjct: 263 YLYVYVNKAPNKPLAPIDREFIKMVLSKIGQQ---VVVKDGYVPLPASVVEQELNKL 316


>gi|119476349|ref|ZP_01616700.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [marine gamma proteobacterium HTCC2143]
 gi|119450213|gb|EAW31448.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [marine gamma proteobacterium HTCC2143]
          Length = 330

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 52/316 (16%), Positives = 105/316 (33%), Gaps = 42/316 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE F  ++P      +++ GSS        G    T +I  
Sbjct: 47  SGNLSSVGSDTLANLMTLWAEGFKRFYPNVNI-QIQAAGSSTAPPALTEG----TSNIGP 101

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR++   EL   +         V +  D + +   +D     ++++D+    +S     
Sbjct: 102 MSRRMKDKELASFEAKYGYKPTAVPVAIDALAVYVHKDNPIAGMSIQDIDAVFSSTRKCR 161

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
             V  +   K   +   +    I I+  +   GT    +KK L +G  ++          
Sbjct: 162 GNVNVDTWGKA-GLSGSWTNRDIQIFGRNSVSGTYGYFKKKGLCKGDFKNT--------- 211

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  +  + +  G+ G+ +  ++   + L  
Sbjct: 212 --------------------VNEQPGSASVVQSVATSINGIGYSGIGYKTSSVRAVPLSK 251

Query: 265 IDG---IVPSMGTIVSGLYPISRPLLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQL 320
             G   +  +    V+G YP+SR L  YV +          RE++   +S         +
Sbjct: 252 KPGGLFVAATSDNAVTGEYPLSRYLYVYVNKAPNQPLSPLDREFIKSVLSKAGQ---EVV 308

Query: 321 FQYGLIPISNEERKSV 336
            + G IP+  +     
Sbjct: 309 VKDGYIPLPAKVVARQ 324


>gi|323491598|ref|ZP_08096777.1| phosphate transport system substrate-binding protein [Vibrio
           brasiliensis LMG 20546]
 gi|323314174|gb|EGA67259.1| phosphate transport system substrate-binding protein [Vibrio
           brasiliensis LMG 20546]
          Length = 320

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/355 (16%), Positives = 110/355 (30%), Gaps = 55/355 (15%)

Query: 1   MRFFFVVLMCFVVLEV-YCGTGTFARN---------RIRIAGSSTLFPYSKIIAENFSEY 50
           M+   VV +  +V             +          +   GS TL   +    E F   
Sbjct: 1   MKKLIVVALLSLVSSAPSFAKPAMLPDYDKVAGITGELTTVGSDTLAGMTTSWVEEFKLL 60

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
           +P      V++ GSS         I          SR +   E++  ++       E+ +
Sbjct: 61  YPSVN-GQVQASGSSTAPPALTERI----AQFGPMSRPMLNREIEAFEREHGYKPTELRV 115

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDFPEVRIA 168
             D I +   RD     L    L    ++ L          +  W    +   + +  + 
Sbjct: 116 AIDAIGIFVHRDNPIEGLNFSQLDSIFSATLRCG---ATESISTWAQLGLDYQWGKRGMQ 172

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++  +   GT    +K  L  G  +                              ++   
Sbjct: 173 LFGRNSVSGTYGYFKKNALCGGDFK-----------------------------NSVNEQ 203

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPISRPL 286
                 +  +    +  G+ G+ +  +   +L +     D I  S   I+SG YP+SR L
Sbjct: 204 PGSASVVQSVGSAINTIGYSGVGYKVSQVKLLPIAKSGDDYIEASQQNILSGKYPLSRYL 263

Query: 287 LFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
             YV +          RE+V F  S +       + + G +PIS +  +   + +
Sbjct: 264 YVYVNKHPFKPLSPIEREFVRFIFSQQGQ---ELVEKEGYVPISPQIAEQELEKV 315


>gi|146305220|ref|YP_001185685.1| phosphate binding protein [Pseudomonas mendocina ymp]
 gi|145573421|gb|ABP82953.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Pseudomonas mendocina ymp]
          Length = 322

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 44/319 (13%), Positives = 105/319 (32%), Gaps = 41/319 (12%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS +L     + AE F + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDSLANLMTLWAEEFKKNYPNVNI-QIQAAGSSTAPPAMTEG----TANMGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR +  +E+   ++        V +  D + +   +D    SL++E +    +S  +  
Sbjct: 95  MSRPMKDSEIQAFEEKYGYKPTAVPVAIDALAVFVHKDNPIKSLSIEQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                        +  ++    + ++  +   GT    +++ L +G  +S          
Sbjct: 155 GDKDIKTWGD-LGLTGEWASKPLQLFGRNSVSGTYGYFKEEALCKGDFKS---------- 203

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         +  I    +  G+ G+ +  ++   + L  
Sbjct: 204 -------------------NVNEQPGSASVVQSISSTLNAIGYSGIGYKTSSVRAVPLSK 244

Query: 265 IDG--IVPSMGTIVSGLYPISRPLLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQLF 321
             G     S    ++G +P++R    YV +           E+V   +S +       + 
Sbjct: 245 KGGEAFEASEENALAGKFPLARFFYVYVNKAPNQPLSPLDAEFVKLMLSKQGQ---EVVM 301

Query: 322 QYGLIPISNEERKSVRDSI 340
           + G IP+ ++  +     +
Sbjct: 302 KDGYIPLPSKVAEKALKEL 320


>gi|85859333|ref|YP_461535.1| phosphate ABC transporter periplasmic protein [Syntrophus
           aciditrophicus SB]
 gi|85722424|gb|ABC77367.1| ABC-type phosphate transport system, periplasmic component
           [Syntrophus aciditrophicus SB]
          Length = 283

 Score =  150 bits (378), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 59/338 (17%), Positives = 115/338 (34%), Gaps = 58/338 (17%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           M+      +  + L  +      A   + I GS+T+ P ++   E + +  P        
Sbjct: 1   MKKVMSWFISCLALLAW-SLPAAAATTVVIKGSTTVLPIAQSALEAYMKTHPGVNISLSG 59

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
            G       E  + + D T DI  SSR+I   E    +  G+  + E  +  D I+ +  
Sbjct: 60  GG-----SGEGIKALMDRTTDIATSSREIKDKEAASARAKGIQPL-EHVVAIDAIVPIVH 113

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
                  LT++ L            ++    ++ W E+        I +       GT E
Sbjct: 114 PANRITGLTLDQL-----------SQIYQGKIRNWKEV--GGDNRPIVVVSRDSSSGTYE 160

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
                VL    V  R                              ++       +  I  
Sbjct: 161 SWGHLVLNGAKVTPRA-----------------------------QLQASSGAVVQTISK 191

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N+   G++GL +       +K + ++G+  S   +++  YPI+RPL  Y   +    V G
Sbjct: 192 NRYAIGYIGLGYL---NRSVKGLTVNGVQASSDNVLAKTYPIARPLYMYTNGEPKGDVAG 248

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRD 338
              +++F +S         + + G +P+    + + + 
Sbjct: 249 ---FINFVLSPAGQQ---LVAKDGFVPVKAPAKGNAKK 280


>gi|237801791|ref|ZP_04590252.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331024650|gb|EGI04706.1| phosphate ABC transporter periplasmic phosphate-binding protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 333

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 47/320 (14%), Positives = 102/320 (31%), Gaps = 42/320 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + AE + + +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDTLANLMTLWAEAYKKEYPSVNI-QIQAAGSSTAPPALTEG----TANLGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   EL   ++        + +  D + +   +D     LT+E +    +   +  
Sbjct: 95  MSRKMKDGELSAFEQKHGYKPTAIPVAVDALAVFVHKDNPIKGLTLEQVDAIFSVTRLCG 154

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
            +           +  D     I ++  +   GT    +++ L +G  +           
Sbjct: 155 ARADAKTWGD-VGVTGDLAGKPIQLFGRNSVSGTYGYFKEEALCKGDFK----------- 202

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               +         ++ I  + +  G+ G+ +  +N   + L  
Sbjct: 203 ------------------ANVNEQPGSASVVSSISNSLNSIGYSGIGYKTSNVRTVPLAR 244

Query: 265 IDGIVPSMGTIV---SGLYPISRPLLFYVKRQHFN-SVLGLREYVSFSVSDEMMAPDSQL 320
            +G            +G YP+SR L  YV +           E++   +S +       +
Sbjct: 245 KEGGEFVEDNEANTLNGTYPLSRFLYVYVNKAPNQPLAPLEAEFIKLVLSRQGQ---EVV 301

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G IP+     +     +
Sbjct: 302 MKDGYIPLPARVVERTMTEL 321


>gi|90579401|ref|ZP_01235211.1| putative phosphate-binding protein [Vibrio angustum S14]
 gi|90440234|gb|EAS65415.1| putative phosphate-binding protein [Vibrio angustum S14]
          Length = 336

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 49/321 (15%), Positives = 100/321 (31%), Gaps = 45/321 (14%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL       AE F   +P        +G S+         + + T  +  
Sbjct: 54  SGNLSSVGSDTLANLMTYWAEEFKRRYPNVNIQIQTAGSSTA-----PTALIEATAQLGP 108

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR +   E++  ++        + +  D + +    D     +  E L    +  L   
Sbjct: 109 MSRTMKNKEIEAFEQEYGYKPTAIKVAVDALAVFVHEDNPLKGINFEQLDAIYSRTLRCG 168

Query: 145 DKVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
                 P+ +W    +   + +  I IY  +   GT    +K  L  G  R         
Sbjct: 169 ---ALKPITEWGQLGLPGSWKDRGIQIYGRNSVSGTYGYFKKHALCRGDFR--------- 216

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                 +         +  +  + +  G+ G+ +       + +
Sbjct: 217 --------------------NNVNEQPGSASVVQSVSTSLNAIGYSGIGYKTTGIKAIPV 256

Query: 263 V--PIDGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQ 319
                D +  ++   VSG YP+SR L  YV +           E++ F +S +       
Sbjct: 257 AREGDDYVEATIENSVSGHYPLSRFLYIYVNKNPNKPLAPMEGEFLRFILSSDGQK---I 313

Query: 320 LFQYGLIPISNEERKSVRDSI 340
           + + G IP+  +  +    ++
Sbjct: 314 VQKDGYIPLPVKVVEQNIAAL 334


>gi|294495554|ref|YP_003542047.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanohalophilus mahii DSM 5219]
 gi|292666553|gb|ADE36402.1| phosphate ABC transporter substrate-binding protein, PhoT family
           [Methanohalophilus mahii DSM 5219]
          Length = 297

 Score =  150 bits (377), Expect = 3e-34,   Method: Composition-based stats.
 Identities = 58/338 (17%), Positives = 114/338 (33%), Gaps = 67/338 (19%)

Query: 5   FVVLMCFVVLEVYCGTG-------------TFARNRIRIAGSSTLFPYSKIIAENFSEYF 51
             ++M   +    C +              T    +I + GS+T+ P ++  AE +    
Sbjct: 12  LTLIMVLALFTAGCASNDEETDESPNGAEETAQAEQINVKGSTTVLPLAQAAAETYMANH 71

Query: 52  PEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIG 111
           PE        G            + D  + I  +SR+I   E+   + +G+ D  E  I 
Sbjct: 72  PEASISISGGG-----SGTGIAALIDGDVHIGMASRQIKDAEIKNAEANGI-DTVEHVIA 125

Query: 112 HDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYV 171
            DG+ +V + +     LT + +             +    +  W        +  I +  
Sbjct: 126 WDGLTVVVNPENPVDQLTYDQIK-----------GIYDGSISNW--ADVGGEDKEIVVIN 172

Query: 172 PSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDY 231
                GT    + +VL +      +                                   
Sbjct: 173 RDSSSGTYGYFQGEVLGDDNEFREDAVSTSS----------------------------N 204

Query: 232 TETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI-VPSMGTIVSGLYPISRPLLFYV 290
              L  +  N++  G++G ++  +N   L +   DG+  P+   I++G YP++RPL FY 
Sbjct: 205 GAVLQSVSQNEEAIGYIGFAYLTDNVKGLDVDKGDGMVAPTSENILAGDYPLARPLHFYT 264

Query: 291 KRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPI 328
             Q         +++ F +S+E       ++  G  P+
Sbjct: 265 DGQPTGLA---ADFIEFILSEEGT---EIVYDVGYFPV 296


>gi|71281115|ref|YP_267953.1| putative phosphate ABC transporter periplasmic phosphate-binding
           protein [Colwellia psychrerythraea 34H]
 gi|71146855|gb|AAZ27328.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Colwellia psychrerythraea 34H]
          Length = 319

 Score =  150 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 48/319 (15%), Positives = 102/319 (31%), Gaps = 41/319 (12%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL       AE+F   +P        +G S+         + + T ++  
Sbjct: 37  SGNVSSVGSDTLANMMTFWAEDFKRTYPNVNVQIQAAGSSTA-----PPALTEATSNLGP 91

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SRK+   E++  +K        V +  D + +   +D     LT+  +    ++     
Sbjct: 92  MSRKMKMREIEAFQKRYGYKPTRVRVAIDALAVFVHKDNPLEGLTIAQVDAVFSNNRKCG 151

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
                +       +   +    + +Y  +   GT    +KK L +G  +           
Sbjct: 152 ADKDIDRWGD-LGLSGAWTGKDVQLYGRNSVSGTYGYFKKKALCKGDFK----------- 199

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                              ++         +  +  + +  G+ G+ +  +    L L  
Sbjct: 200 ------------------NSVNEQPGSASVVQSVSASLNGIGYSGIGYRTSGVRALPLAK 241

Query: 265 ID--GIVPSMGTIVSGLYPISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLF 321
                I  +M   +SG YP+SR L  YV +  +        E++   +S         + 
Sbjct: 242 KGQVFIEANMENAISGKYPLSRYLYVYVNKHPNKALPPMEAEFLKMILSKTGQK---IVE 298

Query: 322 QYGLIPISNEERKSVRDSI 340
           + G IP+ ++        +
Sbjct: 299 KDGYIPLPSKVVAKEYKKL 317


>gi|220935816|ref|YP_002514715.1| ABC-type phosphate transport system, periplasmic component
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219997126|gb|ACL73728.1| ABC-type phosphate transport system, periplasmic component
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 323

 Score =  150 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 51/355 (14%), Positives = 106/355 (29%), Gaps = 58/355 (16%)

Query: 2   RFFFVVLMCFVVLEVYCGTG------------TFARNRIRIAGSSTLFPYSKIIAENFSE 49
           +  F   +   +L                         +   GS TL     + AE F++
Sbjct: 4   KKVFTAGIAATLLTSGAVLAEVDPNLPGYQRVAGISGNLSSIGSDTLNNMMTLWAEEFAK 63

Query: 50  YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVT 109
           ++P      ++  GSS        G    T ++   SR +  +E+   +        E+ 
Sbjct: 64  FYPNVNI-QIQGAGSSTAPPALIEG----TANLGPMSRAMRASEIRTFEDRHGYAPTEIP 118

Query: 110 IGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEI--RPDFPEVRI 167
           +  D + +  ++D     L++  +    ++          N +  W ++     +    I
Sbjct: 119 VAIDMVAVYVNKDNPIQGLSLPQVDAIFSATRACG---YANDITTWGQVGLTGAWANRDI 175

Query: 168 AIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEV 227
            +Y  +   GT    ++  L  G  +S                              I  
Sbjct: 176 TLYSRNAVSGTYGFFKENALCGGDFKST-----------------------------INE 206

Query: 228 DGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG---IVPSMGTIVSGLYPISR 284
               +  +  +E   +  G+ G+ +  +   V+ L    G      +    VSG YP++R
Sbjct: 207 QPGSSAVVRGVEQTINGIGYSGIGYKTSGVRVVPLAKEHGGQFAEANGENAVSGDYPLAR 266

Query: 285 PLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRD 338
            L  Y             RE+    +S E       + + G + +          
Sbjct: 267 FLYVYANANPTTGMAPLEREFFRMVLSKEGQ---EVVHRDGYVTLPASVAARFMK 318


>gi|89072665|ref|ZP_01159230.1| putative phosphate-binding protein [Photobacterium sp. SKA34]
 gi|89051485|gb|EAR56939.1| putative phosphate-binding protein [Photobacterium sp. SKA34]
          Length = 333

 Score =  150 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 49/321 (15%), Positives = 101/321 (31%), Gaps = 45/321 (14%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL       AE F   +P        +G S+         + + T  +  
Sbjct: 51  SGNLSSVGSDTLANLMTYWAEEFKRRYPNVNIQIQTAGSSTA-----PTALIEATAQLGP 105

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR +   E++  ++        + +  D + +    D     +  E L    +  L   
Sbjct: 106 MSRVMKNKEIEAFEQEYGYKPTAIKVAVDALAVFVHEDNPLKGINFEQLDAIYSRTLRCG 165

Query: 145 DKVVFNPLKKW--SEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
                 P+ +W    +   + +  I IY  +   GT    +K  L  G  R         
Sbjct: 166 ---ALKPITEWGQLGLPGSWKDRSIQIYGRNSVSGTYGYFKKHALCRGDFR--------- 213

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                 +         +  +  + +  G+ G+ +       + +
Sbjct: 214 --------------------NNVNEQPGSASVVQSVSTSLNAIGYSGIGYKTTGIKAIPV 253

Query: 263 V--PIDGIVPSMGTIVSGLYPISRPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQ 319
                D +  ++   VSG YP+SR L  YV +  +        E++ F +S +       
Sbjct: 254 AREGNDYVEATIENSVSGHYPLSRFLYVYVNKHPNKPLAPMEGEFLRFILSSDGQK---I 310

Query: 320 LFQYGLIPISNEERKSVRDSI 340
           + + G IP+  +  +    ++
Sbjct: 311 VQKDGYIPLPVKVVEQNMAAL 331


>gi|332160709|ref|YP_004297286.1| ABC superfamily (Peri_bind) high-affinity phosphate transporter
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|325664939|gb|ADZ41583.1| ABC superfamily (Peri_bind) high-affinity phosphate transporter
           [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
          Length = 295

 Score =  150 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 46/319 (14%), Positives = 96/319 (30%), Gaps = 41/319 (12%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS TL     + A++F+ ++P        +G S+         +      +  
Sbjct: 11  SGNLSSVGSDTLANLMSLWADDFNHHYPGVNLQIQAAGSSTA-----PAALAAGAAQLGP 65

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR +   E+    +        V +  D +++   +D     LT+  L    +      
Sbjct: 66  MSRPMKAAEITAFTERYGYPPLAVPVAVDALVVFVHQDNPLDKLTLSQLDAVFSQNRRCG 125

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
           +        +   ++  + E  I  Y  +   GT    ++ VL  G              
Sbjct: 126 ESHRIQRFGE-LGLKEHWAERSIQRYSRNSASGTYGFFKQLVLCGGDFS----------- 173

Query: 205 KYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP 264
                               I         +  +  + +  G+  + F  +    L L  
Sbjct: 174 ------------------NNINELPGSASVVQAVAGSLNGMGYASIGFRNSGVKPLSLSA 215

Query: 265 I--DGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLF 321
              D ++P+   +  G YP+SR L  Y+ +            ++   +S E       + 
Sbjct: 216 NGQDYVMPTAENVKDGRYPLSRYLYIYINKAPGKPLEPLTAAFLERVLSPEGQKR---VT 272

Query: 322 QYGLIPISNEERKSVRDSI 340
             G +P+  E     R  +
Sbjct: 273 HDGYLPLPPEILNHTRKEL 291


>gi|149909263|ref|ZP_01897919.1| putative phosphate ABC transporter, periplasmic
           phosphate-bindingprotein [Moritella sp. PE36]
 gi|149807580|gb|EDM67528.1| putative phosphate ABC transporter, periplasmic
           phosphate-bindingprotein [Moritella sp. PE36]
          Length = 325

 Score =  150 bits (377), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 57/360 (15%), Positives = 115/360 (31%), Gaps = 61/360 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN----------------RIRIAGSSTLFPYSKIIA 44
           M    +V+   + +        FA                   +   GS TL     + A
Sbjct: 1   MNIKQIVVALGISMTAIASQSAFAAGLDPKLPEYKKVSGISGNLSTVGSDTLANMMTLWA 60

Query: 45  ENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSD 104
           E F   +P      +++ GSS        G    T      SRK+   E++  +K     
Sbjct: 61  EEFKYTYPSVNV-QIQAAGSSTAPPALTEG----TSQFGPMSRKMKSKEIEAFEKRYGYK 115

Query: 105 IQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW--SEIRPDF 162
              + +  D + +   +D     L + D+    +S L   +      +++W    ++  +
Sbjct: 116 PTAIRVAIDALAVFVHKDNPIKGLNIADVDAIFSSTLKCGEA---KRVERWGELGLQGSW 172

Query: 163 PEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDG 222
            E  I ++  +   GT    +KK L +G  +                             
Sbjct: 173 AERDIQLFGRNSVSGTYGYFKKKALCKGDFK----------------------------- 203

Query: 223 IAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLY 280
             +         +  +  + +  G+ G+ +  +    + L     + I  S+    SG Y
Sbjct: 204 NNVNEQPGSASVVQSVSSSLNAIGYSGIGYKTSGVRAVPLAKKGTNYIEASLDNAASGKY 263

Query: 281 PISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDS 339
           P+SR L  YV +    +      E++ F +S +       + + G +P+ N         
Sbjct: 264 PLSRYLYVYVNKSPNKSLSPMQTEFLKFMLSKQGQK---IVAKDGYVPLPNSVTSKDLKK 320


>gi|86606216|ref|YP_474979.1| phosphate ABC transporter, phosphate-binding protein [Synechococcus
           sp. JA-3-3Ab]
 gi|86554758|gb|ABC99716.1| phosphate ABC transporter, phosphate-binding protein [Synechococcus
           sp. JA-3-3Ab]
          Length = 359

 Score =  149 bits (376), Expect = 4e-34,   Method: Composition-based stats.
 Identities = 52/368 (14%), Positives = 112/368 (30%), Gaps = 47/368 (12%)

Query: 2   RFFFVVLMCFVVLEVYCGTGTFARN-------RIRIAGSSTLFPYSKIIAENFSEYFPEF 54
           R  F+  +  V          + R         I  AG++   P  +  A+ F +  P  
Sbjct: 9   RRSFLKSLSAVAAGFAASQAGWQRVFAQQKTITINGAGATFPAPLYQTWAQEFGKKNPNI 68

Query: 55  KTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDEC--KKHGVSDIQEVTIGH 112
           +    +S GS  G ++F       T+D   S       E+ +   + +    +  V +  
Sbjct: 69  QV-NYQSVGSGAGRQQFVA----RTVDFGASDSVPRPEEISKIEGEANPPKGMVAVPMVG 123

Query: 113 DGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKW-------SEIRPDFPEV 165
             ++   +   V            +    +    +    +KKW             FP++
Sbjct: 124 GALVAAYNVPGVGPE---------IRLSRLALANIFLGKIKKWNDPLLAGLNPGVTFPDM 174

Query: 166 RIAIYVPSGKHGTREVLE---KKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDG 222
            I +   S   GT ++       +  E   +    S +        +        ++Q  
Sbjct: 175 PITVVHRSDGSGTTDIFTTHLNAISPEWRQKVGRGSSVNWPTGVGARGNEGVSEQIKQIP 234

Query: 223 IAIEVDGDYTETLARIEVN--KDVFGFVGLSFYKNNADVLKLVPID----GIVPSMGTIV 276
            +I         L  +     ++  G   +   +     L  + +D    G+ P      
Sbjct: 235 GSIGYVEYGFAKLNNLNFARLENRAGKFVVPKVETEQAALARIKLDERLLGVDPDPE--G 292

Query: 277 SGLYPISRPLLF--YVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERK 334
              YPI        Y       +   ++E++ +++++      S     G +P+  E RK
Sbjct: 293 EDSYPIVGYTWILAYQVYPKAETSKAVKEFLRYALTEGQ----SFAEPLGYVPLPEETRK 348

Query: 335 SVRDSIAV 342
               ++  
Sbjct: 349 KALAALEK 356


>gi|238787965|ref|ZP_04631761.1| ABC superfamily (Peri_bind) high-affinity phosphate transporter
           [Yersinia frederiksenii ATCC 33641]
 gi|238723913|gb|EEQ15557.1| ABC superfamily (Peri_bind) high-affinity phosphate transporter
           [Yersinia frederiksenii ATCC 33641]
          Length = 334

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 44/332 (13%), Positives = 95/332 (28%), Gaps = 41/332 (12%)

Query: 12  VVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEF 71
            +              +   GS TL     + AE+F+ ++P        +G S+      
Sbjct: 37  ALPSSSISASQTLSGNLSSVGSDTLANLMSLWAEDFNHHYPGVNLQIQAAGSST-----A 91

Query: 72  CRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVE 131
              +      +   SR +   E+    +        V +  D +++   RD     +T+ 
Sbjct: 92  PAALAAGATQLGPMSRPMKVAEITAFTQRYGYPPLAVPVAVDALVVFVHRDNPLNKITLP 151

Query: 132 DLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGC 191
            L    +       ++          +   +    +  Y  +   GT    + +VL +G 
Sbjct: 152 QLDAIFSQNRRC-GELHRISRFGELGLGGSWAGRSLQRYSRNSASGTYGFFKHQVLCDGD 210

Query: 192 VRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLS 251
                                            +         +  +  + +  G+  + 
Sbjct: 211 FS-----------------------------NNVNELPGSASVVQAVAGSLNGIGYASIG 241

Query: 252 FYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISRPLLFYVKRQHFN-SVLGLREYVSFS 308
           F       L L     D ++P+   +  G YP+SR L  Y+ +            ++   
Sbjct: 242 FRNTGVKPLALAVNGQDFVMPTAENVKEGNYPLSRYLYIYINKAPGQPLEPLTAAFLERV 301

Query: 309 VSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           +S E       +   G +P+  E     R  +
Sbjct: 302 LSPEGQKR---VIHDGYLPLPPEMLSHTRKEL 330


>gi|309790668|ref|ZP_07685219.1| phosphate binding protein [Oscillochloris trichoides DG6]
 gi|308227262|gb|EFO80939.1| phosphate binding protein [Oscillochloris trichoides DG6]
          Length = 367

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 71/307 (23%), Positives = 125/307 (40%), Gaps = 45/307 (14%)

Query: 21  GTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTI 80
                  I  AGSST+FP S+ +AE F++     +   ++S GS  G + FC        
Sbjct: 89  PATVTGDIIAAGSSTVFPLSERMAEIFNDDGYTGQI-TIDSIGSGAGFERFCVAA---ET 144

Query: 81  DIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASY 140
           DI N+SR I   E++ CK +G + I+         ++VS  +     LT+E L       
Sbjct: 145 DIANASRAIKAEEIEACKGNGRTPIEFRVGTDALAVVVSSENDFLTGLTMEQL------- 197

Query: 141 LIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKM 200
                 V     K W+++ P +P   I ++ P    GT +   + VL++   +       
Sbjct: 198 ----AAVFSGEAKTWADVDPSYPAEAIQLFSPGTDSGTFDYFVEAVLEKDEAKI------ 247

Query: 201 RDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVL 260
                                    ++  D    +  IE +    G+ G ++Y  N  +L
Sbjct: 248 --------------------LAANPQLSEDDNVLVQGIEGSPYAIGYFGYAYYLENKGML 287

Query: 261 KLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQL 320
           K++ IDG+ P+  T   G YP+SRPL  Y      +    +  +++F +++     + ++
Sbjct: 288 KILDIDGVTPTEVTAEDGTYPLSRPLYIYSDATIMSEKPQVAAFINFYLTN----VNDEV 343

Query: 321 FQYGLIP 327
              G  P
Sbjct: 344 VDVGYFP 350


>gi|86145560|ref|ZP_01063890.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           sp. MED222]
 gi|85836531|gb|EAQ54657.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           sp. MED222]
          Length = 318

 Score =  149 bits (376), Expect = 5e-34,   Method: Composition-based stats.
 Identities = 58/354 (16%), Positives = 114/354 (32%), Gaps = 52/354 (14%)

Query: 1   MRFFFVVLMCFVVLE-VYCGTGTFA----------RNRIRIAGSSTLFPYSKIIAENFSE 49
           MRF    L+   ++  V+      +             +   GS TL   + +  E F  
Sbjct: 1   MRFPISSLLALALVTPVHAEQSVDSLPDYSKVPGISGSLLSVGSDTLAGMTTLWVEEFKS 60

Query: 50  YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVT 109
           Y+P      V++ GSS        G    T  +   SR +   E++  ++        + 
Sbjct: 61  YYPNVN-AQVQASGSSTAPPALTEG----TAHLGPMSRPMRLREVEAFEREHGYKPTALR 115

Query: 110 IGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI 169
           +  D I L   RD     L   ++    +  L        N  +    I   + + R  +
Sbjct: 116 VAIDAIGLFVHRDNSIEGLNFREIDSIFSETLRCGATKPLNNWQD-LGISQPWAKHRFQL 174

Query: 170 YVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDG 229
           +  +   GT    ++  L  G  ++R                             +    
Sbjct: 175 FGRNSVSGTYGYFKQNALCSGDFKNR-----------------------------VNEQP 205

Query: 230 DYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI--DGIVPSMGTIVSGLYPISRPLL 287
                +  +  +    G+ G+ +      ++ +     D + P+   I+SG YP+SR L 
Sbjct: 206 GSASVVQSVASSISGIGYSGIGYRVAGVKLIPIAEHGSDYVEPTRANILSGDYPLSRFLY 265

Query: 288 FYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
            YV +          RE+++F  S +       + + G + I  E  +     +
Sbjct: 266 VYVNKHPDKPLSPVEREFLTFVFSKQGQ---ELVEKDGYLAIPPEFAEQELAKV 316


>gi|328472630|gb|EGF43493.1| phosphate transport system substrate-binding protein [Vibrio
           parahaemolyticus 10329]
          Length = 319

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 48/348 (13%), Positives = 110/348 (31%), Gaps = 55/348 (15%)

Query: 10  CFVVLEVYCGTGTFARN--------------RIRIAGSSTLFPYSKIIAENFSEYFPEFK 55
               + + C +   A++               +   GS TL   + +  E F   +P   
Sbjct: 8   AIACIALTCSSMAVAQDKPLPNYHKTTGIVGNLLSVGSDTLAGMTTLWVEEFKSIYPNIN 67

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
                SG S+         + + T      SR +   E++  ++        + +  D I
Sbjct: 68  AQVQASGSSTA-----PPALTEQTAQFGPMSRPMRLKEIEAFERQHGYKPTALRVAIDAI 122

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
            +   +D     L    L    ++ L   +       ++   ++ ++ +  + ++  +  
Sbjct: 123 GIFVHQDNPIQGLNFNQLDAMFSATLRCGESQFITNWQQ-LGLKAEWAKRNLQLFGRNSV 181

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GT    +   L  G  ++R                             +         +
Sbjct: 182 SGTYGYFKSNALCGGDFKTR-----------------------------VNEQPGSASVV 212

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
             +       G+ G+ +      ++ +    ++ + P+   IVSG YP+SR L  YV + 
Sbjct: 213 QSVASTISGVGYSGVGYRVAGVRLVPIAKRGVNYVSPTRTNIVSGKYPLSRYLYVYVNKH 272

Query: 294 HF-NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
                     E++ F  S +  A    + + G +PI+ +        +
Sbjct: 273 PDYPLSPIEAEFIRFMFSAQGQA---LVEKDGYVPITADFAAEELKKV 317


>gi|291449238|ref|ZP_06588628.1| phosphate binding protein [Streptomyces roseosporus NRRL 15998]
 gi|291352185|gb|EFE79089.1| phosphate binding protein [Streptomyces roseosporus NRRL 15998]
          Length = 318

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 78/359 (21%), Positives = 132/359 (36%), Gaps = 64/359 (17%)

Query: 1   MRFFF--VVLMCFVVLEVYCGTGTFA----------RNRIRIAGSSTLFPYSKIIAENFS 48
           MR     + L   V+L      G  A             +++ GSST+ P S + A+ F 
Sbjct: 1   MRRAKAPLALTAAVMLAASACGGADAGSGGEGGDKLSGTVKVDGSSTVAPLSTVAAQLFQ 60

Query: 49  EYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEV 108
           +  P  K     SG      ++FC G      DI N+SR+I   E   C+K GV   +  
Sbjct: 61  QANPGVKVTVGTSGTGGG-FEKFCAG----ETDISNASREIKDEEKALCEKAGVKFEEFS 115

Query: 109 TIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIA 168
                  ++VS  +     LTVE L K       V+          W+++ P FP  ++ 
Sbjct: 116 VANDGLSVVVSKDNDFVECLTVEQLKKIWEPGSKVN---------NWNQVDPKFPNQKME 166

Query: 169 IYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVD 228
           ++      GT +     +  E      ++                               
Sbjct: 167 LFGAGTDSGTFDYFTDAINGEEGASRTDY----------------------------NPS 198

Query: 229 GDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDG----IVPSMGTIVSGLY-PIS 283
            D   T+  +  +K   G+ GLS+++ N D LK + IDG    + P + T+ +G Y P+ 
Sbjct: 199 EDDNVTVRGVSGSKGGIGYFGLSYFEENKDKLKALKIDGGGGCVAPGIETVQNGTYTPLG 258

Query: 284 RPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           R L  Y K            +V + V +          +   +P++ E++K +   +A 
Sbjct: 259 RQLFIYPKASSLEK-PEAEAFVEYYVENSA----EIAEKAQFVPLNAEQQKELEKDLAT 312


>gi|28897345|ref|NP_796950.1| putative phosphate ABC transporter periplasmic phosphate-binding
           protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|153838086|ref|ZP_01990753.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           parahaemolyticus AQ3810]
 gi|260364509|ref|ZP_05777130.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           parahaemolyticus K5030]
 gi|260876307|ref|ZP_05888662.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           parahaemolyticus AN-5034]
 gi|28805554|dbj|BAC58834.1| putative phosphate ABC transporter, periplasmic phosphate-binding
           protein [Vibrio parahaemolyticus RIMD 2210633]
 gi|149748553|gb|EDM59412.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           parahaemolyticus AQ3810]
 gi|308093004|gb|EFO42699.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           parahaemolyticus AN-5034]
 gi|308114693|gb|EFO52233.1| ABC-type phosphate transport system, periplasmic component [Vibrio
           parahaemolyticus K5030]
          Length = 319

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 48/348 (13%), Positives = 110/348 (31%), Gaps = 55/348 (15%)

Query: 10  CFVVLEVYCGTGTFARN--------------RIRIAGSSTLFPYSKIIAENFSEYFPEFK 55
               + + C +   A++               +   GS TL   + +  E F   +P   
Sbjct: 8   AIACIALTCSSMAVAQDKPLSNYHKTTGIVGNLLSVGSDTLAGMTTLWVEEFKSIYPNIN 67

Query: 56  TPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGI 115
                SG S+         + + T      SR +   E++  ++        + +  D I
Sbjct: 68  AQVQASGSSTA-----PPALTEQTAQFGPMSRPMRLKEIEAFERQHGYKPTALRVAIDAI 122

Query: 116 LLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGK 175
            +   +D     L    L    ++ L   +       ++   ++ ++ +  + ++  +  
Sbjct: 123 GIFVHQDNPIQGLNFNQLDAMFSATLRCGESQFITNWQQ-LGLKAEWAKRNLQLFGRNSV 181

Query: 176 HGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETL 235
            GT    +   L  G  ++R                             +         +
Sbjct: 182 SGTYGYFKSNALCGGDFKTR-----------------------------VNEQPGSASVV 212

Query: 236 ARIEVNKDVFGFVGLSFYKNNADVLKLVP--IDGIVPSMGTIVSGLYPISRPLLFYVKRQ 293
             +       G+ G+ +      ++ +    ++ + P+   IVSG YP+SR L  YV + 
Sbjct: 213 QSVASTISGVGYSGVGYRVAGVRLVPIAKRGVNYVSPTRTNIVSGKYPLSRYLYVYVNKH 272

Query: 294 HF-NSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
                     E++ F  S +  A    + + G +PI+ +        +
Sbjct: 273 PDYPLSPIEAEFIRFMFSAQGQA---LVEKDGYVPITADFAAEELKKV 317


>gi|146284339|ref|YP_001174492.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pseudomonas stutzeri A1501]
 gi|145572544|gb|ABP81650.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Pseudomonas stutzeri A1501]
          Length = 321

 Score =  149 bits (375), Expect = 6e-34,   Method: Composition-based stats.
 Identities = 45/320 (14%), Positives = 105/320 (32%), Gaps = 44/320 (13%)

Query: 25  RNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVN 84
              +   GS +L     + AE F   +P      +++ GSS        G    T ++  
Sbjct: 40  SGNLSSVGSDSLANLMTLWAEEFKRSYPNVNI-QIQAAGSSTAPPALTEG----TANMGP 94

Query: 85  SSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVD 144
            SR +  NE+   ++        V +  D + +   +D    SL +E +    +S  +  
Sbjct: 95  MSRPMKDNEIQAFEEKYGYKPTAVPVAIDALAVFVHKDNPIKSLDIEQVDAIFSSTRLCG 154

Query: 145 DKVVFNPLKKWSEIRP--DFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRD 202
            +     +K W ++    ++    I ++  +   GT    +++ L +G  +         
Sbjct: 155 GE---KDIKTWGDLGMTGEWAAKPIQLFGRNSVSGTYGYFKEEALCKGDFK--------- 202

Query: 203 MFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKL 262
                                 +         +  I    +  G+ G+ +  ++   + L
Sbjct: 203 --------------------PNVNEQPGSASVVQSISSTLNAIGYSGIGYKTSSVRAVPL 242

Query: 263 VP-IDGIVPSMGTIVSGLYPISRPLLFYVKRQH-FNSVLGLREYVSFSVSDEMMAPDSQL 320
               +    S    ++G +P++R    YV +           E++   +S +       +
Sbjct: 243 SKGGEAFEASEENALAGKFPLARFFYVYVNKAPNKPLSPIDAEFLKLVLSKQGQ---DVV 299

Query: 321 FQYGLIPISNEERKSVRDSI 340
            + G IP+  +        +
Sbjct: 300 VKDGYIPLPKKVVDKTMQEL 319


>gi|217076257|ref|YP_002333973.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermosipho africanus TCF52B]
 gi|217036110|gb|ACJ74632.1| phosphate ABC transporter, periplasmic phosphate-binding protein
           [Thermosipho africanus TCF52B]
          Length = 273

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 66/327 (20%), Positives = 142/327 (43%), Gaps = 60/327 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           MR  FV+    +V   +          + I GS+T+FP +++  E   + +P+ +   +E
Sbjct: 1   MRKIFVIFAILLVFFAFSR-------TLVIKGSNTIFPVAQLWIEELKKMYPDMEI-TLE 52

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GSS G+      + ++T DI NSSR + ++E+++           + +G+DGI ++ +
Sbjct: 53  GAGSSTGI----AALFNETADIANSSRWLKESEIEKMHS-MKKYFVPIIVGYDGIAVIVN 107

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +++   +++           +     +    ++ WS++ P+ P+ +I IY  +   GT E
Sbjct: 108 KNLGIENIS-----------IDTLKDIYTGKIRYWSQVDPNLPKKQIVIYSRNTASGTFE 156

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E KVL +  +                                + +       +  ++ 
Sbjct: 157 TFENKVLNKEKM-----------------------------APWVRMVESTQFEIESVKN 187

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFN-SVL 299
           N     + G+ +   +   +K++ +DG++P+   I+ G YPISRPL  +V   +      
Sbjct: 188 NPYAIAYTGIGYVTED---VKVLKVDGVLPTKRNILEGTYPISRPLYMFVDASNGYLVDD 244

Query: 300 GLREYVSFSVSDEMMAPDSQLFQYGLI 326
            +++YV+F+VS +       + + G +
Sbjct: 245 LIKKYVNFAVSKKGQ---DLVEKAGYV 268


>gi|330684714|gb|EGG96412.1| phosphate binding protein [Staphylococcus epidermidis VCU121]
          Length = 326

 Score =  149 bits (375), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 64/358 (17%), Positives = 125/358 (34%), Gaps = 67/358 (18%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFA-----------RNRIRIAGSSTLFPYSKIIAENFSE 49
           M+ + +V    +   V  G                  +++  GSST+ P  + + E F++
Sbjct: 1   MKKWQLVGTTVLGASVLLGACGGGNNGGSGEGKDVSGKVKGDGSSTVGPIIEKLNEKFAK 60

Query: 50  YFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVT 109
            +P        SG                  D  N+SR I   E  + +  G+   +   
Sbjct: 61  DYPNATVSSGTSG-----TGGGFEKFISGETDFSNASRPIKDEEKKKLEDKGIKYKEYKI 115

Query: 110 IGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAI 169
                 + V+  +    SL+ + L            ++     K W ++   +P+ +I  
Sbjct: 116 AQDGVTVTVNKDNDFVKSLSKDQLK-----------EIYSGKAKTWKDVNSKWPDKKIKA 164

Query: 170 YVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDG 229
           + P   HGT +   ++V+ +G +++   +                               
Sbjct: 165 FSPDQSHGTFDFFTEEVMDKGDIKAEKNA------------------------------- 193

Query: 230 DYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGI-----VPSMGTIVSGLYPISR 284
           D    +  +E NK+  G+ G +FY+ N D LK V I         P+  TI    Y +SR
Sbjct: 194 DTNVIVQSVEKNKEGIGYFGYNFYQQNKDKLKEVKIKDDKGKDTEPTKKTIQDNSYALSR 253

Query: 285 PLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIAV 342
           PL  Y K +        +E++ F++ D+  +        G + +  ++ K     +  
Sbjct: 254 PLFIYAKEKSLKENKAFQEFMKFTLEDKGKS----AEDAGYVALPKKDYKEELKDLKK 307


>gi|256823302|ref|YP_003147265.1| phosphate-binding protein [Kangiella koreensis DSM 16069]
 gi|256796841|gb|ACV27497.1| phosphate binding protein [Kangiella koreensis DSM 16069]
          Length = 319

 Score =  149 bits (374), Expect = 7e-34,   Method: Composition-based stats.
 Identities = 54/358 (15%), Positives = 113/358 (31%), Gaps = 59/358 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARN--------------RIRIAGSSTLFPYSKIIAEN 46
           M  F  V +  VV  +  G      +               +   GS TL     + AE 
Sbjct: 1   MNVFKKVALVAVVSALSAGVTQAKVDEKLPVYEKTSGVSGNLSSVGSDTLANLMTLWAEE 60

Query: 47  FSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQ 106
           F   +P      +++ GSS        G    T +I   SR +   EL+  +K       
Sbjct: 61  FKRQYPNVNI-QIQAAGSSTAPPALTEG----TSNIGPMSRLMKDKELEAFEKKHGYKPT 115

Query: 107 EVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVR 166
            + +  D + +   +D     +T+ ++    +S            +  W+++        
Sbjct: 116 AIAVAIDALAVYVHKDNPIEGMTIAEVDAVFSSTRKCG---ADKDISNWADLDLADLG-D 171

Query: 167 IAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIE 226
           + IY  +   GT    +K  L +G  +                              ++ 
Sbjct: 172 MQIYGRNSVSGTYGYFKKHALCKGDFK-----------------------------NSVN 202

Query: 227 VDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI---DGIVPSMGTIVSGLYPIS 283
                   +  + ++K+  G+ G  +  ++   + L      +    +    +SG YP+ 
Sbjct: 203 EQPGSASVVQSVGLSKNAIGYSGYGYRTSSVKAVPLAKKAGGEFYEANAENAISGNYPLG 262

Query: 284 RPLLFYVKR-QHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSI 340
           R L+ YV +  +        E++   +S         + + G IP+     +     +
Sbjct: 263 RQLIVYVNKHPNKPLSPIELEFMKMVLSKVGQ---EVVVKDGYIPLPASIAERELQKL 317


>gi|320159673|ref|YP_004172897.1| putative phosphate ABC transporter substrate binding protein
           precursor [Anaerolinea thermophila UNI-1]
 gi|319993526|dbj|BAJ62297.1| putative phosphate ABC transporter substrate binding protein
           precursor [Anaerolinea thermophila UNI-1]
          Length = 295

 Score =  149 bits (374), Expect = 9e-34,   Method: Composition-based stats.
 Identities = 62/341 (18%), Positives = 119/341 (34%), Gaps = 61/341 (17%)

Query: 1   MRF---FFVVLMCFVVLEVYCGTGTFARN-------RIRIAGSSTLFPYSKIIAENFSEY 50
           MR    FF V++  + L                    I+  GS T+   +   AE + + 
Sbjct: 1   MRRALWFFAVIILILFLSSCASRTVQGETLSTEPSYYIQNKGSDTIVNLALRWAEAYQQA 60

Query: 51  FPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTI 110
            PE +      G            + D T+DI N+SR + + E++  +  G+    E  I
Sbjct: 61  HPEVRISVTGGG-----SGTGIAALIDGTVDIANASRAMKKEEIEAARAKGIEP-VEHVI 114

Query: 111 GHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIY 170
             D I ++ +       LT+E +             +    +  W E+     +  I   
Sbjct: 115 ARDAIAVIVNPSNPVSQLTLEQISL-----------IYQGKINNWREV--GGEDRPIVRL 161

Query: 171 VPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGD 230
                 GT     + V++ G   ++       +   + + +                   
Sbjct: 162 SRETNSGTHVYFLEAVVRLGQKDNKALFSPDTLLLPSSEGI------------------- 202

Query: 231 YTETLARIEVNKDVFGFVGLSFYKNNADVLKLVP---IDGIVPSMGTIVSGLYPISRPLL 287
               +  +  N +  G+ GL +      VL +        I+PS+ T+ SG YPISR L 
Sbjct: 203 ----ITEVRDNPNAIGYDGLGYVTPEVKVLAVAKTADDPYILPSVETVNSGAYPISRDLY 258

Query: 288 FYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLIPI 328
            Y +++       ++ Y+ + +S E       + + G +P+
Sbjct: 259 MYTQKE---VNAAVQAYLDWLLSPEAQK---IVLELGFVPV 293


>gi|261822542|ref|YP_003260648.1| phosphate binding protein [Pectobacterium wasabiae WPP163]
 gi|261606555|gb|ACX89041.1| phosphate binding protein [Pectobacterium wasabiae WPP163]
          Length = 312

 Score =  149 bits (374), Expect = 9e-34,   Method: Comp