RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780707|ref|YP_003065120.1| putative phosphate-binding periplasmic protein [Candidatus Liberibacter asiaticus str. psy62] (346 letters) >gnl|CDD|162722 TIGR02136, ptsS_2, phosphate binding protein. Members of this family are phosphate-binding proteins. Most are found in phosphate ABC-transporter operons, but some are found in phosphate regulatory operons. This model separates members of the current family from the phosphate ABC transporter phosphate binding protein described by TIGRFAMs model TIGR00975. Length = 287 Score = 124 bits (314), Expect = 2e-29 Identities = 81/302 (26%), Positives = 133/302 (44%), Gaps = 53/302 (17%) Query: 28 IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87 I I GS+T+ P ++ AE F + P V+ GS G+K G T+DI NSSR Sbjct: 38 ITIDGSTTVAPLAEAAAEEFQKIHPGVSVT-VQGAGSGTGIKALING----TVDIGNSSR 92 Query: 88 KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSV-SLTVEDLYKALASYLIVDDK 146 I EL + K+ G+ I E + DG+ +V ++ V V LTVE L K I + Sbjct: 93 PIKDEELQKDKQKGIKLI-EHKVAVDGLAVVVNKKNVPVDDLTVEQLKK------IYSGE 145 Query: 147 VVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFKY 206 + W E+ D P I + + GTR+ E++V+ + + Sbjct: 146 I-----TNWKEVGGDLPNKPIVVVGRNAGSGTRDTFEEEVMGK-----------AKIKPG 189 Query: 207 NVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPID 266 +Q S +G + + N G++GL + ++ LK ++ Sbjct: 190 KNEQES--------NGAVVS----------IVSSNPGAIGYLGLGYVDDSVKTLK---VN 228 Query: 267 GIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGLI 326 G+ PS I +G YP+SRPL YV + L + E++ F +SD+ + + + G + Sbjct: 229 GVEPSKENIANGSYPLSRPLFMYVNGKPKKPEL-VAEFIDFVLSDD--GGERIVEELGYV 285 Query: 327 PI 328 P+ Sbjct: 286 PL 287 >gnl|CDD|178679 PLN03133, PLN03133, beta-1,3-galactosyltransferase; Provisional. Length = 636 Score = 29.4 bits (66), Expect = 1.4 Identities = 15/43 (34%), Positives = 22/43 (51%) Query: 194 SRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLA 236 S+ +K R F + LSVA V +GI + VDG + + A Sbjct: 288 SQEATKARRYFPFKQGYLSVATLRVGTEGIQMTVDGKHITSFA 330 >gnl|CDD|184796 PRK14701, PRK14701, reverse gyrase; Provisional. Length = 1638 Score = 29.1 bits (65), Expect = 1.9 Identities = 12/30 (40%), Positives = 15/30 (50%) Query: 138 ASYLIVDDKVVFNPLKKWSEIRPDFPEVRI 167 AS LIVDD +FN L + R +F Sbjct: 518 ASVLIVDDPEIFNALIRQMRFRFEFEFKSF 547 >gnl|CDD|169408 PRK08373, PRK08373, aspartate kinase; Validated. Length = 341 Score = 28.9 bits (65), Expect = 2.0 Identities = 17/63 (26%), Positives = 32/63 (50%), Gaps = 3/63 (4%) Query: 102 VSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPD 161 VS ++ VT D +L +++ +E++++ A L +D +++ LKK RPD Sbjct: 39 VSALKGVT---DKLLKLAETFDKEALEEIEEIHEEFAKRLGIDLEILSPYLKKLFNSRPD 95 Query: 162 FPE 164 P Sbjct: 96 LPS 98 >gnl|CDD|181518 PRK08643, PRK08643, acetoin reductase; Validated. Length = 256 Score = 28.5 bits (64), Expect = 2.3 Identities = 21/69 (30%), Positives = 30/69 (43%), Gaps = 6/69 (8%) Query: 206 YNVQQLSVACTSVRQDG---IAIEVD-GDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261 YN + A + +DG IA++ D D + A + D FG L+ NNA V Sbjct: 34 YNEETAQAAADKLSKDGGKAIAVKADVSDRDQVFAAVRQVVDTFG--DLNVVVNNAGVAP 91 Query: 262 LVPIDGIVP 270 PI+ I Sbjct: 92 TTPIETITE 100 >gnl|CDD|180422 PRK06142, PRK06142, enoyl-CoA hydratase; Provisional. Length = 272 Score = 27.6 bits (62), Expect = 4.6 Identities = 12/28 (42%), Positives = 14/28 (50%), Gaps = 6/28 (21%) Query: 155 WSEIRPDF------PEVRIAIYVPSGKH 176 WSE+ F PEVR + SGKH Sbjct: 35 WSELPEIFRWLDADPEVRAVVLSGSGKH 62 >gnl|CDD|184890 PRK14896, ksgA, 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional. Length = 258 Score = 27.6 bits (62), Expect = 5.2 Identities = 20/67 (29%), Positives = 26/67 (38%), Gaps = 13/67 (19%) Query: 223 IAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGL-YP 281 AIE+D E L E+ + D LK V +P +VS L Y Sbjct: 55 YAIELDPRLAEFLRDDEIAAGNVEII-------EGDALK-VD----LPEFNKVVSNLPYQ 102 Query: 282 ISRPLLF 288 IS P+ F Sbjct: 103 ISSPITF 109 >gnl|CDD|184553 PRK14176, PRK14176, bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase; Provisional. Length = 287 Score = 27.5 bits (61), Expect = 5.4 Identities = 13/38 (34%), Positives = 20/38 (52%), Gaps = 3/38 (7%) Query: 257 ADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQH 294 + V +L GI P + TI+ G P S+ YV+ +H Sbjct: 26 SGVERLKSNRGITPGLATILVGDDPASK---MYVRLKH 60 >gnl|CDD|177782 PLN00188, PLN00188, enhanced disease resistance protein (EDR2); Provisional. Length = 719 Score = 27.1 bits (60), Expect = 6.9 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Query: 293 QHFNSVLGLREYVSFSVSDEMMAP 316 Q NSV GLRE+ FS +DE AP Sbjct: 378 QMLNSVAGLREW--FSQTDERGAP 399 >gnl|CDD|129249 TIGR00144, beta_RFAP_syn, beta-RFAP synthase. This protein family contains several archaeal examples of beta-ribofuranosylaminobenzene 5-prime-phosphate synthase (beta-RFAP synthase), an enzyme involved in methanopterin biosynthesis. In some species, two members of this family are found. It is unclear whether both act as beta-RFAP synthase. This family is related to the GHMP kinases (Galactokinase, Homoserine kinase, Mevalonate kinase, Phosphomevalonate kinase). Members are found so far only in the Archaea and in Methylobacterium extorquens. Length = 324 Score = 27.1 bits (60), Expect = 7.6 Identities = 12/35 (34%), Positives = 17/35 (48%), Gaps = 5/35 (14%) Query: 159 RPDFPEVRIAIYVPSGKH--GTREVLEKKVLQEGC 191 R DFP+ I + +P G REV + Q+ C Sbjct: 176 RYDFPDWNIILAIPEIDSVSGRREV---NIFQKYC 207 >gnl|CDD|181823 PRK09401, PRK09401, reverse gyrase; Reviewed. Length = 1176 Score = 26.8 bits (60), Expect = 8.0 Identities = 9/17 (52%), Positives = 12/17 (70%) Query: 138 ASYLIVDDKVVFNPLKK 154 S L+VDD+ +F LKK Sbjct: 541 LSVLLVDDEKLFESLKK 557 >gnl|CDD|130988 TIGR01933, hflK, HflK protein. HflK and HflC are paralogs encoded by tandem genes in Proteobacteria, spirochetes, and some other bacterial lineages. The HflKC complex is anchored in the membrane and exposed to the periplasm. The complex is not active as a protease, but rather binds to and appears to modulate the ATP-dependent protease FtsH. The overall function of HflKC is not fully described.//Regulation of FtsH by HflKC appears to be negative (PubMed:8947034,PubMed:96367). Length = 261 Score = 27.0 bits (60), Expect = 8.1 Identities = 12/48 (25%), Positives = 25/48 (52%), Gaps = 6/48 (12%) Query: 94 LDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVE----DLYKAL 137 ++E V+ ++ + G++L D ++V+V + V+ D YK L Sbjct: 33 IEEVYPVNVTAVRN--LRKQGLMLTGDENIVNVEMNVQYRITDPYKYL 78 >gnl|CDD|161886 TIGR00456, argS, arginyl-tRNA synthetase. This model recognizes arginyl-tRNA synthetase in every completed genome to date. An interesting feature of the alignment of all arginyl-tRNA synthetases is a fairly deep split between two families. One family includes archaeal, eukaryotic and organellar, spirochete, E. coli, and Synechocystis sp. The second, sharing a deletion of about 25 residues in the central region relative to the first, includes Bacillus subtilis, Aquifex aeolicus, the Mycoplasmas and Mycobacteria, and the Gram-negative bacterium Helicobacter pylori. Length = 566 Score = 26.9 bits (60), Expect = 8.6 Identities = 12/62 (19%), Positives = 27/62 (43%), Gaps = 2/62 (3%) Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258 + R++F ++ + + + ++G ETLAR+ ++ D F + G S Sbjct: 211 EARELFV-KLESGDEEAIKLWKRLVEYSLEG-IKETLARLNIHFDSFVWEGESVKNGMVP 268 Query: 259 VL 260 + Sbjct: 269 KV 270 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.322 0.139 0.402 Gapped Lambda K H 0.267 0.0667 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 5,714,913 Number of extensions: 375893 Number of successful extensions: 692 Number of sequences better than 10.0: 1 Number of HSP's gapped: 689 Number of HSP's successfully gapped: 14 Length of query: 346 Length of database: 5,994,473 Length adjustment: 94 Effective length of query: 252 Effective length of database: 3,963,321 Effective search space: 998756892 Effective search space used: 998756892 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 58 (26.2 bits)