RPSBLAST alignment of GI: 254780707 and protein with PDBid: 1twy

>1twy_A ABC transporter, periplasmic substrate-binding protein; nysgxrc target, structural genomics, protein structure initiative; 1.65A {Vibrio cholerae o1 biovar eltor str} SCOP: c.94.1.1 Length = 290
 Score = 91.7 bits (226), Expect = 2e-19
 Identities = 57/332 (17%), Positives = 117/332 (35%), Gaps = 54/332 (16%)

Query: 1   MRFFFVVLMCFVVLEVYCGTGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVE 60
           +    +  +C ++  +   T     + I I+GS+++     ++AE +++  PE     V+
Sbjct: 3   LIRMALAAVCALLFSITTMTPFVQASEITISGSTSVARIMDVLAEKYNQQHPETYVA-VQ 61

Query: 61  SGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSD 120
             GS+ G+            DI  +SR +T+           + +   T+  DG+ +V +
Sbjct: 62  GVGSTAGISLLK----KGVADIAMTSRYLTE-------SEAQNTLHTFTLAFDGLAIVVN 110

Query: 121 RDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTRE 180
           +     +LT E LY            +    +  W ++  +    +IA+       GTR 
Sbjct: 111 QANPVTNLTREQLY-----------GIYKGQITNWKQVGGNDQ--KIAVVTREASSGTRY 157

Query: 181 VLEKKVLQEGCVRSRNFSKMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEV 240
             E  +     V+ R  S +                          V    +     +  
Sbjct: 158 SFESLMGLTKTVKDREVSDVAPTA---------------------LVVNSNSMMKTLVNH 196

Query: 241 NKDVFGFVGLSFYKNNADVLKLVPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG 300
           N    GF+ +     +   ++    +   P+   I    Y +SRP L      + +    
Sbjct: 197 NTQAVGFISIGSVDKSVKAIQ---FEKADPTSDNIAKHTYQLSRPFLILHYSDNADE--Q 251

Query: 301 LREYVSFSVSDEMMAPDSQLFQYGLIPISNEE 332
            +E+++F  S+        + +YG I  S+ E
Sbjct: 252 TKEFIAFLKSESAKK---LIVEYGYIMPSDVE 280