RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780707|ref|YP_003065120.1| putative phosphate-binding
periplasmic protein [Candidatus Liberibacter asiaticus str. psy62]
         (346 letters)



>d1pc3a_ c.94.1.1 (A:) Phosphate-binding protein {Mycobacterium
           tuberculosis [TaxId: 1773]}
          Length = 333

 Score =  108 bits (270), Expect = 6e-25
 Identities = 46/340 (13%), Positives = 100/340 (29%), Gaps = 32/340 (9%)

Query: 20  TGTFARNRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDT 79
           T   +   +   GS+ L+P   +    F E +P   T   +  GS  G+ +   G    T
Sbjct: 4   TPASSPVTLAETGSTLLYPLFNLWGPAFHERYPNV-TITAQGTGSGAGIAQAAAG----T 58

Query: 80  IDIVNSSRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALAS 139
           ++I  S   +++ ++   K      +  + +      +  +   VS  L +     A   
Sbjct: 59  VNIGASDAYLSEGDMAAHK-----GLMNIALAISAQQVNYNLPGVSEHLKLNGKVLAAMY 113

Query: 140 YLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSK 199
                 K   +P         + P   +     S   G   +  + + ++          
Sbjct: 114 Q--GTIKTWDDPQIAALNPGVNLPGTAVVPLHRSDGSGDTFLFTQYLSKQDPEGWGKSPG 171

Query: 200 MRDMFKYNVQQLSV-------ACTSVRQDGIAIEVDGDYTETLARIEVNKDV-FGFVGLS 251
                 +     ++         T   +    +   G      A      +   G    +
Sbjct: 172 FGTTVDFPAVPGALGENGNGGMVTGCAETPGCVAYIGISFLDQASQRGLGEAQLGNSSGN 231

Query: 252 FYKNNADVLKLV--------PIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG--L 301
           F   +A  ++          P +  +  +       YPI       V  +  ++     L
Sbjct: 232 FLLPDAQSIQAAAAGFASKTPANQAISMIDGPAPDGYPIINYEYAIVNNRQKDAATAQTL 291

Query: 302 REYVSFSVSDEMMAPDSQLFQYGLIPISNEERKSVRDSIA 341
           + ++ ++++D      S L Q    P+     K     IA
Sbjct: 292 QAFLHWAITDG--NKASFLDQVHFQPLPPAVVKLSDALIA 329


>d1ixha_ c.94.1.1 (A:) Phosphate-binding protein {Escherichia coli
           [TaxId: 562]}
          Length = 321

 Score = 98.0 bits (243), Expect = 1e-21
 Identities = 38/323 (11%), Positives = 86/323 (26%), Gaps = 26/323 (8%)

Query: 28  IRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSR 87
           +  AG++   P     A+ + +          +  GSS G+K+        T+D   S  
Sbjct: 4   LTGAGATFPAPVYAKWADTYQKETG--NKVNYQGIGSSGGVKQIIAN----TVDFGASDA 57

Query: 88  KITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKV 147
            ++    ++  + G+     V  G    + +       + L  + L       +    K 
Sbjct: 58  PLSD---EKLAQEGLFQFPTVIGGVVLAVNIPGLKSGELVLDGKTLGDIYLGKI----KK 110

Query: 148 VFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNF---SKMRDMF 204
             +            P   IA+   +   GT  V    + +       N    S ++   
Sbjct: 111 WDDEAIAKLNPGLKLPSQNIAVVRRADGSGTSFVFTSYLAKVNEEWKNNVGTGSTVKWPI 170

Query: 205 KYNVQQLSVACTSVRQDGIA---IEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLK 261
               +        V++   A   +E        LA  ++       V  +          
Sbjct: 171 GLGGKGNDGIAAFVQRLPGAIGYVEYAYAKQNNLAYTKLISADGKPVSPTEENFANAAKG 230

Query: 262 L-VPIDGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLG--LREYVSFSVSDEMMAPDS 318
                              +PI+      + +       G  + ++  ++          
Sbjct: 231 ADWSKTFAQDLTNQKGEDAWPITSTTFILIHKDQKKPEQGTEVLKFFDWAYKTG----AK 286

Query: 319 QLFQYGLIPISNEERKSVRDSIA 341
           Q        + +   + VR +  
Sbjct: 287 QANDLDYASLPDSVVEQVRAAWK 309


>d2v3qa1 c.94.1.1 (A:1-376) PstS-like phosphate-binding protein
           {Human (Homo sapiens) [TaxId: 9606]}
          Length = 376

 Score = 97.7 bits (242), Expect = 1e-21
 Identities = 42/380 (11%), Positives = 85/380 (22%), Gaps = 84/380 (22%)

Query: 30  IAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDD-------TIDI 82
           I G     P    +          F        GS  G   F     +         +  
Sbjct: 2   INGGGATLPQK--LYLTPDVLTAGFAP--YIGVGSGKGKIAFLENKYNQFGTDTTKNVHW 57

Query: 83  VNSSRKITQNELDECKKHGV---SDIQEVTIGHDGI-LLVSDRDMVSVSLTVEDLYKALA 138
             S  K+T  EL             + +V      + +        +V L+V++L     
Sbjct: 58  AGSDSKLTATELATYAADKEPGWGKLIQVPSVATSVAIPFRKAGANAVDLSVKELCG--- 114

Query: 139 SYLIVDDKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFS 198
              +   ++       WS I        I +   +   GT E+  + +  +         
Sbjct: 115 ---VFSGRI-----ADWSGITGAGRSGPIQVVYRAESSGTTELFTRFLNAKCT-TEPGTF 165

Query: 199 KMRDMFKYNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNAD 258
            +   F  +         +     +A          L    V +    ++   F      
Sbjct: 166 AVTTTFANSY----SLGLTPLAGAVAATGSDGVMAALNDTTVAEGRITYISPDFAAPTLA 221

Query: 259 VLKLVPIDGIVPSM---------------------------------------------- 272
            L        V                                                 
Sbjct: 222 GLDDATKVARVGKGVVNGVAVEGKSPAAANVSAAISVVPLPAAADRGNPDVWVPVFGATT 281

Query: 273 ----GTIVSGLYPISRPLLFYVKRQHFNS--VLGLREYVSFSVSDEMMAPDSQLFQYGLI 326
                      YPI         + + N+     +R++ +          D+ +     +
Sbjct: 282 GGGVVAYPDSGYPILGFTNLIFSQCYANATQTGQVRDFFTKHYGTSANN-DAAIEANAFV 340

Query: 327 PISNEERKSVRDSIAVGKSG 346
           P+ +  + +VR S     + 
Sbjct: 341 PLPSNWKAAVRASFLTASNA 360


>d1twya_ c.94.1.1 (A:) ABC transporter, periplasmic
           substrate-binding protein VCA0807 {Vibrio cholerae
           [TaxId: 666]}
          Length = 249

 Score = 95.4 bits (236), Expect = 6e-21
 Identities = 56/302 (18%), Positives = 109/302 (36%), Gaps = 54/302 (17%)

Query: 26  NRIRIAGSSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNS 85
           + I I+GS+++     ++AE +++  PE     V+  GS+ G+    +G      DI  +
Sbjct: 1   SEITISGSTSVARIMDVLAEKYNQQHPETY-VAVQGVGSTAGISLLKKG----VADIAMT 55

Query: 86  SRKITQNELDECKKHGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDD 145
           SR +T++E           +   T+  DG+ +V ++     +LT E LY      +    
Sbjct: 56  SRYLTESEAQNT-------LHTFTLAFDGLAIVVNQANPVTNLTREQLYGIYKGQITNWK 108

Query: 146 KVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMFK 205
           +V  N  K               +       GTR   E  +     V+ R  S +     
Sbjct: 109 QVGGNDQKIA-------------VVTREASSGTRYSFESLMGLTKTVKDREVSDVAPT-- 153

Query: 206 YNVQQLSVACTSVRQDGIAIEVDGDYTETLARIEVNKDVFGFVGLSFYKNNADVLKLVPI 265
                             A+ V+ + +     +  N    GF+ +     +   ++    
Sbjct: 154 ------------------ALVVNSN-SMMKTLVNHNTQAVGFISIGSVDKSVKAIQ---F 191

Query: 266 DGIVPSMGTIVSGLYPISRPLLFYVKRQHFNSVLGLREYVSFSVSDEMMAPDSQLFQYGL 325
           +   P+   I    Y +SRP L      + +     +E+++F  S+        + +YG 
Sbjct: 192 EKADPTSDNIAKHTYQLSRPFLILHYSDNADE--QTKEFIAFLKSESAKK---LIVEYGY 246

Query: 326 IP 327
           I 
Sbjct: 247 IM 248


>d1sbqa_ c.124.1.6 (A:) 5,10-methenyltetrahydrofolate synthetase
           homolog MPN348 {Mycoplasma pneumoniae [TaxId: 2104]}
          Length = 164

 Score = 29.4 bits (65), Expect = 0.50
 Identities = 23/141 (16%), Positives = 46/141 (32%), Gaps = 21/141 (14%)

Query: 145 DKVVFNPLKKWSEIRPDFPEVRIAIYVPSGKHGTREVLEKKVLQEGCVRSRNFSKMRDMF 204
           D+ +   L  +   +P      IA+Y P     T      + L+   +R+     + D  
Sbjct: 26  DQKINQKLVAFLTPKPCIK--TIALYEPIKNEVTFVDFFFEFLKINQIRAVYPKVISDTE 83

Query: 205 KYNVQQLSVACTSVRQDGIAIEVD-------------GDYTETLARIEVNKDVFGFVGLS 251
              + Q +      + D   I +              G Y   L ++   +     +G++
Sbjct: 84  IIFIDQETNTFEPNQIDCFLIPLVGFNKDNYRLGFGKGYYDRYLMQLTRQQPK---IGIA 140

Query: 252 FYKNNADVLKL---VPIDGIV 269
           +     D L     V +D I+
Sbjct: 141 YSFQKGDFLADPWDVQLDLII 161


>d1us5a_ c.94.1.1 (A:) Putative GluR0 ligand binding core {Thermus
          thermophilus [TaxId: 274]}
          Length = 298

 Score = 28.0 bits (61), Expect = 1.2
 Identities = 11/57 (19%), Positives = 21/57 (36%), Gaps = 3/57 (5%)

Query: 24 ARNRIRIAG---SSTLFPYSKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGD 77
          A+  I I     +   FP +  IA+  ++     +     +GGS   +     G  +
Sbjct: 1  AQEFITIGSGSTTGVYFPVATGIAKLVNDANVGIRANARSTGGSVANINAINAGEFE 57


>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus
          subtilis [TaxId: 1423]}
          Length = 234

 Score = 25.7 bits (55), Expect = 5.7
 Identities = 5/13 (38%), Positives = 7/13 (53%)

Query: 13 VLEVYCGTGTFAR 25
          VL++  G G  A 
Sbjct: 20 VLDIGAGAGHTAL 32


>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus
          halodurans [TaxId: 86665]}
          Length = 231

 Score = 25.4 bits (54), Expect = 6.6
 Identities = 6/13 (46%), Positives = 7/13 (53%)

Query: 13 VLEVYCGTGTFAR 25
          VL+V  G G  A 
Sbjct: 19 VLDVATGGGHVAN 31


>d1vdma1 c.61.1.1 (A:1-153) Pprobable purine
           phosphoribosyltransferase PH0095 {Pyrococcus horikoshii
           [TaxId: 53953]}
          Length = 153

 Score = 25.5 bits (55), Expect = 7.4
 Identities = 19/123 (15%), Positives = 46/123 (37%), Gaps = 6/123 (4%)

Query: 40  SKIIAENFSEYFPEFKTPFVESGGSSVGLKEFCRGIGDDTIDIVNSSRKITQNELDECKK 99
              +AE   EY P+       + G  +        +GD  + +++       +E  E   
Sbjct: 15  IFALAEKLREYKPDVIIGV--ARGGLIPAVRLSHILGDIPLKVIDVKFYKGIDERGEKPV 72

Query: 100 HGVSDIQEVTIGHDGILLVSDRDMVSVSLTVEDLYKALASYLIVDDKVVFNPLKKWSEIR 159
             +    ++      +++V D  +     T+E + + +      + K+    +K W+ + 
Sbjct: 73  ITIPIHGDLK--DKRVVIVDD--VSDTGKTLEVVIEEVKKLGAKEIKIACLAMKPWTSVV 128

Query: 160 PDF 162
           PD+
Sbjct: 129 PDY 131


>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase
          3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]}
          Length = 311

 Score = 24.9 bits (53), Expect = 9.9
 Identities = 8/14 (57%), Positives = 10/14 (71%)

Query: 12 VVLEVYCGTGTFAR 25
          VVL+V CGTG  + 
Sbjct: 38 VVLDVGCGTGILSM 51


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.322    0.139    0.402 

Gapped
Lambda     K      H
   0.267   0.0440    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 1,309,854
Number of extensions: 63143
Number of successful extensions: 193
Number of sequences better than 10.0: 1
Number of HSP's gapped: 181
Number of HSP's successfully gapped: 18
Length of query: 346
Length of database: 2,407,596
Length adjustment: 86
Effective length of query: 260
Effective length of database: 1,226,816
Effective search space: 318972160
Effective search space used: 318972160
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 53 (24.9 bits)