RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780708|ref|YP_003065121.1| intracellular septation protein A [Candidatus Liberibacter asiaticus str. psy62] (204 letters) >2waq_H DNA-directed RNA polymerase RPO5 subunit; multi-subunit, transcription; 3.35A {Sulfolobus shibatae} PDB: 2wb1_H 2pmz_H 3hkz_H (H:) Length = 84 Score = 25.4 bits (56), Expect = 5.8 Identities = 4/22 (18%), Positives = 7/22 (31%) Query: 183 LIFGIVQMNLINKHTILPEERK 204 L+ KH +L + Sbjct: 7 RKIDPRIHYLVPKHEVLSIDEA 28 >1eik_A RNA polymerase subunit RPB5; RPBH, OCSP, NESG, protein structure initiative, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus} (A:) Length = 77 Score = 25.4 bits (56), Expect = 6.1 Identities = 6/22 (27%), Positives = 11/22 (50%) Query: 183 LIFGIVQMNLINKHTILPEERK 204 + I++ L+ +H IL E Sbjct: 1 MKREILKHQLVPEHVILNESEA 22 >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A (A:1-132) Length = 132 Score = 25.2 bits (54), Expect = 6.6 Identities = 6/54 (11%), Positives = 12/54 (22%), Gaps = 7/54 (12%) Query: 118 YLSGKSFVRFFLSQV------ICLDSIGWRKLTLRWAFFFLFLSFCNEIVWRNF 165 L V+ V + + W + + W+ F Sbjct: 65 ELPATELVQA-CRLVCLRWKELVDGAPLWLLKCQQEGLVPEGSADEERDHWQQF 117 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.338 0.149 0.499 Gapped Lambda K H 0.267 0.0607 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 1,623,453 Number of extensions: 70618 Number of successful extensions: 250 Number of sequences better than 10.0: 1 Number of HSP's gapped: 249 Number of HSP's successfully gapped: 33 Length of query: 204 Length of database: 4,956,049 Length adjustment: 84 Effective length of query: 120 Effective length of database: 2,116,429 Effective search space: 253971480 Effective search space used: 253971480 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 52 (24.1 bits)