RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780708|ref|YP_003065121.1| intracellular septation protein A [Candidatus Liberibacter asiaticus str. psy62] (204 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 29.1 bits (65), Expect = 0.76 Identities = 16/81 (19%), Positives = 24/81 (29%), Gaps = 42/81 (51%) Query: 162 WRNF-----STETWIFFKAIGI-----FP-IFLIFGIVQ------------M-------- 190 W +F T +FF IG+ +P L I++ M Sbjct: 289 WESFFVSVRKAITVLFF--IGVRCYEAYPNTSLPPSILEDSLENNEGVPSPMLSISNLTQ 346 Query: 191 -------NLINKHTILPEERK 204 N N H LP ++ Sbjct: 347 EQVQDYVNKTNSH--LPAGKQ 365 Score = 28.0 bits (62), Expect = 1.5 Identities = 17/87 (19%), Positives = 30/87 (34%), Gaps = 36/87 (41%) Query: 10 IVCFLLEFSPGIAFWLCNFYGEKLFFYFPMLSNL----G---GIIFVSTLL--------F 54 + LL F+P GE + S L G G++ + + F Sbjct: 251 VTAKLLGFTP----------GE-------LRSYLKGATGHSQGLV-TAVAIAETDSWESF 292 Query: 55 M--VLTAVSLGMFWFFFREFRVIPVVS 79 V A+++ +F+ R + P S Sbjct: 293 FVSVRKAITV-LFFIGVRCYEAYPNTS 318 >2cmr_A GP41, transmembrane glycoprotein; immune system, immunoglobulin complex, neutralization, immunoglobulin, envelope protein, HIV; 2.0A {Human immunodeficiency virus 1} PDB: 1f23_A 3cp1_A 3cyo_A 2z2t_A Length = 226 Score = 26.3 bits (58), Expect = 4.9 Identities = 7/36 (19%), Positives = 13/36 (36%), Gaps = 2/36 (5%) Query: 155 SFCNEIVWRNFSTETWIFFKAIGIFPIFLIFGIVQM 190 + IV + + I A ++GI Q+ Sbjct: 90 QLLSGIVQQQNNLLRAIE--AQQHLLQLTVWGIKQL 123 >3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Length = 488 Score = 25.7 bits (56), Expect = 6.8 Identities = 6/21 (28%), Positives = 10/21 (47%) Query: 18 SPGIAFWLCNFYGEKLFFYFP 38 G + W +GEK+F+ Sbjct: 285 FGGTSVWYHVLWGEKIFYLIK 305 >2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, core fucose, SH3 domain; 2.61A {Homo sapiens} Length = 526 Score = 25.3 bits (55), Expect = 9.6 Identities = 9/45 (20%), Positives = 16/45 (35%), Gaps = 9/45 (20%) Query: 114 LFVGYLSGKSFVRFFLSQVICLDSIGWRKLTLRWAFFFLFLSFCN 158 + Y + ++ + L+S WR T W F +S Sbjct: 169 FMIAYGTQRTLI---------LESQNWRYATGGWETVFRPVSETC 204 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.338 0.149 0.499 Gapped Lambda K H 0.267 0.0526 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,834,542 Number of extensions: 81444 Number of successful extensions: 362 Number of sequences better than 10.0: 1 Number of HSP's gapped: 359 Number of HSP's successfully gapped: 49 Length of query: 204 Length of database: 5,693,230 Length adjustment: 88 Effective length of query: 116 Effective length of database: 3,559,758 Effective search space: 412931928 Effective search space used: 412931928 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.8 bits) S2: 54 (25.0 bits)