HHsearch alignment for GI: 254780709 and conserved domain: CHL00072

>CHL00072 chlL photochlorophyllide reductase subunit L.
Probab=98.25  E-value=0.00018  Score=51.66  Aligned_cols=182  Identities=19%  Similarity=0.202  Sum_probs=103.5

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-----------HHHHHHHHHHH--------------HHHCC
Q ss_conf             231135444442478999999985226742677434512-----------45688999997--------------53035
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR-----------SAAIDQLKIWA--------------DRTSA  167 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR-----------~aA~eQL~~~a--------------~~~~v  167 (321)
T Consensus         2 ~iaiyGKGGIGKSTtsaNlsaaLA~~GkkVl~IGcDpk~DsT~~L~g~~~~tvld~l~~~~~~~~~~~~edvi~~G~~gi   81 (271)
T CHL00072          2 KIAVYGKGGIGKSTTSCNISIALARRGKKVLQIGCDPKHDSTFTLTGFLIPTIIDTLQSKDYHYEDVWPEDVIYKGYGGV   81 (271)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHCCCCCCCHHHHHHHHCCCCCCCCHHHHHHCCCCCC
T ss_conf             69997898544858899999999987997999789973777740069988859999975378732164999985277884


Q ss_pred             CCCCCCCCCCC---------HHHHHHHHHHHHH-HCCCEEEEECCCCCC--CHHHHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             32122358661---------2454228999965-148759986543332--11577899998998763022234301123
Q gi|254780709|r  168 DFVCSEIGSDA---------AALAYEAFKQAQA-KKVDVLIIDTAGRLH--NNSILMAGIGKMIRVLKRLDPHAPHSVLQ  235 (321)
Q Consensus       168 ~~~~~~~~~dp---------~~v~~~a~~~a~~-~~~DvvliDTAGR~~--~~~~lm~EL~ki~~v~~~~~~~~p~~~~l  235 (321)
T Consensus        82 ~cv--EaGGPepGvGCaGrgi~~~i~lL~~l~~~~d~D~V~yDvlgDVVCGGFa~Pi~---------------~Ad~~~i  144 (271)
T CHL00072         82 DCV--EAGGPPAGAGCGGYVVGETVKLLKELNAFYEYDVILFDVLGDVVCGGFAAPLN---------------YADYCII  144 (271)
T ss_pred             EEE--ECCCCCCCCCCCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCC---------------CCCEEEE
T ss_conf             665--43899988777886519999999973762138889994477655654567500---------------0888999


Q ss_pred             ECCC--CCCHHHHHHH---HHHHHH--CCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEE-EE----------CCCCCCC
Q ss_conf             1023--3522577899---987643--589769996545787069999999997698899-97----------5898132
Q gi|254780709|r  236 VLDA--TTGQNALRQV---EMFHAV--AGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYF-LG----------VGEGIND  297 (321)
Q Consensus       236 Vlda--~~gq~~~~~a---~~F~~~--~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~f-ig----------~Ge~i~D  297 (321)
T Consensus       145 Vts~e~malyaANnI~~~i~~~a~~~~~rl~GiI~N~~~~~---~~v~~fa~~~g~~~i~~iPrd~~V~~ae~~~~TviE  221 (271)
T CHL00072        145 ITDNGFDALFAANRIAASVREKARTHPLRLAGLVGNRTSKR---DLIDKYVEACPMPVLEVLPLIEDIRVSRVKGKTLFE  221 (271)
T ss_pred             EECCCHHHHHHHHHHHHHHHHHHHCCCCCCCEEEECCCCCH---HHHHHHHHHCCCCEEEECCCCCHHHHHHHCCCCEEE
T ss_conf             95670889999999999999973046864443652268837---899999997399669856871166899974882042


Q ss_pred             CCCCCHH---------HHHHHHCCCC
Q ss_conf             5557789---------9999872865
Q gi|254780709|r  298 LEPFVAK---------DFSAVITGCL  314 (321)
Q Consensus       298 l~~f~~~---------~~~~~llG~g  314 (321)
T Consensus       222 ~~p~s~~~~~~~~~Yr~LA~~I~~n~  247 (271)
T CHL00072        222 MAESEPSLNYVCDFYLNIADQLLSQP  247 (271)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHHHCCC
T ss_conf             28998247899999999999997399