HHsearch alignment for GI: 254780709 and conserved domain: CHL00095

>CHL00095 clpC Clp protease ATP binding subunit.
Probab=97.42  E-value=0.0035  Score=42.67  Aligned_cols=128  Identities=17%  Similarity=0.166  Sum_probs=65.0

Q ss_pred             CCCCC-CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-CCCC-CCCCCHHHHH
Q ss_conf             36674-1231135444442478999999985226742677434512456889999975303532-1223-5866124542
Q gi|254780709|r  107 FSHRP-HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSE-IGSDAAALAY  183 (321)
Q Consensus       107 ~~~~p-~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-~~~~-~~~dp~~v~~  183 (321)
T Consensus       534 ~~~rPigsFlf~GPTGvGKTElAK~LA~~LFg~e~~--liR~DMS---Ey~E~hsvsrLIGaPPGYVGy~eGG~----LT  604 (823)
T CHL00095        534 NPNRPIASFIFCGPTGVGKTELTKALASYFFGSEEA--MIRLDMS---EYMEKHTVSKLIGSPPGYVGYNEGGQ----LT  604 (823)
T ss_pred             CCCCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCC--EEEECCC---CCCCCCCHHHHCCCCCCCCCCCCCCC----HH
T ss_conf             899974689987899887799999999997478202--5885351---01554207674589987667787882----01


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCH-HHHHHHHHHHHHHHHCCCC-CCCCEEEEECCCCCCHHHH
Q ss_conf             2899996514875998654333211-5778999989987630222-3430112310233522577
Q gi|254780709|r  184 EAFKQAQAKKVDVLIIDTAGRLHNN-SILMAGIGKMIRVLKRLDP-HAPHSVLQVLDATTGQNAL  246 (321)
Q Consensus       184 ~a~~~a~~~~~DvvliDTAGR~~~~-~~lm~EL~ki~~v~~~~~~-~~p~~~~lVlda~~gq~~~  246 (321)
T Consensus       605 eaV---rr~PysVvLfDEIEKAHpdV~nilLQvlDdG~LtD~~Gr~vdF~NtIIImTSNlGs~~i  666 (823)
T CHL00095        605 EAV---RKKPYTVVLFDEIEKAHPDIFNLLLQILDDGRLTDSKGRTIDFKNTLIIMTSNLGSKVI  666 (823)
T ss_pred             HHH---HCCCCEEEEECHHHHCCHHHHHHHHHHCCCCCCCCCCCCEEECEEEEEEECCCCCHHHH
T ss_conf             988---71998699862131138899998876516884348999988431039997165055888