HHsearch alignment for GI: 254780709 and conserved domain: COG0410

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism].
Probab=95.32  E-value=0.009  Score=39.75  Aligned_cols=45  Identities=20%  Similarity=0.364  Sum_probs=33.8

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH
Q ss_conf             741231135444442478999999985226742677434512456
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA  154 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA  154 (321)
T Consensus        28 ~Geiv~llG~NGaGKTTlLkti~Gl~~~~~G~I~~~G~dit~~p~   72 (237)
T COG0410          28 RGEIVALLGRNGAGKTTLLKTIMGLVRPRSGRIIFDGEDITGLPP   72 (237)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCEECCCCCH
T ss_conf             898899989998888999999858987887069989835677997