HHsearch alignment for GI: 254780709 and conserved domain: COG1131

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms].
Probab=95.62  E-value=0.0062  Score=40.89  Aligned_cols=40  Identities=23%  Similarity=0.398  Sum_probs=29.0

Q ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             1231135444442478999999985226742677434512
Q gi|254780709|r  112 HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR  151 (321)
Q Consensus       112 ~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR  151 (321)
T Consensus        32 ei~gllG~NGAGKTTllk~l~Gl~~p~~G~i~i~G~~~~~   71 (293)
T COG1131          32 EIFGLLGPNGAGKTTLLKILAGLLKPTSGEILVLGYDVVK   71 (293)
T ss_pred             EEEEEECCCCCCHHHHHHHHHCCCCCCCEEEEECCCCCCC
T ss_conf             5999989999989999999967977886499995862751