HHsearch alignment for GI: 254780709 and conserved domain: COG1192

>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning].
Probab=98.18  E-value=7.1e-06  Score=61.56  Aligned_cols=42  Identities=36%  Similarity=0.422  Sum_probs=32.8

Q ss_pred             CCEEECCCCC-CCCHHHHHHHHHHHHH-HCCCCEEEEECCCCCH
Q ss_conf             4123113544-4442478999999985-2267426774345124
Q gi|254780709|r  111 PHVILVVGVN-GVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRS  152 (321)
Q Consensus       111 p~vil~vG~n-G~GKTTT~aKLA~~~~-~~g~kV~lva~DtfR~  152 (321)
T Consensus         2 ~~iI~v~n~KGGvGKTT~a~nLa~~La~~~~~kVLliDlDpQ~s   45 (259)
T COG1192           2 MKIIAVANQKGGVGKTTTAVNLAAALAKRGGKKVLLIDLDPQGS   45 (259)
T ss_pred             CEEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEECCCCCC
T ss_conf             76999985788851999999999999983899789997899941