HHsearch alignment for GI: 254780709 and conserved domain: COG1341

>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only].
Probab=98.05  E-value=3.9e-05  Score=56.33  Aligned_cols=120  Identities=23%  Similarity=0.271  Sum_probs=74.8

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-----CCHHHH------------HHHHHHHHHHCCCCC
Q ss_conf             667412311354444424789999999852267426774345-----124568------------899999753035321
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT-----FRSAAI------------DQLKIWADRTSADFV  170 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt-----fR~aA~------------eQL~~~a~~~~v~~~  170 (321)
T Consensus        70 ~~~~~~vmvvG~vDSGKSTLt~~LaN~~l~rG~~v~iiDaDvGQ~ei~pPg~ISL~~~~s~~~~L~~l~~~~~~----Fv  145 (398)
T COG1341          70 AGKVGVVMVVGPVDSGKSTLTTYLANKLLARGRKVAIIDADVGQSEIGPPGFISLAFPESPVISLSELEPFTLY----FV  145 (398)
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEEECCCCCCCCHHHCCCCCEE----EE
T ss_conf             06873899989867678899999998876447418999689997666797467741256777777775865227----98


Q ss_pred             CC-CCCCCCHHH---HHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC
Q ss_conf             22-358661245---4228999965148759986543332115778999989987630222343011231023
Q gi|254780709|r  171 CS-EIGSDAAAL---AYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA  239 (321)
Q Consensus       171 ~~-~~~~dp~~v---~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda  239 (321)
T Consensus       146 G~isP~~~~~~~i~~v~rL~~~a~~~-~~~ilIdT~GWi~G-~~g~elk~~li~~ik------P~~Ii~l~~~  210 (398)
T COG1341         146 GSISPQGFPGRYIAGVARLVDLAKKE-ADFILIDTDGWIKG-WGGLELKRALIDAIK------PDLIIALERA  210 (398)
T ss_pred             ECCCCCCCHHHHHHHHHHHHHHHHCC-CCEEEECCCCCEEC-CHHHHHHHHHHHHCC------CCEEEEECCC
T ss_conf             51477777689999999999986516-87799969984307-427899999886509------7789993144