HHsearch alignment for GI: 254780709 and conserved domain: COG1484

>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair].
Probab=96.33  E-value=0.038  Score=35.35  Aligned_cols=81  Identities=28%  Similarity=0.409  Sum_probs=54.7

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHH
Q ss_conf             74123113544444247899999998522674267743451245688999997530353212235866124542289999
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQA  189 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a  189 (321)
T Consensus       104 ~~~nl~l~G~~G~GKthLa~Ai~~~l~~~g~sv~f~~~~e----l~~~Lk~~~~~----------~~~~~~-----l~~-  163 (254)
T COG1484         104 RGENLVLLGPPGVGKTHLAIAIGNELLKAGISVLFITAPD----LLSKLKAAFDE----------GRLEEK-----LLR-  163 (254)
T ss_pred             CCCCEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHH----HHHHHHHHHHC----------CCHHHH-----HHH-
T ss_conf             5882899899998799999999999998398499988599----99999998745----------526899-----998-


Q ss_pred             HHHCCCEEEEECCCCCCCHHH
Q ss_conf             651487599865433321157
Q gi|254780709|r  190 QAKKVDVLIIDTAGRLHNNSI  210 (321)
Q Consensus       190 ~~~~~DvvliDTAGR~~~~~~  210 (321)
T Consensus       164 ~l~~~dlLIiDDlG~~~~~~~  184 (254)
T COG1484         164 ELKKVDLLIIDDIGYEPFSQE  184 (254)
T ss_pred             HHHHCCEEEEECCCCCCCCCH
T ss_conf             875289899823677668815