HHsearch alignment for GI: 254780709 and conserved domain: COG2074

>COG2074 2-phosphoglycerate kinase [Carbohydrate transport and metabolism].
Probab=97.24  E-value=0.0021  Score=44.23  Aligned_cols=99  Identities=22%  Similarity=0.341  Sum_probs=64.1

Q ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHCCCC---CHHHHHHHHHHHHHHHCCCCCCCCC----CCCCCCCCEEECCCCCC
Q ss_conf             9999997388989999999999987512789---9899999999987852010012100----01366741231135444
Q gi|254780709|r   49 LEDLLIRSDIGVAVAQKIVEELLTKRYAKDV---SVQRVLYDVSELIHKMLMPLSKPFN----WDFSHRPHVILVVGVNG  121 (321)
Q Consensus        49 Lee~LL~ADVg~~va~~Iie~ik~~~~~~~i---~~~~i~~~l~~~L~~~L~~~~~~~~----~~~~~~p~vil~vG~nG  121 (321)
T Consensus        20 L~rSlta~g~~p~~Ay~iA~~i~e~L~~~~~~~v~~~eir~~~~~l~~k~~~e~a~rY~lwR~ir~~~~p~IILIGGasG   99 (299)
T COG2074          20 LARSLTAAGVDPDLAYSIAIEIQEELKKEGIRLVTKDEIREVYQKLLEKGDPEVAKRYLLWRRIRKMKRPLIILIGGASG   99 (299)
T ss_pred             HHHHHHHCCCCHHHHHHHHHHHHHHHHHCCCEEEEHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCEEEEECCCCC
T ss_conf             98888861468258999999999999757972761999999999998732879999999999986157875999617887


Q ss_pred             CCHHHHHHHHHHHHHHCCCCEEEEECCCCC
Q ss_conf             442478999999985226742677434512
Q gi|254780709|r  122 VGKTTVIGKLSKKMSDAGLKVMLAAGDTFR  151 (321)
Q Consensus       122 ~GKTTT~aKLA~~~~~~g~kV~lva~DtfR  151 (321)
T Consensus       100 VGkStIA~ElA~rLgI---~-~visTD~IR  125 (299)
T COG2074         100 VGKSTIAGELARRLGI---R-SVISTDSIR  125 (299)
T ss_pred             CCHHHHHHHHHHHCCC---C-EEECCHHHH
T ss_conf             7725799999997298---6-100424799