HHsearch alignment for GI: 254780709 and conserved domain: COG2894

>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning].
Probab=96.82  E-value=0.0012  Score=45.82  Aligned_cols=180  Identities=19%  Similarity=0.229  Sum_probs=91.3

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC---C-------------------
Q ss_conf             231135444442478999999985226742677434512456889999975303532---1-------------------
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF---V-------------------  170 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~---~-------------------  170 (321)
T Consensus         5 IVvTSGKGGVGKTTttAnig~aLA~~GkKv~liD~Di-------GLRNLDlimGlE~RiVYd~vdVi~g~~~l~QALIkD   77 (272)
T COG2894           5 IVVTSGKGGVGKTTTTANIGTALAQLGKKVVLIDFDI-------GLRNLDLIMGLENRIVYDLVDVIEGEATLNQALIKD   77 (272)
T ss_pred             EEEECCCCCCCCCCHHHHHHHHHHHCCCEEEEEECCC-------CCHHHHHHHCCCCEEEEEEHHHHCCCCCHHHHHHCC
T ss_conf             9994488876743106778999997398599996676-------720446664342015654013444766365676403


Q ss_pred             ---------CCCCCCCCHHHH----HHHHHHHHHHCCCEEEEECC-CCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEE
Q ss_conf             ---------223586612454----22899996514875998654-3332115778999989987630222343011231
Q gi|254780709|r  171 ---------CSEIGSDAAALA----YEAFKQAQAKKVDVLIIDTA-GRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQV  236 (321)
Q Consensus       171 ---------~~~~~~dp~~v~----~~a~~~a~~~~~DvvliDTA-GR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lV  236 (321)
T Consensus        78 Kr~~nL~lLPAsQtrdKdalt~E~v~~vv~eL~~~~fDyIi~DsPAGIE~G~~~A~~---------------~Ad~AiVV  142 (272)
T COG2894          78 KRLENLFLLPASQTRDKDALTPEGVKKVVNELKAMDFDYIIIDSPAGIEQGFKNAVY---------------FADEAIVV  142 (272)
T ss_pred             CCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHH---------------CCCEEEEE
T ss_conf             567852661443236722279999999999997669988996484067788886541---------------02637997


Q ss_pred             CCCCC--CHHHHHH-----HHHHHHHCC---CCEEEEECCCC-CCCHHHHHHH---HHHHCCCEEEE-----------EC
Q ss_conf             02335--2257789-----998764358---97699965457-8706999999---99976988999-----------75
Q gi|254780709|r  237 LDATT--GQNALRQ-----VEMFHAVAG---TTGLIMTKMDG-TARGGGLIPI---VVTHKIPVYFL-----------GV  291 (321)
Q Consensus       237 lda~~--gq~~~~~-----a~~F~~~~~---~~g~I~TKlD~-ta~~G~~ls~---~~~~~~Pi~fi-----------g~  291 (321)
T Consensus       143 tnPEvSsVRDsDRiiGlLesk~~rae~~~~~~~~llvnR~~p~~v~~GeMlsv~Dv~~iL~i~liGiiPed~~Vi~asN~  222 (272)
T COG2894         143 TNPEVSSVRDSDRIIGLLESKSRRAEIGEEPKEHLLLNRYRPEMVKRGEMLSVEDVLEILSIPLIGVIPEDQDVLRASNK  222 (272)
T ss_pred             CCCCCCCCCCCHHHEEEHHCCCCHHHCCCCCCCEEEEECCCHHHHCCCCCCCHHHHHHHHCCCEEEEECCCHHHEEECCC
T ss_conf             48875542341122020121454233077666348997168888115772539999997477447760485333000478


Q ss_pred             CCCCCCCCCC----CHHHHHHHHCCCC
Q ss_conf             8981325557----7899999872865
Q gi|254780709|r  292 GEGINDLEPF----VAKDFSAVITGCL  314 (321)
Q Consensus       292 Ge~i~Dl~~f----~~~~~~~~llG~g  314 (321)
T Consensus       223 GePv~l~~~~~a~~Ay~d~arRllGe~  249 (272)
T COG2894         223 GEPVILDDNSDAGKAYRDIARRLLGEE  249 (272)
T ss_pred             CCCEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             887675787517799999999970888