HHsearch alignment for GI: 254780709 and conserved domain: COG3523

>COG3523 IcmF Type VI protein secretion system component VasK [Intracellular trafficking, secretion, and vesicular transport].
Probab=97.53  E-value=0.00061  Score=47.99  Aligned_cols=123  Identities=28%  Similarity=0.345  Sum_probs=66.3

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHC
Q ss_conf             31135444442478999999985226742677434512456889999975303532122358661245422899996514
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKK  193 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~  193 (321)
T Consensus       128 y~viG~pgsGKTtal~-------~sgl~--------Fpl~--~~~~~~~~~~~g-----T~~cdww---f------~---  173 (1188)
T COG3523         128 YMVIGPPGSGKTTALL-------NSGLQ--------FPLA--EQMGALGLAGPG-----TRNCDWW---F------T---  173 (1188)
T ss_pred             EEEECCCCCCCCHHHH-------CCCCC--------CCCH--HHHCCCCCCCCC-----CCCCCCC---C------C---
T ss_conf             5885488898400875-------15536--------6615--553312226888-----7335754---2------5---


Q ss_pred             CCEEEEECCCCCCCHH----HHHHHHHHHHHHHHCCCCCCCCE-EEEECCC---CCCHHHHH--------H-----HHHH
Q ss_conf             8759986543332115----77899998998763022234301-1231023---35225778--------9-----9987
Q gi|254780709|r  194 VDVLIIDTAGRLHNNS----ILMAGIGKMIRVLKRLDPHAPHS-VLQVLDA---TTGQNALR--------Q-----VEMF  252 (321)
Q Consensus       194 ~DvvliDTAGR~~~~~----~lm~EL~ki~~v~~~~~~~~p~~-~~lVlda---~~gq~~~~--------~-----a~~F  252 (321)
T Consensus       174 deaVlIDtaGry~~q~s~~~~~~~~W~~fL~lLkk~R~~~piNGiiltlsv~~L~~~~~~~~~~~~~~LR~RL~El~~tL  253 (1188)
T COG3523         174 DEAVLIDTAGRYITQDSADEVDRAEWLGFLGLLKKYRRRRPLNGIILTLSVSDLLTADPAEREALARTLRARLQELRETL  253 (1188)
T ss_pred             CCEEEECCCCCEECCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEEEEEEEHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             53489858752443667502348889998889997355788863799978999738999999999999999999999841


Q ss_pred             HHHCCCCEEEEECCCCCCC
Q ss_conf             6435897699965457870
Q gi|254780709|r  253 HAVAGTTGLIMTKMDGTAR  271 (321)
Q Consensus       253 ~~~~~~~g~I~TKlD~ta~  271 (321)
T Consensus       254 ~~~~PV-Yl~lTk~Dll~G  271 (1188)
T COG3523         254 HARLPV-YLVLTKADLLPG  271 (1188)
T ss_pred             CCCCCE-EEEEECCCCCCC
T ss_conf             567763-899862100215