HHsearch alignment for GI: 254780709 and conserved domain: COG3598

>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair].
Probab=96.43  E-value=0.026  Score=36.54  Aligned_cols=90  Identities=21%  Similarity=0.251  Sum_probs=58.6

Q ss_pred             EEECC-CCCCCCHHHHHHHHH-------HHHH---HCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC-------CCCC
Q ss_conf             23113-544444247899999-------9985---2267426774345124568899999753035321-------2235
Q gi|254780709|r  113 VILVV-GVNGVGKTTVIGKLS-------KKMS---DAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV-------CSEI  174 (321)
Q Consensus       113 vil~v-G~nG~GKTTT~aKLA-------~~~~---~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~-------~~~~  174 (321)
T Consensus        90 ~~~~~~gdsg~GKttllL~l~IalaaG~~lfG~~v~epGkvlyvslEl~re~~L~Rl~~v~a~mgLsPadvrn~dltd~~  169 (402)
T COG3598          90 YVSILYGDSGVGKTTLLLYLCIALAAGKNLFGNKVKEPGKVLYVSLELYREDILERLEPVRARMGLSPADVRNMDLTDVS  169 (402)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCEEEEEEECCCHHHHHHHHHHHHHHCCCCHHHHHHEECCCCC
T ss_conf             05898448862376899999999986477745335588807999822686889999999998709985763220000245


Q ss_pred             CCCC----HHH--HHHHHHHHHHHCCCEEEEECC
Q ss_conf             8661----245--422899996514875998654
Q gi|254780709|r  175 GSDA----AAL--AYEAFKQAQAKKVDVLIIDTA  202 (321)
Q Consensus       175 ~~dp----~~v--~~~a~~~a~~~~~DvvliDTA  202 (321)
T Consensus       170 Gaa~~~d~l~pkl~rRfek~~~Q~rp~~vViDp~  203 (402)
T COG3598         170 GAADESDVLSPKLYRRFEKILEQKRPDFVVIDPF  203 (402)
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHHCCCEEEECCH
T ss_conf             6787200105899999999998747874997344