HHsearch alignment for GI: 254780709 and conserved domain: KOG0781

>KOG0781 consensus.
Probab=100.00  E-value=0  Score=450.55  Aligned_cols=284  Identities=31%  Similarity=0.479  Sum_probs=258.4

Q ss_pred             HHHHHHHHHHHHHHHCCCCCCHH----HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCC-----HHHHHHHHHHHH
Q ss_conf             99999999999986056778999----999999999973889899999999999875127899-----899999999987
Q gi|254780709|r   22 ASTSLKLKEGITDIISSRRLDDG----VREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVS-----VQRVLYDVSELI   92 (321)
Q Consensus        22 ~kt~~~L~~~l~~l~~~~~lde~----~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~-----~~~i~~~l~~~L   92 (321)
T Consensus       274 ~k~~g~aFg~fkglvG~K~L~eeDL~pvL~km~ehLitKNVA~eiA~~LcesV~a~Legkkv~sfs~V~~Tvk~Al~daL  353 (587)
T KOG0781         274 KKTVGGAFGLFKGLVGSKSLSEEDLNPVLDKMTEHLITKNVAAEIAEKLCESVAASLEGKKVGSFSTVESTVKEALRDAL  353 (587)
T ss_pred             HCCHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
T ss_conf             42024589988863155644475669999999999876201289999999999998510210450277899999999999


Q ss_pred             HHHCCCCCCC-----C-CCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH-
Q ss_conf             8520100121-----0-00136674123113544444247899999998522674267743451245688999997530-
Q gi|254780709|r   93 HKMLMPLSKP-----F-NWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRT-  165 (321)
Q Consensus        93 ~~~L~~~~~~-----~-~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~-  165 (321)
T Consensus       354 vQILTP~~sVDlLrdI~~ar~~krPYvi~fvGVNGVGKSTNLAKIayWLlqNkfrVlIAACDTFRsGAvEQLrtHv~rl~  433 (587)
T KOG0781         354 VQILTPQRSVDLLRDIMSARRRKRPYVISFVGVNGVGKSTNLAKIAYWLLQNKFRVLIAACDTFRSGAVEQLRTHVERLS  433 (587)
T ss_pred             HHHCCCCCHHHHHHHHHHHHHCCCCEEEEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHHH
T ss_conf             98738873066999999987468975999982147665132999999998578369998624312447899999999998


Q ss_pred             -----CCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             -----353212235866124542289999651487599865433321157789999899876302223430112310233
Q gi|254780709|r  166 -----SADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT  240 (321)
Q Consensus       166 -----~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~  240 (321)
T Consensus       434 ~l~~~~v~lfekGYgkd~a~vak~AI~~a~~~gfDvvLiDTAGRmhn~~~LM~~L~kl~~~n~------pD~i~~VgEAL  507 (587)
T KOG0781         434 ALHGTMVELFEKGYGKDAAGVAKEAIQEARNQGFDVVLIDTAGRMHNNAPLMTSLAKLIKVNK------PDLILFVGEAL  507 (587)
T ss_pred             HHCCCHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHHHCCC------CCEEEEEHHHH
T ss_conf             745520488861047782899999999998669878998354433478067899999974479------86599850555


Q ss_pred             CCHHHHHHHHHHHHHC-------CCCEEEEECCCC-CCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHC
Q ss_conf             5225778999876435-------897699965457-8706999999999769889997589813255577899999872
Q gi|254780709|r  241 TGQNALRQVEMFHAVA-------GTTGLIMTKMDG-TARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVIT  311 (321)
Q Consensus       241 ~gq~~~~~a~~F~~~~-------~~~g~I~TKlD~-ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~ll  311 (321)
T Consensus       508 VG~dsvdq~~~Fn~al~d~~~~r~iDgilltK~DTvdd~vG~~v~Mvy~t~~PIlFvG~GQtysDLr~l~vk~vV~tLm  586 (587)
T KOG0781         508 VGNDSVDQLKKFNRALADHSTPRLIDGILLTKFDTVDDKVGAAVSMVYITGKPILFVGVGQTYSDLRKLNVKAVVATLM  586 (587)
T ss_pred             HCCHHHHHHHHHHHHHHCCCCCCCCCEEEEEECCHHHHHHHHHHHHHEECCCCEEEEECCCCCHHHHHCCHHHHHHHHH
T ss_conf             2755899999999987448974423437887125065688878764200389769984586610376525899999863