HHsearch alignment for GI: 254780709 and conserved domain: KOG1805

>KOG1805 consensus.
Probab=97.97  E-value=3.7e-05  Score=56.53  Aligned_cols=52  Identities=33%  Similarity=0.470  Sum_probs=37.3

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             3113544444247899999998522674267743451245688999997530353
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSAD  168 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~  168 (321)
T Consensus       688 ~LI~GMPGTGKTTtI~~LIkiL~~~gkkVLLts---yThsAVDNILiKL~~~~i~  739 (1100)
T KOG1805         688 ALILGMPGTGKTTTISLLIKILVALGKKVLLTS---YTHSAVDNILIKLKGFGIY  739 (1100)
T ss_pred             HEEECCCCCCCHHHHHHHHHHHHHCCCEEEEEE---HHHHHHHHHHHHHHCCCCC
T ss_conf             203269989812259999999997388189985---0567889999987506711