HHsearch alignment for GI: 254780709 and conserved domain: PRK00090

>PRK00090 bioD dithiobiotin synthetase; Reviewed.
Probab=98.24  E-value=0.00016  Score=52.10  Aligned_cols=174  Identities=20%  Similarity=0.298  Sum_probs=93.0

Q ss_pred             EEECCCC-CCCCHHHHHHHHHHHHHHCCCCEEEEE-----C-CCCCHHHHHHHHHHHHHHC-----CCC-CCCC------
Q ss_conf             2311354-444424789999999852267426774-----3-4512456889999975303-----532-1223------
Q gi|254780709|r  113 VILVVGV-NGVGKTTVIGKLSKKMSDAGLKVMLAA-----G-DTFRSAAIDQLKIWADRTS-----ADF-VCSE------  173 (321)
Q Consensus       113 vil~vG~-nG~GKTTT~aKLA~~~~~~g~kV~lva-----~-DtfR~aA~eQL~~~a~~~~-----v~~-~~~~------  173 (321)
T Consensus         1 ~ifI~GT~T~vGKT~vt~~L~~~l~~~G~~v~~~KPv~tG~~~~~~~~Da~~~~~~~~~~~~~~~~~p~~~~~p~sP~~a   80 (223)
T PRK00090          1 VLFVTGTDTGVGKTVVTAALAQALREQGYRVAGYKPVQSGCDGGLRNGDALALQRLSGLPLDYELVNPYRFEEPLSPHLA   80 (223)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECEEEECCCCCCCCHHHHHHHHHHCCCCCHHHHCCCCCCCCCCHHHH
T ss_conf             98998689997699999999999997899489975120489889972799999998089998676054025889898999


Q ss_pred             ---CCC--CCHHHHHHHHHHHHHHCCCEEEEECCCC--CCCHH-HHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCH--
Q ss_conf             ---586--6124542289999651487599865433--32115-7789999899876302223430112310233522--
Q gi|254780709|r  174 ---IGS--DAAALAYEAFKQAQAKKVDVLIIDTAGR--LHNNS-ILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQ--  243 (321)
Q Consensus       174 ---~~~--dp~~v~~~a~~~a~~~~~DvvliDTAGR--~~~~~-~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq--  243 (321)
T Consensus        81 a~~~g~~i~~~~-i~~~~~~l-~~~~d~vlvEGaGGl~~Pl~~~~~~~Dla---~~l-------~~pvILV~~~~lG~in  148 (223)
T PRK00090         81 ARLEGVTIDLEK-ISAALREL-AQQADLVLVEGAGGLLVPLTDDLTLADLA---AQL-------QLPVILVVGVKLGCIN  148 (223)
T ss_pred             HHHHCCCCCHHH-HHHHHHHH-HHHCCEEEEECCCCCCCCCCCCCCHHHHH---HHH-------CCCEEEEECCCCCHHH
T ss_conf             999098468999-99999999-83189899946886556756787889999---996-------8898999769888099


Q ss_pred             HHHHHHHHH-HHHCCCCEEEEECCCCCCC--HHHHHHHHHHHCCCEEEEECCCCCCCCCC
Q ss_conf             577899987-6435897699965457870--69999999997698899975898132555
Q gi|254780709|r  244 NALRQVEMF-HAVAGTTGLIMTKMDGTAR--GGGLIPIVVTHKIPVYFLGVGEGINDLEP  300 (321)
Q Consensus       244 ~~~~~a~~F-~~~~~~~g~I~TKlD~ta~--~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~  300 (321)
T Consensus       149 htllt~eal~~~gl~v~GvI~N~~~~~~~~~~~~~~~l~~~~gvP--vLG~iP~~~~~~~  206 (223)
T PRK00090        149 HTLLTLEAIRARGLPLAGWVANGVPPEGLRHAENLATLAELLPAP--LLGRLPYLAELSP  206 (223)
T ss_pred             HHHHHHHHHHHCCCCEEEEEEECCCCCHHHHHHHHHHHHHHCCCC--EEEECCCCCCCCH
T ss_conf             999989999968994899999685883667776899999854998--8997589999895