HHsearch alignment for GI: 254780709 and conserved domain: PRK00454

>PRK00454 engB GTPase EngB; Reviewed.
Probab=97.21  E-value=0.025  Score=36.70  Aligned_cols=152  Identities=16%  Similarity=0.234  Sum_probs=78.5

Q ss_pred             CCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCC-CEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHH
Q ss_conf             013667412311354444424789999999852267-4267743451245688999997530353212235866124542
Q gi|254780709|r  105 WDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGL-KVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAY  183 (321)
Q Consensus       105 ~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~-kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~  183 (321)
T Consensus        19 ~p~~~~p~-VaivGrpNvGKSTL~N~L~------g~k~~a~vs-~~--pgtT-r--------~i~~~~------------   67 (196)
T PRK00454         19 LPPDDGPE-IAFAGRSNVGKSSLINALT------NRKNLARTS-KT--PGRT-Q--------LINFFE------------   67 (196)
T ss_pred             CCCCCCCE-EEEECCCCCCHHHHHHHHH------CCCCEEEEE-CC--CCCE-E--------EEEEEE------------
T ss_conf             99988968-9998489888999999986------897369974-78--8860-7--------988876------------


Q ss_pred             HHHHHHHHHCCCEEEEECCC-----CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHH-----HHHHHHHHH
Q ss_conf             28999965148759986543-----33211577899998998763022234301123102335225-----778999876
Q gi|254780709|r  184 EAFKQAQAKKVDVLIIDTAG-----RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQN-----ALRQVEMFH  253 (321)
Q Consensus       184 ~a~~~a~~~~~DvvliDTAG-----R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~-----~~~~a~~F~  253 (321)
T Consensus        68 --------~~~~~~lvDtpGyG~a~~~~~~~~~~~~~--i~~yl~~~--~~l~~villIDa~~g~~~~D~~i~~~l~~~~  135 (196)
T PRK00454         68 --------VNDGLRLVDLPGYGYAKVSKEEKEKWQKL--IEEYLQKR--ENLKGVVLLIDSRHPLKELDLEMIEWLKEAG  135 (196)
T ss_pred             --------CCCCEEEEECCCCCCCCCCHHHHHHHHHH--HHHHHHHH--HCCCEEEEEEECCCCCCHHHHHHHHHHHHCC
T ss_conf             --------18833899379974132778788899999--99999962--3336389999716589888999999998627


Q ss_pred             HHCCCCEEEEECCCCCCCHHH---HHHHHHHH-----CCCEEEEEC--CCCCCCCCCCC
Q ss_conf             435897699965457870699---99999997-----698899975--89813255577
Q gi|254780709|r  254 AVAGTTGLIMTKMDGTARGGG---LIPIVVTH-----KIPVYFLGV--GEGINDLEPFV  302 (321)
Q Consensus       254 ~~~~~~g~I~TKlD~ta~~G~---~ls~~~~~-----~~Pi~fig~--Ge~i~Dl~~f~  302 (321)
T Consensus       136 --~p-~iivlNKiD~l~~~~~~~~~~~i~~~l~~~~~~~~ii~ISA~~g~GI~eL~~~I  191 (196)
T PRK00454        136 --IP-VLIVLTKADKLKKGERKKLLKKVKKALARFAADPEVLLFSSLKKTGIDELRAAI  191 (196)
T ss_pred             --CC-CEEEEECCHHCCHHHHHHHHHHHHHHHHHCCCCCCEEEEECCCCCCHHHHHHHH
T ss_conf             --78-599998725169789999999999997612589828999699997989999999