HHsearch alignment for GI: 254780709 and conserved domain: PRK00698

>PRK00698 tmk thymidylate kinase; Validated.
Probab=96.72  E-value=0.0054  Score=41.30  Aligned_cols=47  Identities=28%  Similarity=0.515  Sum_probs=35.5

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEE--CCCCCHHHHHHHHHHH
Q ss_conf             2311354444424789999999852267426774--3451245688999997
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAA--GDTFRSAAIDQLKIWA  162 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva--~DtfR~aA~eQL~~~a  162 (321)
T Consensus         5 fIviEGiDGsGKsTq~~~L~~~L~~~g~~v~~t~eP~~t---~~g~~ir~~~   53 (204)
T PRK00698          5 FITIEGIDGAGKSTQIELLAERLEEQGRDVVFTREPGGT---PLGEKLRELL   53 (204)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC---CHHHHHHHHH
T ss_conf             999988999989999999999999679978998699998---0699999998