HHsearch alignment for GI: 254780709 and conserved domain: PRK00784

>PRK00784 cobyric acid synthase; Provisional.
Probab=97.66  E-value=0.0024  Score=43.83  Aligned_cols=179  Identities=21%  Similarity=0.238  Sum_probs=111.9

Q ss_pred             EEECCCCC-CCCHHHHHHHHHHHHHHCCCCEE-----------EEECCCCCHHHHHHHHHHHHHHCCCCCCCC----CCC
Q ss_conf             23113544-44424789999999852267426-----------774345124568899999753035321223----586
Q gi|254780709|r  113 VILVVGVN-GVGKTTVIGKLSKKMSDAGLKVM-----------LAAGDTFRSAAIDQLKIWADRTSADFVCSE----IGS  176 (321)
Q Consensus       113 vil~vG~n-G~GKTTT~aKLA~~~~~~g~kV~-----------lva~DtfR~aA~eQL~~~a~~~~v~~~~~~----~~~  176 (321)
T Consensus         5 ~lMv~GT~S~vGKS~l~aaLCRi~~~~G~~VaPFKaQNMslNs~vt~dG~EigrAQ~~QA~Aag~~p~v~MNPILLKP~g   84 (492)
T PRK00784          5 ALMVQGTTSDAGKSTLVAGLCRILARRGLRVAPFKAQNMSLNSAVTADGGEIGRAQALQAEAAGVEPSVDMNPVLLKPQS   84 (492)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHCCCCCEECCCCCEEHHHHHHHHHHCCCCCCCCCCCEEECCCC
T ss_conf             05888678887799999999999995898557857022466517889998336999999998699997676887763189


Q ss_pred             --------------------------CCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCC
Q ss_conf             --------------------------612454228999965148759986543332115778999989987630222343
Q gi|254780709|r  177 --------------------------DAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAP  230 (321)
Q Consensus       177 --------------------------dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p  230 (321)
T Consensus        85 d~~SQVIv~Gk~~g~~~a~~Y~~~~~~~~~~v~~a~~~L-~~~~d~iV~EGAG-SpaEiNL~~~--Di~Nm~~A~~~--~  158 (492)
T PRK00784         85 DTGSQVIVQGKVVGNMDARDYHDYKPRLLEAVLESLDRL-AAEYDLVVVEGAG-SPAEINLRDR--DIANMGFAEAA--D  158 (492)
T ss_pred             CCCCEEEECCEECCCCCHHHHHHHHHHHHHHHHHHHHHH-HHHCCEEEEECCC-CCCCCCCCHH--HHHHHHHHHHC--C
T ss_conf             988679999978753139999986999999999999998-8658899993589-8200265220--02428999865--9


Q ss_pred             CEEEEECCCCCCHHHHHHHHHHH-----HHCCCCEEEEECCCCCCCH--HHHHHHHHHHCCCEEEEECCCCCCCCC
Q ss_conf             01123102335225778999876-----4358976999654578706--999999999769889997589813255
Q gi|254780709|r  231 HSVLQVLDATTGQNALRQVEMFH-----AVAGTTGLIMTKMDGTARG--GGLIPIVVTHKIPVYFLGVGEGINDLE  299 (321)
Q Consensus       231 ~~~~lVlda~~gq~~~~~a~~F~-----~~~~~~g~I~TKlD~ta~~--G~~ls~~~~~~~Pi~fig~Ge~i~Dl~  299 (321)
T Consensus       159 apviLV~DIdRGGvfAsl~GT~~lL~~~eR~li~G~IiNKFRGD~~ll~pG~~~le~~tg~P--vlGviP~~~~l~  232 (492)
T PRK00784        159 APVILVADIDRGGVFASLVGTLALLSPEERARVKGFVINKFRGDISLLEPGLDWLEELTGIP--VLGVLPYLDDLR  232 (492)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHCCHHHHHHEEEEEEEEECCCHHHHCCHHHHHHHHHCCC--CEEEECCCCCCC
T ss_conf             98899997567642687763887599988711589999764587466355999999986898--068614656799