HHsearch alignment for GI: 254780709 and conserved domain: PRK01172

>PRK01172 ski2-like helicase; Provisional.
Probab=95.91  E-value=0.11  Score=32.01  Aligned_cols=123  Identities=18%  Similarity=0.212  Sum_probs=72.2

Q ss_pred             EECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEEECCCCCHHHHHHHHHHHH--HHCCCC--CCCCCCCCCH-----HHHH
Q ss_conf             31135444442478999999985-226742677434512456889999975--303532--1223586612-----4542
Q gi|254780709|r  114 ILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGDTFRSAAIDQLKIWAD--RTSADF--VCSEIGSDAA-----ALAY  183 (321)
Q Consensus       114 il~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lva~DtfR~aA~eQL~~~a~--~~~v~~--~~~~~~~dp~-----~v~~  183 (321)
T Consensus        40 llvsaPTgsGKT-lvAe~ai~~~l~~~~k~iyi~--P~kAL~~EK~~~~~~~~~~g~~v~~~tGd~~~~~~~~~~~~I~V  116 (674)
T PRK01172         40 VIVSVPTAAGKT-LIAYSAIYETFLAGLKSIYIV--PLRSLAMEKYEELSRLRSLGMRVKISIGDYDDPPDFIKRYDVVI  116 (674)
T ss_pred             EEEECCCCCCHH-HHHHHHHHHHHHHCCCEEEEC--CHHHHHHHHHHHHHHHHCCCCEEEEEECCCCCCCCCCCCCCEEE
T ss_conf             999789998699-999999999998589799987--78999999999999887379827788538889801025589999


Q ss_pred             HHHHHHH---------HHCCCEEEEECCC------CCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHH
Q ss_conf             2899996---------5148759986543------332115778999989987630222343011231023352257789
Q gi|254780709|r  184 EAFKQAQ---------AKKVDVLIIDTAG------RLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQ  248 (321)
Q Consensus       184 ~a~~~a~---------~~~~DvvliDTAG------R~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~  248 (321)
T Consensus       117 ~T~Ek~~sl~~~~~~~l~~v~~vViDEiH~i~d~~RG~~lE~~l~---kl~~-l------~~~~qiIgLSATi~-N~~~l  185 (674)
T PRK01172        117 LTSEKADSLIHHDPYIINDVGLIVADEIHIIGDEDRGPTLETVLS---SARY-V------NPDARILALSATVS-NANEL  185 (674)
T ss_pred             ECHHHHHHHHHCCCHHHCCCCEEEEECCEECCCCCCHHHHHHHHH---HHHH-C------CCCEEEEEECCCCC-CHHHH
T ss_conf             878999999864950221369899826525068772499999999---9985-3------86607997157868-99999


Q ss_pred             HH
Q ss_conf             99
Q gi|254780709|r  249 VE  250 (321)
Q Consensus       249 a~  250 (321)
T Consensus       186 a~  187 (674)
T PRK01172        186 AQ  187 (674)
T ss_pred             HH
T ss_conf             98