HHsearch alignment for GI: 254780709 and conserved domain: PRK03992

>PRK03992 proteasome-activating nucleotidase; Provisional.
Probab=96.02  E-value=0.067  Score=33.67  Aligned_cols=136  Identities=21%  Similarity=0.342  Sum_probs=64.2

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCCCCC--CCCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHH
Q ss_conf             9999999998785201001210001--36674123113544444247899999998522674267743451245688999
Q gi|254780709|r   82 QRVLYDVSELIHKMLMPLSKPFNWD--FSHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLK  159 (321)
Q Consensus        82 ~~i~~~l~~~L~~~L~~~~~~~~~~--~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~  159 (321)
T Consensus       138 ~~~k~el~E~vel---Pl~~pe~f~~~Gi~pPkGvLLyGPPGtGKTllAkAvA~e~---~~~fi~v-------~~s~l~s  204 (390)
T PRK03992        138 DEQIREVREAVEL---PLKNPELFEEVGIEPPKGVLLYGPPGTGKTLLAKAVAHET---NATFIRV-------VGSELVQ  204 (390)
T ss_pred             HHHHHHHHHHHHH---HHHCHHHHHHCCCCCCCEEEEECCCCCCHHHHHHHHHHHH---CCCEEEE-------EHHHHHH
T ss_conf             9999999999999---8659899997699999727868989997899999999874---8887996-------6799752


Q ss_pred             HHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEECC---C--CCCC--------HHHHHHHHHHHHHHHHCCC
Q ss_conf             9975303532122358661245422899996514875998654---3--3321--------1577899998998763022
Q gi|254780709|r  160 IWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIIDTA---G--RLHN--------NSILMAGIGKMIRVLKRLD  226 (321)
Q Consensus       160 ~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTA---G--R~~~--------~~~lm~EL~ki~~v~~~~~  226 (321)
T Consensus       205 k~-------------vGesek~vr~lF~~Ar~~aP~IiFiDEiDai~~~R~~~~~~g~~ev~r~l~qLL~em-------D  264 (390)
T PRK03992        205 KF-------------IGEGARLVRELFELAREKAPSIIFIDEIDAIAAKRTDSGTSGDREVQRTLMQLLAEM-------D  264 (390)
T ss_pred             CC-------------CCHHHHHHHHHHHHHHHHCCCEEEHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHC-------C
T ss_conf             45-------------417999999999999970990897143256633567788862088999999999974-------4


Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             234301123102335225778999
Q gi|254780709|r  227 PHAPHSVLQVLDATTGQNALRQVE  250 (321)
Q Consensus       227 ~~~p~~~~lVlda~~gq~~~~~a~  250 (321)
T Consensus       265 G~~~~~~V~VIaATNrpd~LDpAl  288 (390)
T PRK03992        265 GFDPRGNVKIIAATNRPDILDPAL  288 (390)
T ss_pred             CCCCCCCEEEEEECCCCHHCCHHH
T ss_conf             877778827996069810059777