HHsearch alignment for GI: 254780709 and conserved domain: PRK04040

>PRK04040 adenylate kinase; Provisional.
Probab=96.48  E-value=0.0074  Score=40.36  Aligned_cols=171  Identities=19%  Similarity=0.256  Sum_probs=73.5

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-CCHH-------HHHHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             412311354444424789999999852267426774345-1245-------68899999753035321223586612454
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT-FRSA-------AIDQLKIWADRTSADFVCSEIGSDAAALA  182 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt-fR~a-------A~eQL~~~a~~~~v~~~~~~~~~dp~~v~  182 (321)
T Consensus         2 ~k~VvvtGiPGvGKTTv~~~~~~~l~~-~~~~v-n~G~~M~e~A~~~glv~~RDemRk----L~~~~--------q~~lQ   67 (189)
T PRK04040          2 MKVVVVTGVPGVGKTTVLNKALEKLKE-DYKIV-NFGDVMLEVAKEEGLVEHRDEMRK----LPLEE--------QKELQ   67 (189)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHCC-CCEEE-EHHHHHHHHHHHCCCCCCHHHHCC----CCHHH--------HHHHH
T ss_conf             418999758988789999999997235-87598-677999999998177347788747----99999--------99999


Q ss_pred             HHHHHHHHH-HCCCEEEEECCCCCCCHHHHHHHH-HHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHH---CC
Q ss_conf             228999965-148759986543332115778999-9899876302223430112310233522577899987643---58
Q gi|254780709|r  183 YEAFKQAQA-KKVDVLIIDTAGRLHNNSILMAGI-GKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAV---AG  257 (321)
Q Consensus       183 ~~a~~~a~~-~~~DvvliDTAGR~~~~~~lm~EL-~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~---~~  257 (321)
T Consensus        68 ~~Aa~~I~~~~~~~~ViIDTHa~Iktp~GylpGLP~~Vl~~L~------P~~iv-lieA~P~-eIl~RR--~~D~tR~RD  137 (189)
T PRK04040         68 REAAERIAEMAGEGPVIVDTHATIKTPGGYLPGLPEWVLEELN------PDVIV-LIEADPD-EILMRR--LRDPTRRRD  137 (189)
T ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCCCCCCCCCCCHHHHHHCC------CCEEE-EEECCHH-HHHHHH--HCCCCCCCC
T ss_conf             9999999983578728994452002688677899899998669------98899-9975889-999988--425566898


Q ss_pred             CCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCC
Q ss_conf             9769996545787069999999997698899975898132555778999998728
Q gi|254780709|r  258 TTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITG  312 (321)
Q Consensus       258 ~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG  312 (321)
T Consensus       138 ~es~~~I~~hq~~nR~~a~ayavltga~Vkiv~N-------~e~~~e~Aa~~iv~  185 (189)
T PRK04040        138 VETEESIEEHQEMNRAAAMAYAVLTGATVKIVEN-------HEGLLEEAAEEIVE  185 (189)
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHHCCEEEEEEC-------CCCCHHHHHHHHHH
T ss_conf             7889999999999999999999973984899978-------99988999999999