HHsearch alignment for GI: 254780709 and conserved domain: PRK05342

>PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional.
Probab=97.40  E-value=0.0012  Score=45.90  Aligned_cols=69  Identities=22%  Similarity=0.397  Sum_probs=38.1

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434512456889999975303532122358661245422899996
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQ  190 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~  190 (321)
T Consensus       109 KsNILliGPTG~GKTlla~tLAk~l---~vPF~iaDAT~lTE------------------aGYVGeDVE~ii~~Llq~Ad  167 (411)
T PRK05342        109 KSNILLIGPTGSGKTLLAQTLARIL---NVPFAIADATTLTE------------------AGYVGEDVENILLKLLQAAD  167 (411)
T ss_pred             CCCEEEECCCCCCHHHHHHHHHHHH---CCCEEEEEECEECC------------------CCCCCCCHHHHHHHHHHHCC
T ss_conf             4538998999977889999999986---99989986120012------------------67456079999999999828


Q ss_pred             H----HCCCEEEEE
Q ss_conf             5----148759986
Q gi|254780709|r  191 A----KKVDVLIID  200 (321)
Q Consensus       191 ~----~~~DvvliD  200 (321)
T Consensus       168 ~dve~Ae~GIV~ID  181 (411)
T PRK05342        168 YDVEKAQRGIVYID  181 (411)
T ss_pred             CCHHHHHCCEEEEE
T ss_conf             88998836828885