HHsearch alignment for GI: 254780709 and conserved domain: PRK05632

>PRK05632 phosphate acetyltransferase; Reviewed.
Probab=96.38  E-value=0.11  Score=32.20  Aligned_cols=31  Identities=32%  Similarity=0.437  Sum_probs=20.7

Q ss_pred             EECCCC-CCCCHHHHHHHHHHHHHHCCCCEEE
Q ss_conf             311354-4444247899999998522674267
Q gi|254780709|r  114 ILVVGV-NGVGKTTVIGKLSKKMSDAGLKVML  144 (321)
Q Consensus       114 il~vG~-nG~GKTTT~aKLA~~~~~~g~kV~l  144 (321)
T Consensus         4 IyIa~te~~sGKTsVaLGL~~aL~r~g~KVGf   35 (702)
T PRK05632          4 IYLAPTGTGVGLTSVSLGLVRALERKGVKVGF   35 (702)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCCEEE
T ss_conf             99962799987999999999999836884799