HHsearch alignment for GI: 254780709 and conserved domain: PRK05636

>PRK05636 replicative DNA helicase; Provisional.
Probab=96.09  E-value=0.052  Score=34.42  Aligned_cols=39  Identities=21%  Similarity=0.290  Sum_probs=31.8

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEEECC
Q ss_conf             741231135444442478999999985-226742677434
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLAAGD  148 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lva~D  148 (321)
T Consensus       266 ~G~LiIiAARPsmGKTalAlnia~n~A~~~g~~v~~fSLE  305 (507)
T PRK05636        266 GGQMIIVAARPGVGKSTIALDFMRSASIKNNKASVIFSLE  305 (507)
T ss_pred             CCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEEECC
T ss_conf             3567999737878668999999999998769937997156