HHsearch alignment for GI: 254780709 and conserved domain: PRK06526

>PRK06526 transposase; Provisional.
Probab=97.84  E-value=0.00019  Score=51.51  Aligned_cols=153  Identities=14%  Similarity=0.232  Sum_probs=89.8

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHH----HHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCC
Q ss_conf             999999999973889899999999999875127899899999----9999878520100121000136674123113544
Q gi|254780709|r   45 VREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLY----DVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVN  120 (321)
Q Consensus        45 ~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~----~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~n  120 (321)
T Consensus        34 s~~e~L~~Lle~E~~~R~~rr~~rrlk~A~fp~~ktLe~fd~~~~~~l~~~~i~~La~----~~f--i~~~~Nvil~G~~  107 (254)
T PRK06526         34 SHEEFLAACLQREVAARESHGGEGRIRAARFPSRKSLEEFDFDHQRSLKRDTIAHLGT----LDF--VTGKENVVFLGPP  107 (254)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHCCCCCCCCCCHHHHHHHHC----CCH--HHCCCCEEEECCC
T ss_conf             9999999999999999999899999997797998898767865678989999999863----717--7658878998999


Q ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEE
Q ss_conf             44424789999999852267426774345124568899999753035321223586612454228999965148759986
Q gi|254780709|r  121 GVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAKKVDVLIID  200 (321)
Q Consensus       121 G~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~~~DvvliD  200 (321)
T Consensus       108 GtGKThLA~Alg~~A~~~G~~v~f~~~~~L----~~~L~~a----------~~~g~-----~~~~~--~~l~~~dLLIiD  166 (254)
T PRK06526        108 GTGKTHLAIGLGIRACQAGHRVLFATAAQW----VARLAAA----------HHAGR-----LQDEL--VKLGRIPLLIVD  166 (254)
T ss_pred             CCCHHHHHHHHHHHHHHCCCCEEEEEHHHH----HHHHHHH----------HHCCC-----HHHHH--HHHHCCCEEEEE
T ss_conf             986899999999999986996799877999----9999998----------85580-----99999--985136877650


Q ss_pred             CCCCCCCHHHHHHHHHHHHHHHHCCCC
Q ss_conf             543332115778999989987630222
Q gi|254780709|r  201 TAGRLHNNSILMAGIGKMIRVLKRLDP  227 (321)
Q Consensus       201 TAGR~~~~~~lm~EL~ki~~v~~~~~~  227 (321)
T Consensus       167 e~g~~~~~~~~a~~---lf~li~~Rye  190 (254)
T PRK06526        167 EVGYIPFEAEAANL---FFQLVSSRYE  190 (254)
T ss_pred             CCCCCCCCHHHHHH---HHHHHHHHHC
T ss_conf             21364478899999---9999999974