HHsearch alignment for GI: 254780709 and conserved domain: PRK06904

>PRK06904 replicative DNA helicase; Validated.
Probab=95.36  E-value=0.28  Score=29.27  Aligned_cols=117  Identities=15%  Similarity=0.189  Sum_probs=65.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHH-HCCCCEEEE--------------------ECCCCCHHH------HHHHHHHHH
Q ss_conf             41231135444442478999999985-226742677--------------------434512456------889999975
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMS-DAGLKVMLA--------------------AGDTFRSAA------IDQLKIWAD  163 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~-~~g~kV~lv--------------------a~DtfR~aA------~eQL~~~a~  163 (321)
T Consensus       221 g~LiViAaRPsmGKTa~alnia~n~A~~~~~~V~~fSLEM~~~~l~~R~ls~~s~v~~~~i~~g~~l~~~e~~~~~~~~~  300 (472)
T PRK06904        221 SDLIIVAARPSMGKTTFAMNLCENAAMASEKPVLVFSLEMPAEQIMMRMLASLSRVDQTKIRTGQNLDQQDWAKISSTVG  300 (472)
T ss_pred             CCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCCCHHHHHCCCCCHHHHHHHHHHHHH
T ss_conf             75799973798756899999999999955995799778799999999999986499988864688560999999999999


Q ss_pred             HH-CCC-CCCCC-CCCCCHHHHHHHHHHHHHH-CCCEEEEECCCCCCCH---HHHHHHHHHHHHHHHCCCC
Q ss_conf             30-353-21223-5866124542289999651-4875998654333211---5778999989987630222
Q gi|254780709|r  164 RT-SAD-FVCSE-IGSDAAALAYEAFKQAQAK-KVDVLIIDTAGRLHNN---SILMAGIGKMIRVLKRLDP  227 (321)
Q Consensus       164 ~~-~v~-~~~~~-~~~dp~~v~~~a~~~a~~~-~~DvvliDTAGR~~~~---~~lm~EL~ki~~v~~~~~~  227 (321)
T Consensus       301 ~l~~~~~l~idd~~~~t~~~i~~~~r~~~~~~~~l~~vvIDYLqL~~~~~~~~~r~~ei~~isr~LK~lAk  371 (472)
T PRK06904        301 MFKQKPNLYIDDSSGLTPTELRSRARRVYRENGGLSLIMVDYLQLMRAPGFEDNRTLEIAEISRSLKALAK  371 (472)
T ss_pred             HHHCCCCEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEEEHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             98468981684699999999999999999873899789963886604888777788999999999999999