HHsearch alignment for GI: 254780709 and conserved domain: PRK07132

>PRK07132 DNA polymerase III subunit delta'; Validated.
Probab=96.31  E-value=0.019  Score=37.53  Aligned_cols=121  Identities=12%  Similarity=0.096  Sum_probs=62.3

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHC-CCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHH-HHHHH
Q ss_conf             6674123113544444247899999998522-674267743451245688999997530353212235866124-54228
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDA-GLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAA-LAYEA  185 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~-g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~-v~~~a  185 (321)
T Consensus        17 ~klsHAYLF~G~~G~Gk~~~a~~~a~~l~~~~~~~~~--~~~------------~~--~~~~~id-~~~~~i~~~~i~~~   79 (303)
T PRK07132         17 NKISHSFLLKSNYNNDLDESILYFLNKFNNLQSLNLN--LEE------------LP--YNIFLFD-IFDEDLSKEEFLSA   79 (303)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCC--CCC------------CC--CCCEEEC-CCCCCHHHHHHHHH
T ss_conf             9976168867899867999999999997299878887--545------------65--3230413-32220016889999


Q ss_pred             HHHHH-----HHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHH
Q ss_conf             99996-----5148759986543332115778999989987630222343011231023352257789998764
Q gi|254780709|r  186 FKQAQ-----AKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHA  254 (321)
Q Consensus       186 ~~~a~-----~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~  254 (321)
T Consensus        80 i~~~~~~~~~~~~~Kv~IIdea~~lt~~A~---------NaLLKtLEEPp~~~~fil~t~~~~~il~TI~SRCq  144 (303)
T PRK07132         80 IEKFSFSSFVSNQKKILIIKNIEKTSNSSL---------NALLKTIEEPSKNTYFLLTTKNINKVIPTIVSRCQ  144 (303)
T ss_pred             HHHHHHCCCCCCCEEEEEEECHHHCCHHHH---------HHHHHHCCCCCCCEEEEEEECCHHHCCHHHHHCCE
T ss_conf             999973665568706999816553399999---------99998703898684899972882438377863665