HHsearch alignment for GI: 254780709 and conserved domain: PRK08116

>PRK08116 hypothetical protein; Validated.
Probab=96.94  E-value=0.0068  Score=40.61  Aligned_cols=92  Identities=21%  Similarity=0.342  Sum_probs=57.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
T Consensus       110 GLll~G~~GtGKThLa~aIa~~l~~~g~~V~~~~~~~l----l~~lk~~--------~~~~~~~~----~~e~l~~--l~  171 (262)
T PRK08116        110 GLLLWGSPGNGKTYLAAAIANELIEKGVPVVFVNVPEL----LNRIKST--------YNSEGKED----ENEIIRA--LD  171 (262)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHCCCEEEEEEHHHH----HHHHHHH--------HHCCCCHH----HHHHHHH--HH
T ss_conf             18998989998999999999999987993999889999----9999999--------86356101----9999998--61


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCC
Q ss_conf             487599865433321157789999899876302
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRL  225 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~  225 (321)
T Consensus       172 ~~dLLIiDDlG~e~~t~w~~---e~lf~IIn~R  201 (262)
T PRK08116        172 NADLLILDDLGAEKDTEWVR---EKLYNIIDSR  201 (262)
T ss_pred             CCCEEEEEHHCCCCCCHHHH---HHHHHHHHHH
T ss_conf             29989983221456987899---9999999999