HHsearch alignment for GI: 254780709 and conserved domain: PRK09302

>PRK09302 circadian clock protein KaiC; Reviewed.
Probab=97.78  E-value=0.00019  Score=51.46  Aligned_cols=90  Identities=22%  Similarity=0.205  Sum_probs=61.5

Q ss_pred             CCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCC-------CCCCHH--
Q ss_conf             74123113544444247899999998522674267743451245688999997530353212235-------866124--
Q gi|254780709|r  110 RPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEI-------GSDAAA--  180 (321)
Q Consensus       110 ~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~-------~~dp~~--  180 (321)
T Consensus       265 ~GsstLi~Gp~GtGKTtla~qFl~~~a~~GE~~l~~~FeE~----~~~l~~~a~~~G~dl~~~~~~G~l~i~~~~p~~~~  340 (501)
T PRK09302        265 RGSIILVSGATGTGKTLLVSKFAEAACRRGERCLLFAFEES----RAQLVRNATSWGIDLEEMERKGLLKIICARPESTG  340 (501)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEEEECC----HHHHHHHHHHCCCCHHHHHHCCCEEEEEECCCCCC
T ss_conf             89469998899988899999999999865990899999679----99999999973998488874894799983700059


Q ss_pred             ---HHHHHHHHHHHHCCCEEEEECCC
Q ss_conf             ---54228999965148759986543
Q gi|254780709|r  181 ---LAYEAFKQAQAKKVDVLIIDTAG  203 (321)
Q Consensus       181 ---v~~~a~~~a~~~~~DvvliDTAG  203 (321)
T Consensus       341 ~~e~~~~i~~~v~~~~~~rVvIDsls  366 (501)
T PRK09302        341 LEDHLQIIKREIEEFKPSRVAVDPLS  366 (501)
T ss_pred             HHHHHHHHHHHHHHCCCCEEEECCHH
T ss_conf             89999999999997299899995806