HHsearch alignment for GI: 254780709 and conserved domain: PRK09361

>PRK09361 radB DNA repair and recombination protein RadB; Provisional.
Probab=98.25  E-value=1.5e-05  Score=59.30  Aligned_cols=92  Identities=15%  Similarity=0.187  Sum_probs=59.3

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHH--H-CCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             412311354444424789999999852267426774345124568899999753--0-3532122358661245422899
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADR--T-SADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~--~-~v~~~~~~~~~dp~~v~~~a~~  187 (321)
T Consensus        23 G~itei~G~pG~GKTtl~lq~a~~~~~~g~~vlYidtE~~~~er~~qi~~~~~~~~~~~i~~~-~~~~~~~~~~~i~~~~  101 (224)
T PRK09361         23 GTITQIYGPPGSGKTNICIQLAVEAARQGKKVIYIDTEGLSPERFKQIAGEDFEELLSNIIIF-EPSSFEEQREAIQKAE  101 (224)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHCCCHHHHHHCCEEE-CCCCHHHHHHHHHHHH
T ss_conf             879999899998599999999999997499099967876788999998565734542061472-4798899999999999


Q ss_pred             HHHHHCCCEEEEECCC
Q ss_conf             9965148759986543
Q gi|254780709|r  188 QAQAKKVDVLIIDTAG  203 (321)
Q Consensus       188 ~a~~~~~DvvliDTAG  203 (321)
T Consensus       102 ~~~~~~~~lvVIDSi~  117 (224)
T PRK09361        102 KIAKENVGLIVLDSAT  117 (224)
T ss_pred             HHHHCCCCEEEEECCH
T ss_conf             8750587389996230