HHsearch alignment for GI: 254780709 and conserved domain: PRK10865

>PRK10865 protein disaggregation chaperone; Provisional.
Probab=97.24  E-value=0.0013  Score=45.65  Aligned_cols=130  Identities=17%  Similarity=0.210  Sum_probs=64.0

Q ss_pred             CCCCC-CEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCC-CCCC-CCCCCHHHHH
Q ss_conf             36674-1231135444442478999999985226742677434512456889999975303532-1223-5866124542
Q gi|254780709|r  107 FSHRP-HVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADF-VCSE-IGSDAAALAY  183 (321)
Q Consensus       107 ~~~~p-~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~-~~~~-~~~dp~~v~~  183 (321)
T Consensus       593 dp~rPiGsFLFlGPTGVGKTElAK~LA~~LF~~e~~--liriDM---SEy~E~hsVSrLiGaPPGYVGy~eGG----~LT  663 (857)
T PRK10865        593 DPNRPIGSFLFLGPTGVGKTELCKALANFMFDSDDA--MVRIDM---SEFMEKHSVSRLVGAPPGYVGYEEGG----YLT  663 (857)
T ss_pred             CCCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCHHH--EEEECC---HHHCCCHHHHHHCCCCCCCCCCCCCC----CHH
T ss_conf             999973899986898788899999999998389334--256253---32113012767558998766757788----110


Q ss_pred             HHHHHHHHHCCCEEEEECCCCCCCHH-HHHHHHHHHHHHHHCCC-CCCCCEEEEECCCCCCHHHHHH
Q ss_conf             28999965148759986543332115-77899998998763022-2343011231023352257789
Q gi|254780709|r  184 EAFKQAQAKKVDVLIIDTAGRLHNNS-ILMAGIGKMIRVLKRLD-PHAPHSVLQVLDATTGQNALRQ  248 (321)
Q Consensus       184 ~a~~~a~~~~~DvvliDTAGR~~~~~-~lm~EL~ki~~v~~~~~-~~~p~~~~lVlda~~gq~~~~~  248 (321)
T Consensus       664 eaV---Rr~PySVvLfDEIEKAHpdV~nilLQvlD~G~LtD~~Gr~vdF~NtIIImTSN~Gs~~i~~  727 (857)
T PRK10865        664 EAV---RRRPYSVILLDEVEKAHPDVFNILLQVLDDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQE  727 (857)
T ss_pred             HHH---HHCCCEEEEEHHHHHHCHHHHHHHHHHHCCCEEECCCCCEEEEEEEEEEECCCHHHHHHHH
T ss_conf             999---8198778863257663858999999870368320799988851334899646233699986