HHsearch alignment for GI: 254780709 and conserved domain: PRK10867

>PRK10867 signal recognition particle protein; Provisional.
Probab=100.00  E-value=0  Score=664.75  Aligned_cols=290  Identities=32%  Similarity=0.509  Sum_probs=273.5

Q ss_pred             HHHHHHHHHHHHHHHHCCCCCCHH----HHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCC----C-HHHHHHHHHHH
Q ss_conf             999999999999986056778999----99999999997388989999999999987512789----9-89999999998
Q gi|254780709|r   21 FASTSLKLKEGITDIISSRRLDDG----VREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDV----S-VQRVLYDVSEL   91 (321)
Q Consensus        21 L~kt~~~L~~~l~~l~~~~~lde~----~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i----~-~~~i~~~l~~~   91 (321)
T Consensus         2 f~~Ls~~l~~~~~~l~g~~~lte~~i~~~lrEIr~ALLeADV~~~vvk~~i~~vke~~~g~~v~~~l~p~q~i~kiv~~e   81 (453)
T PRK10867          2 FDNLTDRLSRTLRNISGRGRLTEDNVKETLREVRMALLEADVALPVVREFINRVKEKAVGHEVNKSLTPGQEFVKIVRNE   81 (453)
T ss_pred             HHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             37888999999997149987789999999999999999756887999999999999963351357898899999999999


Q ss_pred             HHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCC
Q ss_conf             7852010012100013667412311354444424789999999852-267426774345124568899999753035321
Q gi|254780709|r   92 IHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAAIDQLKIWADRTSADFV  170 (321)
Q Consensus        92 L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA~~~~~-~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~  170 (321)
T Consensus        82 L~~lLg~~~~~l~~~-~~~p~VIm~vGLqGsGKTTT~aKLA~~lk~k~~k~vllvaaDt~RpaA~eQL~~la~~~~v~~~  160 (453)
T PRK10867         82 LVAAMGEENQTLNLA-AQPPAVVLMAGLQGAGKTTSVGKLGKFLREKHKKKVLVVSADVYRPAAIKQLETLAEQVGVDFF  160 (453)
T ss_pred             HHHHHCCCCCCCCCC-CCCCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCEE
T ss_conf             999858887666337-8999699997468885185899999999973898379855887705899999999985198043


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHH
Q ss_conf             22358661245422899996514875998654333211577899998998763022234301123102335225778999
Q gi|254780709|r  171 CSEIGSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVE  250 (321)
Q Consensus       171 ~~~~~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~  250 (321)
T Consensus       161 ~~~~~~dp~~ia~~a~~~ak~~~~DvvivDTAGRl~~d~~Lm~El~~i~~~~~------P~e~llV~Da~~GQ~a~~~a~  234 (453)
T PRK10867        161 PSDVGQKPVDIVNAALKEAKLKFYDVLLVDTAGRLHVDEAMMDEIKQVHASIN------PVETLFVVDAMTGQDAANTAK  234 (453)
T ss_pred             CCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCHHCCHHHHHHHHHHHHHHC------CCCEEEEEECCCCHHHHHHHH
T ss_conf             67889988999999999999779999999787601210888999999987637------871379743223566899999


Q ss_pred             HHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCHHHHHHHHCCCCCCC
Q ss_conf             8764358976999654578706999999999769889997589813255577899999872865646
Q gi|254780709|r  251 MFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGVGEGINDLEPFVAKDFSAVITGCLDYG  317 (321)
Q Consensus       251 ~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~Ge~i~Dl~~f~~~~~~~~llG~gd~~  317 (321)
T Consensus       235 ~F~~~~~~~gvIlTKlDgdarGG~alS~~~~t~~PI~FiG~GEk~ddle~F~p~r~asRILGmGDi~  301 (453)
T PRK10867        235 AFNEALPLTGVVLTKVDGDARGGAALSIRHITGKPIKFLGVGEKTDALEPFHPDRIASRILGMGDVL  301 (453)
T ss_pred             HHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHCCCCCHH
T ss_conf             9998559870787504678761389899999786967886699824588768489999861898789