HHsearch alignment for GI: 254780709 and conserved domain: PRK12726

>PRK12726 flagellar biosynthesis regulator FlhF; Provisional.
Probab=100.00  E-value=0  Score=482.35  Aligned_cols=241  Identities=22%  Similarity=0.308  Sum_probs=200.4

Q ss_pred             HHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEECCCCCCCCHHHHHHHHH
Q ss_conf             99738898999999999998751278998999999999878520100121000136674123113544444247899999
Q gi|254780709|r   53 LIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKMLMPLSKPFNWDFSHRPHVILVVGVNGVGKTTVIGKLS  132 (321)
Q Consensus        53 LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~~~L~~~L~~~~~~~~~~~~~~p~vil~vG~nG~GKTTT~aKLA  132 (321)
T Consensus       159 ~~~~~f~~~~~~~~-~~~------e~~~~~~~~~~~~~~~~~~~~~-~~~~~l~---~g~VIaLVGvnGvGKTTTiAKLA  227 (407)
T PRK12726        159 TYVADFMQAGRKQF-KQV------ETAHLDDITDWFVPYLSGKLAV-EDSFDLS---NHRIISLIGQTGVGKTTTLVKLG  227 (407)
T ss_pred             HHHHHHHHHHHHHH-HHH------HHHHHHHHHHHHHHHHCCCCCC-CCEEEEC---CCCEEEEECCCCCCHHHHHHHHH
T ss_conf             66542448899999-887------3101534068999975389770-3202303---69089998999897899999999


Q ss_pred             HHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHH-HHHHCCCEEEEECCCCCCCHHHH
Q ss_conf             99852267426774345124568899999753035321223586612454228999-96514875998654333211577
Q gi|254780709|r  133 KKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQ-AQAKKVDVLIIDTAGRLHNNSIL  211 (321)
Q Consensus       133 ~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~-a~~~~~DvvliDTAGR~~~~~~l  211 (321)
T Consensus       228 ~~l~~~gkkV~LVAaDTFRaAAiEQLk~~g~rlgVpV~~---~~dpa~l~-~av~~~a~~~~~DvVIIDTAGRl~~d~~L  303 (407)
T PRK12726        228 WQLLKQNRTVGFITTDTFRSGAVEQFQGYADKLDVELIV---ATSPAELE-EAVQYMTYVNCVDHILIDTVGRNYLAEES  303 (407)
T ss_pred             HHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCEEEE---ECCHHHHH-HHHHHHHHCCCCCEEEEECCCCCCCCHHH
T ss_conf             999977991799970667788999999999997964998---18889999-99999986289998999699988134999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHHHHCCCEEEEEC
Q ss_conf             89999899876302223430112310233522577899987643589769996545787069999999997698899975
Q gi|254780709|r  212 MAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQVEMFHAVAGTTGLIMTKMDGTARGGGLIPIVVTHKIPVYFLGV  291 (321)
Q Consensus       212 m~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a~~F~~~~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~fig~  291 (321)
T Consensus       304 m~EL~ki~~vi~------P~~~lLV~dag~~~~~v~qa~~~~~~v~ItGiILTKLDgtAKGG~aLSi~~~~~lPI~fIG~  377 (407)
T PRK12726        304 VSEISAYTDVVH------PDLTCFTFSSGMKSADVMTILPKLAEIPIDGFIITKMDETTRIGDLYTVMQETNLPVLYMTD  377 (407)
T ss_pred             HHHHHHHHHCCC------CCEEEEEECCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCCCCCHHHHHHHHHCCCEEEEEC
T ss_conf             999999873328------96699993675669999999987047999879997014789853999999998889799947


Q ss_pred             CCCC-CCCCCCCHHHHHHHHCCCC
Q ss_conf             8981-3255577899999872865
Q gi|254780709|r  292 GEGI-NDLEPFVAKDFSAVITGCL  314 (321)
Q Consensus       292 Ge~i-~Dl~~f~~~~~~~~llG~g  314 (321)
T Consensus       378 GEkIPEDi~~~~~~~l~~R~l~~~  401 (407)
T PRK12726        378 GQNITENIFRPKSRWLAERFVGTD  401 (407)
T ss_pred             CCCCCCCCCCCCHHHHHHHHHCCH
T ss_conf             999970120289899999984631