HHsearch alignment for GI: 254780709 and conserved domain: PRK13231

>PRK13231 nitrogenase reductase-like protein; Reviewed.
Probab=98.33  E-value=2e-05  Score=58.44  Aligned_cols=158  Identities=16%  Similarity=0.163  Sum_probs=97.4

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCC-----------HHHHHHHHHHHHH----------HCCCCCC
Q ss_conf             231135444442478999999985226742677434512-----------4568899999753----------0353212
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFR-----------SAAIDQLKIWADR----------TSADFVC  171 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR-----------~aA~eQL~~~a~~----------~~v~~~~  171 (321)
T Consensus         4 ~iAiyGKGGIGKSTt~~NlaaalA-~g~rVl~igcDpk~dst~~L~G~~~ptvl~~l~~~~~~~~~dvv~~g~~gi~cv-   81 (264)
T PRK13231          4 KIAIYGKGGIGKSTTVSNMAAAYS-SDNSTLVIGCDPKADTTRTLVGKRIPTVLDTLKDNRQPELEDIIYEGYNNTLCV-   81 (264)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHH-CCCCEEEECCCCCCCHHHHHHCCCCCCHHHHHHHCCCCCHHHHEEECCCCEEEE-
T ss_conf             899978985478889999999998-799779985688850246761999883889863127777656312178984997-


Q ss_pred             CCCC-CCCH--------HHHHHHHHHHH--HHCCCEEEEECCCCC---CCHHHHHHHHHHHHHHHHCCCCCCCCEEEEEC
Q ss_conf             2358-6612--------45422899996--514875998654333---21157789999899876302223430112310
Q gi|254780709|r  172 SEIG-SDAA--------ALAYEAFKQAQ--AKKVDVLIIDTAGRL---HNNSILMAGIGKMIRVLKRLDPHAPHSVLQVL  237 (321)
Q Consensus       172 ~~~~-~dp~--------~v~~~a~~~a~--~~~~DvvliDTAGR~---~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVl  237 (321)
T Consensus        82 -esGgpepg~gcagrgi~~~~~lLe~~~~~~~~~D~vl~Dvlgdvvcggfa~Pi--------------r~~~Adev~IVt  146 (264)
T PRK13231         82 -ESGGPEPGVGCAGRGVIVAMNLLEKLGVFDNDPDVVIYDVLGDVVCGGFSVPL--------------REDYADEVYIVT  146 (264)
T ss_pred             -ECCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCEECCC--------------CCCCCCEEEEEE
T ss_conf             -37998877665652176898999872642247987999435872056670455--------------426698899994


Q ss_pred             CC--CCCHHHHHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHHHHHHCCCEE
Q ss_conf             23--3522577899987643-58976999654578706999999999769889
Q gi|254780709|r  238 DA--TTGQNALRQVEMFHAV-AGTTGLIMTKMDGTARGGGLIPIVVTHKIPVY  287 (321)
Q Consensus       238 da--~~gq~~~~~a~~F~~~-~~~~g~I~TKlD~ta~~G~~ls~~~~~~~Pi~  287 (321)
T Consensus       147 s~e~msLyaAnnI~~~i~~~~~rl~GiI~N~r~~~~e~~iv~~fa~~~g~~vl  199 (264)
T PRK13231        147 SGEYMSLYAANNIAKGIKKLKGKLGGIICNCRNVKNEVEIVSEFASLIGSRII  199 (264)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCHHHHHHHHHHHCCCCEE
T ss_conf             78589999999999999995464420896068988779999999997199689