HHsearch alignment for GI: 254780709 and conserved domain: PRK13632

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=96.00  E-value=0.0078  Score=40.21  Aligned_cols=53  Identities=17%  Similarity=0.239  Sum_probs=34.8

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCC
Q ss_conf             412311354444424789999999852267426774345124568899999753035
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSA  167 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v  167 (321)
T Consensus        36 Ge~vaivG~nGsGKSTLlk~l~Gll~p~~G~I~v~G~~i~~~----~~~~~~~~ig~   88 (273)
T PRK13632         36 GEYVAILGHNGSGKSTISKILTGLLKPQSGEIKIFGITISKE----NLKYLRKKIGI   88 (273)
T ss_pred             CCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEEECCEECCCC----CHHHHHHHEEE
T ss_conf             989999999998699999999738778887599999999968----98998743569