HHsearch alignment for GI: 254780709 and conserved domain: PRK13651

>PRK13651 cobalt transporter ATP-binding subunit; Provisional.
Probab=96.23  E-value=0.0095  Score=39.60  Aligned_cols=58  Identities=21%  Similarity=0.190  Sum_probs=36.5

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCC-------------CCHHHH---HHHHHHHHHHCCC
Q ss_conf             412311354444424789999999852267426774345-------------124568---8999997530353
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDT-------------FRSAAI---DQLKIWADRTSAD  168 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~Dt-------------fR~aA~---eQL~~~a~~~~v~  168 (321)
T Consensus        33 GE~v~IiG~nGsGKSTL~k~l~Gll~P~~G~V~~~g~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~lr~~vG~v  106 (304)
T PRK13651         33 GEFIAIIGQTGSGKTTFIEHLNALLLPDTGTIEWIYFDEKNKEKKKVVEDPVIKLKFRKKLKKIKEIRRRVGVV  106 (304)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHCCCCCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCEEEE
T ss_conf             98999987999859999999966999887169994245434554311343022134566666689877337999