HHsearch alignment for GI: 254780709 and conserved domain: PTZ00133

>PTZ00133 ADP-ribosylation factor; Provisional.
Probab=96.57  E-value=0.0081  Score=40.09  Aligned_cols=139  Identities=17%  Similarity=0.246  Sum_probs=69.6

Q ss_pred             CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             66741231135444442478999999985226742677434512456889999975303532122358661245422899
Q gi|254780709|r  108 SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       108 ~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
T Consensus        14 ~kk~~kililGl~~sGKTsil~~l~----~-~~~~----------------------~~~pTvg~----~~~~-------   55 (182)
T PTZ00133         14 GKKEVRILMVGLDAAGKTTILYKLK----L-GEVV----------------------TTIPTIGF----NVET-------   55 (182)
T ss_pred             CCCEEEEEEECCCCCCHHHHHHHHH----C-CCCC----------------------CCCCCCCC----CEEE-------
T ss_conf             7874799999679988999999996----2-9977----------------------73786884----5699-------


Q ss_pred             HHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCCHHHHHHH-HHHHHHC---CCCE---
Q ss_conf             99651487599865433321157789999899876302223430112310233522577899-9876435---8976---
Q gi|254780709|r  188 QAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTGQNALRQV-EMFHAVA---GTTG---  260 (321)
Q Consensus       188 ~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~gq~~~~~a-~~F~~~~---~~~g---  260 (321)
T Consensus        56 -~~~~~~~l~iwD~~Gqe~~-r~l----------w~~yy~-~~~giI~VvD~sd~~-~~~~~~~~l~~~l~~~~~~~~pi  121 (182)
T PTZ00133         56 -VEYKNLKFTMWDVGGQDKL-RPL----------WRHYYQ-NTNGIIFVVDSNDRE-RIGDARQELEKMLAEDELRNAVL  121 (182)
T ss_pred             -EEECCEEEEEEECCCCCCC-CHH----------HHHCCC-CCCEEEEEEECCCHH-HHHHHHHHHHHHHCCHHHCCCEE
T ss_conf             -9978889999989998454-747----------876056-764499999667878-99999999999971442248859


Q ss_pred             -EEEECCCCCC-CH-H---HHHHHHHHHCCCEEEEE----CCCCCCCC
Q ss_conf             -9996545787-06-9---99999999769889997----58981325
Q gi|254780709|r  261 -LIMTKMDGTA-RG-G---GLIPIVVTHKIPVYFLG----VGEGINDL  298 (321)
Q Consensus       261 -~I~TKlD~ta-~~-G---~~ls~~~~~~~Pi~fig----~Ge~i~Dl  298 (321)
T Consensus       122 Li~~NK~Dl~~a~~~~ei~~~l~l~~~~~~~~~i~~~SA~tG~Gi~e~  169 (182)
T PTZ00133        122 LVFANKQDLPNAMSTTEVTEKLGLHSVRQRNWYIQGCCATTAQGLYEG  169 (182)
T ss_pred             EEEECCCCCCCCCCHHHHHHHHCHHHHHCCCCEEEEEECCCCCCHHHH
T ss_conf             999706687788899999999695556159958998257589498999