HHsearch alignment for GI: 254780709 and conserved domain: TIGR01007

>TIGR01007 eps_fam capsular exopolysaccharide family; InterPro: IPR005702 This family describes the capsular exopolysaccharide proteins in bacteria. The exopolysaccharide gene cluster consists of several genes which encode a number of proteins which regulate the exoploysaccharide biosynthesis (EPS). At least 13 genes EpsA to EpsM in streptococcus species seem to direct the EPS proteins and share high homology. ; GO: 0030234 enzyme regulator activity, 0045227 capsule polysaccharide biosynthetic process.
Probab=98.38  E-value=5.9e-06  Score=62.12  Aligned_cols=145  Identities=21%  Similarity=0.303  Sum_probs=92.3

Q ss_pred             CCEEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHH----------------------HHHHHHHHHH-HC
Q ss_conf             4123113-5444442478999999985226742677434512456----------------------8899999753-03
Q gi|254780709|r  111 PHVILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAA----------------------IDQLKIWADR-TS  166 (321)
Q Consensus       111 p~vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA----------------------~eQL~~~a~~-~~  166 (321)
T Consensus        19 ~K~l~itS~~~~eGKsT~S~NiA~~fAqaGyKTLlIDgD~R~sv~~~~Fk~~n~~~GLtn~L~g~~dl~~~i~~T~isen   98 (207)
T TIGR01007        19 IKVLLITSVKAGEGKSTTSANIAVSFAQAGYKTLLIDGDMRNSVMSGTFKSQNKIKGLTNFLSGNTDLSDAICETNISEN   98 (207)
T ss_pred             EEEEEEEECCCCCCCEEEEHHHHHHHHHCCCEEEEEECCCCCCCEEEEECCCCCCCCCHHHHCCCCCHHHHHHCCCCCCC
T ss_conf             05899841105888624107889999856855888754658660367865888765633322145453334202654678


Q ss_pred             CCCCCC-CCCCCCHHHH----HHHHHHHHHHCCCEEEEECCCC-CCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCC-
Q ss_conf             532122-3586612454----2289999651487599865433-32115778999989987630222343011231023-
Q gi|254780709|r  167 ADFVCS-EIGSDAAALA----YEAFKQAQAKKVDVLIIDTAGR-LHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDA-  239 (321)
Q Consensus       167 v~~~~~-~~~~dp~~v~----~~a~~~a~~~~~DvvliDTAGR-~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda-  239 (321)
T Consensus        99 L~vi~sG~vPPNPt~LL~s~~F~~l~e~~~~~fD~iiiDTPPig~V~DAai~------a~--------~~d~~~LV~~A~  164 (207)
T TIGR01007        99 LDVITSGPVPPNPTELLQSSNFKTLIETLRKYFDYIIIDTPPIGTVIDAAII------AR--------AVDASILVTDAG  164 (207)
T ss_pred             CEEECCCCCCCCHHHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH------HH--------HHCCEEEEEECC
T ss_conf             7275178878775478888999999999871688899951886667889999------98--------729779887225


Q ss_pred             CCCHHHHHHHHHHHHHC--CCCEEEEECCCCC
Q ss_conf             35225778999876435--8976999654578
Q gi|254780709|r  240 TTGQNALRQVEMFHAVA--GTTGLIMTKMDGT  269 (321)
Q Consensus       240 ~~gq~~~~~a~~F~~~~--~~~g~I~TKlD~t  269 (321)
T Consensus       165 ~~~k~~v~KAK~~LEq~G~~~LGvvLNK~d~s  196 (207)
T TIGR01007       165 KIKKREVKKAKEQLEQAGSKFLGVVLNKVDIS  196 (207)
T ss_pred             CCCHHHHHHHHHHHHHHCCCEEEEEECCCCCC
T ss_conf             32646789999999861784115888882576