HHsearch alignment for GI: 254780709 and conserved domain: TIGR01420

>TIGR01420 pilT_fam twitching motility protein; InterPro: IPR006321 These represent the PilT subfamily of proteins related to GspE, a protein involved in type II secretion (also called the General Secretion Pathway). PilT is an apparent cytosolic ATPase associated with type IV pilus systems. It is not required for pilin biogenesis, but is required for twitching motility and social gliding behaviors, shown in some species, powered by pilus retraction . Members of this family may be found in some species that do not have type IV pili but have related structures for DNA uptake and natural transformation. ; GO: 0005524 ATP binding, 0006810 transport.
Probab=98.33  E-value=2.5e-07  Score=71.75  Aligned_cols=196  Identities=19%  Similarity=0.252  Sum_probs=98.3

Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHH--CCCCCCCC
Q ss_conf             9999999986056778999999999999973889899999999999875127899899999999987852--01001210
Q gi|254780709|r   26 LKLKEGITDIISSRRLDDGVREELEDLLIRSDIGVAVAQKIVEELLTKRYAKDVSVQRVLYDVSELIHKM--LMPLSKPF  103 (321)
Q Consensus        26 ~~L~~~l~~l~~~~~lde~~leeLee~LL~ADVg~~va~~Iie~ik~~~~~~~i~~~~i~~~l~~~L~~~--L~~~~~~~  103 (321)
T Consensus        45 ~~~~~l~~~~l~~t--h~~~~~~f~~~-~E~Dfs~~~~~~--~RfRvN~f~QRg~~a~vlR~ip~~Ip~fe~LG-LP~~v  118 (350)
T TIGR01420        45 EDTQKLLREILSST--HEKQREEFEEN-GELDFSFSLPGL--ARFRVNAFKQRGGVALVLRLIPSKIPTFEELG-LPRPV  118 (350)
T ss_pred             HHHHHHHHHHCCCC--CHHHHHHHHHC-CCCCEEEEECCC--CEEEEHHHHHCCHHHHHHHHCCCCCCCHHHCC-CCHHH
T ss_conf             99999999863845--65777505650-664446630673--22122032350006423231153462166637-98789


Q ss_pred             CCCC-CCCCCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHH
Q ss_conf             0013-667412311354444424789999999852267426774345124568899999753035321223586612454
Q gi|254780709|r  104 NWDF-SHRPHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALA  182 (321)
Q Consensus       104 ~~~~-~~~p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~  182 (321)
T Consensus       119 ~~~~a~~~~GLiLVTGPTGSGKSTTlAsmIDyIN~~~~~H-IiTIE-------DPIEyvh~~~~sli~QREvG~DT~s-F  189 (350)
T TIGR01420       119 LRELAERPRGLILVTGPTGSGKSTTLASMIDYINKNKAGH-IITIE-------DPIEYVHKNKRSLINQREVGLDTLS-F  189 (350)
T ss_pred             HHHHHHCCCCCEEEECCCCCCHHHHHHHHHHHHHCCCCCC-CEEEE-------CCEEEEECCCEEEEECCCCCCCHHH-H
T ss_conf             9999836699389876889867899999997874038888-25631-------7731410477024543624675457-9


Q ss_pred             HHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCCCC-HHHHHHHHHH
Q ss_conf             228999965148759986543332115778999989987630222343011231023352-2577899987
Q gi|254780709|r  183 YEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDATTG-QNALRQVEMF  252 (321)
Q Consensus       183 ~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~~g-q~~~~~a~~F  252 (321)
T Consensus       190 ~~ALraALReDPDvILiG----------E~RD~ET~~~AL~AAETG-----HLV~-gTLHTnsA~~ti~RI  244 (350)
T TIGR01420       190 ANALRAALREDPDVILIG----------EMRDLETVELALTAAETG-----HLVF-GTLHTNSAAKTIERI  244 (350)
T ss_pred             HHHHHHHHCCCCCEEEEE----------CCCCHHHHHHHHHHHHHC-----CHHH-HHHHHHHHHHHHHHH
T ss_conf             999768410289889982----------556278999999874213-----1567-666642388876777