HHsearch alignment for GI: 254780709 and conserved domain: TIGR02533

>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369 GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway. ; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015628 protein secretion by the type II secretion system, 0015627 type II protein secretion system complex.
Probab=97.37  E-value=0.00015  Score=52.32  Aligned_cols=74  Identities=19%  Similarity=0.329  Sum_probs=51.4

Q ss_pred             CCEEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECC---CCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             41231135444442478999999985226742677434---512456889999975303532122358661245422899
Q gi|254780709|r  111 PHVILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGD---TFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFK  187 (321)
Q Consensus       111 p~vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~D---tfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~  187 (321)
T Consensus       245 HGIiLVTGPTGSGKtTTL--YaaL~~LN~~~~NIlTvEDPVEY~i~GIgQ~Qvn-~kIglTF------------A-~GLR  308 (495)
T TIGR02533       245 HGIILVTGPTGSGKTTTL--YAALSRLNTPERNILTVEDPVEYQIEGIGQIQVN-PKIGLTF------------A-AGLR  308 (495)
T ss_pred             CCEEEECCCCCCCHHHHH--HHHHHHHCCCCCCEEEEECCEEEEECCCCEEEEC-CCCCHHH------------H-HHHH
T ss_conf             961884177898525889--9999863589971568657824762487636514-6543038------------8-8878


Q ss_pred             HHHHHCCCEEEEE
Q ss_conf             9965148759986
Q gi|254780709|r  188 QAQAKKVDVLIID  200 (321)
Q Consensus       188 ~a~~~~~DvvliD  200 (321)
T Consensus       309 aILRQDPDiiMvG  321 (495)
T TIGR02533       309 AILRQDPDIIMVG  321 (495)
T ss_pred             HHHCCCCCEEEEE
T ss_conf             8642799889982