HHsearch alignment for GI: 254780709 and conserved domain: TIGR03018

>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase. Members of this protein family are related to a known protein-tyrosine autokinase and to numerous homologs from exopolysaccharide biosynthesis region proteins, many of which are designated as chain length determinants. Most members of this family contain a short region, immediately C-terminal to the region modeled here, with an abundance of Tyr residues. These C-terminal tyrosine residues are likely to be autophosphorylation sites. Some members of this family are fusion proteins.
Probab=98.52  E-value=7.4e-06  Score=61.42  Aligned_cols=141  Identities=18%  Similarity=0.254  Sum_probs=81.7

Q ss_pred             CCCCCEEECCCC-CCCCHHHHHHHHHHHHHH-CCCCEEEEECCCCCHHHHHH------------HH----HHHHH-----
Q ss_conf             667412311354-444424789999999852-26742677434512456889------------99----99753-----
Q gi|254780709|r  108 SHRPHVILVVGV-NGVGKTTVIGKLSKKMSD-AGLKVMLAAGDTFRSAAIDQ------------LK----IWADR-----  164 (321)
Q Consensus       108 ~~~p~vil~vG~-nG~GKTTT~aKLA~~~~~-~g~kV~lva~DtfR~aA~eQ------------L~----~~a~~-----  164 (321)
T Consensus        32 ~~~~kvi~VTS~~pgeGKTtva~nLA~~lA~~~~~~VLLVDaDlr~p~l~~~l~~~~~~Gl~d~L~~~~~~l~~~i~~~~  111 (207)
T TIGR03018        32 KKNNNLIMVTSSLPGEGKSFTAINLAISLAQEYDKTVLLIDADLRRPSLHRTLGLEAEPGLSDCLLDPVLDLADVLVPTN  111 (207)
T ss_pred             CCCCEEEEEECCCCCCCHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCCCHHCCCCCCCCHHHHHCCCCCCHHHHEECCC
T ss_conf             67880999978999998899999999999972498599995357899710013889999856774389987567234268


Q ss_pred             -HCCCCCCC-CCCCCCHHHH----HHHHHHHHHHCCC--EEEEECCCCCCCHH-HHHHHHHHHHHHHHCCCCCCCCEEEE
Q ss_conf             -03532122-3586612454----2289999651487--59986543332115-77899998998763022234301123
Q gi|254780709|r  165 -TSADFVCS-EIGSDAAALA----YEAFKQAQAKKVD--VLIIDTAGRLHNNS-ILMAGIGKMIRVLKRLDPHAPHSVLQ  235 (321)
Q Consensus       165 -~~v~~~~~-~~~~dp~~v~----~~a~~~a~~~~~D--vvliDTAGR~~~~~-~lm~EL~ki~~v~~~~~~~~p~~~~l  235 (321)
T Consensus       112 ~~~l~vlpag~~~~~~~~ll~s~~~~~li~~lr~~yd~~~VIiDtPPvl~~~Da~~la~~--------------~D~vll  177 (207)
T TIGR03018       112 IGRLSLLPAGRRHPNPTELLASQRMRSLLHELARRYPDRIIIIDTPPLLVFSEARALARL--------------VGQIVL  177 (207)
T ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHHHH--------------CCEEEE
T ss_conf             875557516898996676542699999999999737965799838962232369999996--------------896999


Q ss_pred             ECCC-CCCHHHHHH-HHHHHHHCCCCEEEE
Q ss_conf             1023-352257789-998764358976999
Q gi|254780709|r  236 VLDA-TTGQNALRQ-VEMFHAVAGTTGLIM  263 (321)
Q Consensus       236 Vlda-~~gq~~~~~-a~~F~~~~~~~g~I~  263 (321)
T Consensus       178 Vvr~~~t~~~~v~~a~~~L~-~~~vlG~Vl  206 (207)
T TIGR03018       178 VVEEGRTTQEAVKEALSALE-SCKVLGVVL  206 (207)
T ss_pred             EEECCCCCHHHHHHHHHHHC-CCCEEEEEE
T ss_conf             99799878999999999866-898069996