HHsearch alignment for GI: 254780709 and conserved domain: TIGR03371

>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ. Members of this family are the YhjQ protein, found immediately upsteam of bacterial cellulose synthase (bcs) genes in a broad range of bacteria, including both copies of the bcs locus in Klebsiella pneumoniae. In several species it is seen clearly as part of the bcs operon. It is identified as a probable component of the bacterial cellulose metabolic process not only by gene location, but also by partial phylogenetic profiling, or Haft-Selengut algorithm (PMID:16930487), based on a bacterial cellulose biosynthesis genome property profile. Cellulose plays an important role in biofilm formation and structural integrity in some bacteria. Mutants in yhjQ in Escherichia coli, show altered morphology an growth, but the function of YhjQ has not yet been determined.
Probab=98.53  E-value=3.6e-06  Score=63.65  Aligned_cols=159  Identities=19%  Similarity=0.177  Sum_probs=81.7

Q ss_pred             EEECC-CCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHH---------H----------HHHH--HHHHHCCCCC
Q ss_conf             23113-54444424789999999852267426774345124568---------8----------9999--9753035321
Q gi|254780709|r  113 VILVV-GVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAI---------D----------QLKI--WADRTSADFV  170 (321)
Q Consensus       113 vil~v-G~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~---------e----------QL~~--~a~~~~v~~~  170 (321)
T Consensus         3 iIav~n~KGGVGKTT~avNLA~~La~~G~rVLlIDlDpQ~~l~~~~g~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~i   82 (246)
T TIGR03371         3 VIAIVGIKGGVGRTTLTAALASALKLLGEPVLAIDLDPQNLLRLHFGMDWSVRDGWARALLAGEDWRAAAYRSSDGVLFL   82 (246)
T ss_pred             EEEEECCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHCCCCCCCCCCHHHHHHCCCCHHHHHEECCCCEEEE
T ss_conf             99997599985499999999999996899789997599985032248887534569999827998889525578982897


Q ss_pred             CCCC----------CCCCHHHHHHHHHHHHHHCCCEEEEECCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCEEEEECCCC
Q ss_conf             2235----------866124542289999651487599865433321157789999899876302223430112310233
Q gi|254780709|r  171 CSEI----------GSDAAALAYEAFKQAQAKKVDVLIIDTAGRLHNNSILMAGIGKMIRVLKRLDPHAPHSVLQVLDAT  240 (321)
Q Consensus       171 ~~~~----------~~dp~~v~~~a~~~a~~~~~DvvliDTAGR~~~~~~lm~EL~ki~~v~~~~~~~~p~~~~lVlda~  240 (321)
T Consensus        83 p~~~~~~~~~~~~~~~~~~-~l~~~l~~l~~~~~D~viiD~pp~l~~--~~~~-------al~-----aad~vlipv~~~  147 (246)
T TIGR03371        83 PYGTLSADEREAYQAHDAG-WLARLLQQLDLAARDWVLIDLPRGPSP--ITDQ-------ALA-----AADLVLVVVNAD  147 (246)
T ss_pred             ECCCCCHHHHHHHCCCCHH-HHHHHHHHHCCCCCCEEEEECCCCCCH--HHHH-------HHH-----HCCEEEEEECCC
T ss_conf             0898477789876044789-999999863036798899948998749--9999-------999-----889479981899


Q ss_pred             C-CHHHHHH-H---HHHHHHCCCCEEEEECCCCCCCHHH-HHHHH-HHHCCCE
Q ss_conf             5-2257789-9---9876435897699965457870699-99999-9976988
Q gi|254780709|r  241 T-GQNALRQ-V---EMFHAVAGTTGLIMTKMDGTARGGG-LIPIV-VTHKIPV  286 (321)
Q Consensus       241 ~-gq~~~~~-a---~~F~~~~~~~g~I~TKlD~ta~~G~-~ls~~-~~~~~Pi  286 (321)
T Consensus       148 ~~s~~~~~~~~~~~~~~~~~~~~~~iv~n~~~~~~~~~~~~~~~l~~~~~~~~  200 (246)
T TIGR03371       148 AACYATLHQLALALLARSVPPDGIHYLINQFQPARQLSRDVRAVLRATLGSRL  200 (246)
T ss_pred             HHHHHHHHHHHHHHHHHCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             89999999999999984277675178863026401589999999999749881