HHsearch alignment for GI: 254780709 and conserved domain: TIGR03574

>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members of this protein are L-seryl-tRNA(Sec) kinase. This enzyme is part of a two-step pathway in Eukaryota and Archaea for performing selenocysteine biosynthesis by changing serine misacylated on selenocysteine-tRNA to selenocysteine. This enzyme performs the first step, phosphorylation of the OH group of the serine side chain. This family represents archaeal proteins with this activity.
Probab=97.71  E-value=5.9e-05  Score=55.08  Aligned_cols=92  Identities=22%  Similarity=0.356  Sum_probs=55.7

Q ss_pred             EEECCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHH
Q ss_conf             23113544444247899999998522674267743451245688999997530353212235866124542289999651
Q gi|254780709|r  113 VILVVGVNGVGKTTVIGKLSKKMSDAGLKVMLAAGDTFRSAAIDQLKIWADRTSADFVCSEIGSDAAALAYEAFKQAQAK  192 (321)
Q Consensus       113 vil~vG~nG~GKTTT~aKLA~~~~~~g~kV~lva~DtfR~aA~eQL~~~a~~~~v~~~~~~~~~dp~~v~~~a~~~a~~~  192 (321)
T Consensus         1 Livl~GlP~SGKSt~a~~L~~~l~~~~~~~i~~~~d~~~~~----~~~~~~~~---------Ek~~r~~~~~~v~~~l~~   67 (249)
T TIGR03574         1 LIILTGLPGVGKSTFSKELSKKLSEKNIDNIILGTDLIRES----FPVWKEKY---------EEFIRDSTLYLIKTALKN   67 (249)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHHHCCCEEEECCCCCHHH----HHHCCHHH---------HHHHHHHHHHHHHHHHCC
T ss_conf             97896789998999999999999982996599655200212----00033677---------999899999999998433


Q ss_pred             CCCEEEEECCCCCCCHHHHHHHHHHHHHH
Q ss_conf             48759986543332115778999989987
Q gi|254780709|r  193 KVDVLIIDTAGRLHNNSILMAGIGKMIRV  221 (321)
Q Consensus       193 ~~DvvliDTAGR~~~~~~lm~EL~ki~~v  221 (321)
T Consensus        68 ~-~~vI~D~~n---YiKg~RYEL~clAk~   92 (249)
T TIGR03574        68 K-YSVIVDDTN---YYNSKRRDLINIAKE   92 (249)
T ss_pred             C-CEEEECCCC---HHHHHHHHHHHHHHH
T ss_conf             7-669972732---788999999999998